Transportstyrelsens föreskrifter om fartyg som transporterar kondenserade gaser i bulk (GC-koden)
Bemyndigande
Som Transportstyrelsens föreskrifter ska gälla koden för konstruktion och utrustning av fartyg som transporterar kondenserade gaser i bulk (Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk (GCkoden)), som antogs av den internationella sjöfartsorganisationen (IMO) den 12 november 1975 genom resolution A.328(IX) , i lydelsen enligt resolution MSC.447(99) . Den engelska, franska och spanska texten av GC-koden ska ha samma giltighet . Kodens engelska text med ändringar antagna till och med resolution MSC.447(99) finns i bilagan.
Tillämpningsområde
Gastankfartyg byggda före den 1 juli 1986 ska, vid transport av kondenserade gaser i bulk inom Sveriges sjöterritorium, uppfylla kraven i GC-koden. Svenska gastankfartyg ska uppfylla kraven också vid transport utanför sjöterritoriet. Gastankfartyg enligt första stycket får i stället för dessa föreskrifter uppfylla bilaga 2 i Transportstyrelsens föreskrifter och allmänna råd (TSFS 2021:89) om fartyg som transporterar kondenserade gaser i bulk (IGC-koden).
1 Se Europaparlamentets och rådets direktiv (EU) 2015/1535 av den 9 september 2015 om ett informationsförfarande beträffande tekniska föreskrifter och beträffande föreskrifter för informationssamhällets tjänster. A.328(IX), Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk (GC Code). 3 MSC.447(99), Adoption of Amendments to the Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk (GC Code). 4 Texterna på franska och spanska finns tillgängliga hos IMO.
1
Gastankfartyg enligt 2 § som undergår reparation, ändringar, modifieringar och utrustas i samband därmed ska fortsätta att uppfylla åtminstone de krav som tidigare varit tillämpliga för fartyget. Ett sådant fartyg ska uppfylla kraven för fartyg med byggnadsdatum den 1 juli 1986 eller senare i åtminstone samma utsträckning som innan fartyget undergick reparation, ändringar, modifieringar eller utrustades. Om ett fartyg enligt 2 § genomgår en väsentlig förändring ska det uppfylla Transportstyrelsens föreskrifter och allmänna råd (TSFS 2021:89) om fartyg som transporterar kondenserade gaser i bulk (IGC-koden) i den utsträckning som Transportstyrelsen anser att det är rimligt och praktiskt möjligt.
Bestämmelser om krav för fartyg som konverteras till gastankfartyg finns i Transportstyrelsens föreskrifter och allmänna råd (TSFS 2021:89) om fartyg som transporterar kondenserade gaser i bulk (IGC-koden).
Ömsesidighetsklausul
Varor som lagligen saluförs i en annan medlemsstat i Europeiska unionen eller i Turkiet, eller som har sitt ursprung i och som lagligen saluförs i en Eftastat som är part i EES-avtalet förutsätts vara förenliga med dessa regler. Tillämpningen av dessa regler omfattas av Europaparlamentets och rådets förordning (EU) 2019/515 av den 19 mars 2019 om ömsesidigt erkännande av varor som är lagligen saluförda i en annan medlemsstat och om upphävande av förordning (EG) nr 764/2008.
Definitioner
I dessa föreskrifter används följande termer och definitioner. fartyg byggda fartyg som är kölsträckt eller befinner sig på motsvarande byggnadsstadium gastankfartyg lastfartyg som är byggt eller anpassat för och som används för bulktransport av kondenserad gas eller andra produkter uppräknade i kapitel 19 i IGC-koden motsvarande byggnation som kan identifieras till ett visst fartyg byggnadsstadium har påbörjats och sammanfogning av fartyget har nått en omfattning av minst 50 ton eller 1 % av den uppskattade totalvikten av allt material som ingår i fartygets struktur, varvid den lägsta angivelsen ska gälla väsentlig ändrade huvuddimensioner eller utökad kapacitet
förändring
Undantag
Transportstyrelsen kan, om det finns särskilda skäl, medge undantag från dessa föreskrifter om det inte strider mot internationella överenskommelser eller gemenskapsrättslig lagstiftning.
2
Ikraftträdande och övergångsbestämmelser
1. Denna författning träder i kraft den 1 mars 2022. 2. Sjöfartsverkets och Transportstyrelsens beslut som gäller då denna författning träder i kraft gäller även efter ikraftträdandet av denna författning. Sådana beslut som meddelats av Sjöfartsverket ska anses ha meddelats av Transportstyrelsen. Sjöfartsverkets och Transportstyrelsens beslut gäller till dess att Transportstyrelsen meddelar ett nytt beslut eller giltighetstiden för beslutet går ut.
På Transportstyrelsens vägnar
JONAS BJELFVENSTAM Robin Cook (Sjö- och luftfart)
Utgivare: Kristina Nilsson, Transportstyrelsen, Norrköping ISSN 2000-1975 3
Bilaga
Title RESOLUTIONs / Assembly / 9th Session / Res.A.328(9) Superseded by Res.MSC.5(48), Amended by Res.MSC.25(60), Res.MSC.34(63),
Note
Res.MSC.60(67). Res.MSC.107(73), Res.MSC.182(79).
RESOLUTION A.328 (IX)
Adopted on 12 November 1975
Agenda item 7(c)
CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK
The Assembly, NOTING Article 16(i) of the IMCO Convention concerning the functions of the Assembly, RECOGNIZING that the rapid increase in sea transport of liquefied gases in bulk gives rise to the urgent need for international standards to ensure their safe carriage, with a view to avoiding or minimizing the risk to ships crew, personnel of shore installations and to the environment, RECALLING that when it adopted in Resolution A.212(7) the Code for the Construction and Equipment of Ships Carrying Dangerous Chemicals in Bulk (Bulk Chemical Code), it requested the Maritime Safety Committee to draw up inter alia a code to cover the carriage of liquefied gases in bulk, NOTING ALSO that the International Conference on Marine Pollution, 1973, adopted with Resolution 16 the Recommendation concerning the prevention of pollution by liquefied gases carried in bulk, HAVING CONSIDERED the Recommendation by the Maritime Safety Committee at its thirty-second session, RECOGNIZING FURTHER that gas ship design technology is rapidly evolving, ADOPTS the Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk (Gas Carrier Code), the text of which is set out at Annex to this Resolution, INVITES all governments concerned to take appropriate steps to give effect to the Code as soon as possible, and to inform the Organization on measures taken in this respect, REQUESTS the Maritime Safety Committee to continue its study on this subject, AUTHORIZES the Maritime Safety Committee to amend the Code as may be necessary.
ANNEX
CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK
PREAMBLE 1. The Code has been developed to provide an international standard for the safe carriage by sea in bulk of liquefied gases and certain other substances listed in Chapter XIX, by prescribing the design and constructional features of ships involved in such carriage and the equipment they should carry so as to minimize the risk to the ship, its crew and to the environment having regard to the nature of the products involved. 2. The basic philosophy is one of ship types related to the hazards of the products covered by the Code. Each of the products may have one or more hazard properties which include flammability, toxicity, corrosivity and reactivity. A further possible hazard may arise due to the products being transported under cryogenic or pressure conditions. 3. Throughout the development of the Code it was recognized that it must be based upon sound naval architectural and engineering principles and the best understanding available as to the hazards of the various products covered; furthermore that gas ship design technology is not only a complex technology but is rapidly evolving and that the Code should not remain static but be continually re-evaluated and revised. To this end the Organization will periodically
5
Bilaga
review the Code taking into account both experience and future development. 4. In the preparation of the Code it was recognized that severe collisions or strandings could lead to cargo tank damage and result in uncontrolled release of the product. Such release could result in evaporation and dispersion of the product and, in some cases, cause brittle fracture of a ship's hull. The requirements in the Code are intended to minimize this risk as far as is practicable, based upon present knowledge and technology. 5. The Code primarily deals with ship design and equipment. In order to ensure the safe transport of the products the total system must, however, be appraised. Other important facets of the safe transport of the products, such as training, operation, traffic control and handling in port, are being or will be examined further by the Organization. 6. The development of the Code has been greatly assisted by the work of the International Association of Classification Societies (IACS) and full account has been taken of the IACS Unified Requirements for Liquefied Gas Tankers in Chapters IV, V and VI. 7. The development of Chapter X has been greatly assisted by the relevant work of the International Electrotechnical Commission (IEC). 8. Chapter XVIII of the Code dealing with the operation of liquefied gas tankers, highlights the regulations in other chapters that are operational in nature and mentions those other important safety features that are peculiar to gas ship operation. 9. The Code has been laid out in a manner similar to the Code for the Construction and Equipment of Ships Carrying Dangerous Chemicals in Bulk (Resolution A.212(7) and every effort has been made, where appropriate, to make the two Codes compatible. Further efforts are, however, required to align the Codes. 10. This Code is applicable to new ships as provided for in paragraph 1.2. Interim procedures for utilizing this Code in evaluating certain of the other ships are contained in Resolution A.329(9) pending the development of a separate code for other liquefied gas tankers.
CONTENTS
Chapter I - General 1.1 Purpose 1.2 Application 1.3 Hazards 1.4 Definitions 1 5 Equivalents 1.6 Surveys and certification 1.7 Review of the Code Chapter II - Ship Survival Capability and Cargo Tank Location 2.1 General 2.2 Freeboard and stability 2.3 Damage and flooding assumptions 2.4 Survival requirements 2.5 Standard of damage to be applied 2.6 Location of cargo tanks 2.7 Special consideration for small ships Chapter III - Ship Arrangements 3.1 Segregation of the cargo area 3.2 Accommodation, service and control station spaces
6
Bilaga
3.3 Cargo pump rooms and cargo compressor rooms ] 3.4 Cargo control rooms 3.5 Access to spaces in the cargo area 3.6 Air-locks 3.7 Bilge and ballast arrangements 3.8 Bow or stern loading and discharge arrangements Chapter IV - Cargo Containment 4.1 General 4.2 Definitions 4.3 Design loads 4.4 Structural analysis 4.5 Allowable stresses and corrosion allowance 4.6 Supports 4.7 Secondary barrier ] 4.8 Insulation 4.9 Materials 4.10 Construction and testing 4.11 Stress relieving for independent tanks type C 4.12 Guidance formulae for acceleration components 4.13 Stress categories Chapter V - Process Pressure Vessels and Liquid, Vapour. and Pressure Piping Systems 5.1 General 5.2 Cargo and process piping 5.3 Cargo system valving requirements 5.4 Ship's cargo hoses 5.5 Cargo transfer methods Chapter VI - Materials of Construction 6.1 General 6.2 Material requirements 6.3 Welding and non-destructive testing Chapter VII - Cargo Pressure / Temperature Control 7.1 General 7.2 Refrigeration systems Chapter VIII - Cargo Vent Systems 8.1 General 8.2 Pressure relief systems 8.3 Additional pressure relieving system 8.4 Vacuum protection systems 8.5 Size of valves
7
Bilaga
Chapter IX - Environmental Control for Cargo Containment Systems 9.1 Environmental control within cargo tanks and cargo piping systems 9.2 Environmental control within the hold spaces (cargo containment systems other than independent tanks type C) 9.3 Environmental control of spaces surrounding independent tanks type C 9.4 Inerting 9.5 Inert gas production on board Chapter X - Electrical Arrangements 10.1 General 10.2 Types of equipment Chapter XI - Fire Protection and Fire Extinguishing 11.1 Structural fire protection 11.2 Fire water main equipment 11.3 Water spray system 11.4 Dry chemical powder fire extinguishing systems 11.5 Gas-dangerous enclosed spaces 11.6 Firemen's outfits and protective clothing Chapter XII - Mechanical Ventilation in Cargo Area 12.1 Spaces required to be entered during normal cargo handling operations 12.2 Spaces not normally entered Chapter XIII - Instrumentation (Gauging, Gas Detection) 13.1 General 13.2 Level indicators for cargo tanks 13.3 Liquid level alarms 13.4 Pressure gauges 13.5 Temperature indicating devices 13.6 Gas detection requirements Chapter XIV - Personnel Protection Chapter XV - Filling Limits for Cargo Tanks 15.1 General 15.2 Information to be provided to the master Chapter XVI - Use of Cargo as Fuel Chapter XVII - Special Requirements 17.1 General 17.2 Personnel protection 17.3 Materials of construction 17.4 Independent tank type C 17 5 Refrigeration systems 17.6 Deck cargo piping
8
Bilaga
17.7 Bow or stern loading and discharge lines 17.8 Exclusion of air from vapour spaces 17.9 Moisture control 17.10 Inhibition 17 11 Permanently installed toxic gas detectors 17.12 Special requirements for individual gases Chapter XVIII - Operating Requirements 18.1 Information required to be carried 18.2 Compatibility 18.3 Personnel training 18.4 Entry into spaces 18.5 Carriage of cargo at low temperature 18.6 Protective clothing 18.7 Systems and controls 18.8 Cargo transfer operations 18.9 Additional operating requirements Chapter XIX - Summary of Minimum Requirements Appendix - Model Form of Certificate of Fitness for the Carriage of Liquefied Gases in Bulk
CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK
CHAPTER I - GENERAL
1.1 Purpose The purpose of this Code, in the following referred to as the Code, is to recommend suitable design criteria, construction standards and other safety measures for ships transporting liquefied gases and certain other substances in bulk so as to minimize the risk to the ship, its crew and to the environment. 1.2 Application 1.2.1 The Code applies to products which are liquefied gases having a vapour pressure exceeding 2.8 kp/cm² absolute at a temperature of 37.8°C, and certain other substances as shown in Chapter XIX, when carried in bulk on board ships, regardless of their size. 1.2.2 Subject to 1.2.1, the Code applies in its entirety to ships: (i) for which the building contract is placed after 31 October 1976; or (ii) in the absence of a building contract, the keel of which is laid or which is at a similar stage of construction after 31 December 1976, or (iii) the delivery of which is after 30 June 1980; or (iv) which have undergone a major conversion: (1) for which the contract is placed after 31 October 1976; or (2) in the absence of a contract the conversion of which is begun after 31 December 1976; or (3) which is completed after 30 June 1980. 1.2.3 Any ship which fully complies with the provisions of this Code may be regarded as a ship as referred to in 1.2.2. 1.2.4 Compliance of the ship with 1.2.2 or 1.2.3 as appropriate should be shown on the Certificate of Fitness provided
9
Bilaga
for in 1.6.
1.3 Hazards
Hazards of gases considered in this Code include fire, toxicity, corrosivity, reactivity, low temperature and pressure.
1.4 Definitions
Except where expressly provided otherwise, the tool lowing definitions apply to the Code . Additional definitions are given in 4.2.
1.4.1 "Cargoes" are products listed in Chapter XIX carried in bulk by ships subject to the Code.
1.4.2 "Vapour pressure" is the absolute equilibrium pressure of the saturated vapour above the liquid expressed in kp/cm² at a specified temperature.
1.4.3 "Boiling point" is the temperature at which a product exhibits a vapour pressure equal to the atmospheric barometric pressure.
1.4.4 "Flammable range" is the range between the minimum and maximum concentrations of vapour in air which forms flammable mixtures.
1.4.5 "Vapour density" is the relative weight of the vapour compared with the weight of an equal volume of dry air at standard conditions of temperature and pressure.
1.4.6 "Cargo area" is that part of the ship which contains the cargo containment system and cargo pump and compressor rooms and includes deck areas over the full beam and length of the ship above the foregoing. Where fitted, the cofferdams, ballast or void spaces at the after end of the after most hold space or the forward end of the forward most hold space are excluded from the cargo area.
1.4.7 "Cargo containment system" is the arrangement for containment of cargo including, where fitted, a primary and secondary barrier, associated insulation and any intervening spaces, and adjacent structure if necessary for the support of these elements. If the secondary barrier is part of the hull structure it may be a boundary of the hold space.
1.4.8 "Cargo tank" is the liquid-tight shell designed to be the primary container of the cargo and includes all such containers whether or not associated with insulation and/or secondary barriers.
1.4.9 "Primary barrier" is the inner element designed to contain the cargo when the cargo containment system includes two boundaries.
1.4.10 "Secondary barrier" is the liquid resisting outer element of a cargo containment system designed to afford temporary containment of any envisaged leakage of liquid cargo through the primary barrier and to prevent the lowering of the temperature of the ship's structure to an unsafe level. Types of secondary barrier are more fully defined in Chapter IV.
1.4.11 "Hold space" is the space enclosed by the ship's structure in which a cargo containment system is situated .
1.4.12 "Interbarrier space" is the space between a primary and a secondary barrier, whether or not completely or partially occupied by insulation or other material.
1.4.13 "Insulation space" is the space, which may or may not be an interbarrier space, occupied wholly or in part by insulation.
1.4.14 "Void space" is the enclosed space in the cargo area external to a cargo containment system, not being a hold space, ballast space, fuel oil tank, cargo pump or compressor room, or any space in normal use by personnel.
1.4.15 "Cofferdam" is the isolating space between two adjacent steel bulkheads or decks. This space may be a void space or ballast space.
1.4.16 "Gas-dangerous spaces or zones" are:
(a) a space in the cargo area which is not equipped with approved arrangements to ensure that its atmosphere is at all times maintained in a safe condition;
(b) an enclosed space outside the cargo area through which any piping, which may contain liquid or gaseous products, passes, or within which such piping terminates, unless approved arrangements are installed to prevent any escape of product vapour into the atmosphere of that space;
(c) a cargo containment system and cargo piping;
10
Bilaga
(d)
(i) a hold space where cargo is carried in a cargo containment system requiring a secondary barrier;
(ii) a hold space where cargo is carried in a cargo containment system nor requiring a secondary barrier;
(e) a space separated from a hold space described in sub-paragraph (d)(i) of this paragraph by a single gastight steel boundary;
(f) a cargo pump room and cargo compressor room;
(g) a zone on the open deck, or semi-enclosed space on the open deck, within 3 m of any cargo tank outlet, gas or vapour outlet, cargo pipe flange, cargo valve or of entrances and ventilation openings to cargo pump rooms and cargo compressor rooms;
(h) the open deck over the cargo area and 3 m forward and aft of the cargo area on the open deck up to a height of 2.4 m above the weather deck;
(i) a zone within 2.4 m of the outer surface of a cargo containment system where such surface is exposed to the weather;
(j) an enclosed or semi-enclosed space in which pipes containing products are located, A space which contains gas detection equipment complying with 13.63 and a space utilizing boil-off gas as fuel and complying with Chapter XVI are not considered gas-dangerous spaces in this context;
(k) a compartment for cargo hoses; and
(l) an enclosed or semi-enclosed space having a direct opening into any gas-dangerous space or zone.
1.4.17 "Gas-safe space" is a space not being a gas-dangerous space.
1.4.18 "Tank cover" is the protective structure intended to protect the cargo containment system against damage where it protrudes through the weather deck and/or to ensure the continuity and integrity of the deck structure.
1.4.19 "Tank dome" is the upward extension of a portion of the cargo tank. For below deck cargo containment systems the tank dome protrudes through the weather deck or through a tank cover.
1.4.20 "Accommodation spaces" are those used for public spaces, corridors, lavatories, cable offices, hospitals, cinemas, games and hobbies rooms, pantries containing no cooking appliance and similar spaces. Public spaces are those portions of the accommodation which are used as halls, dining rooms, lounges and similar permanently enclosed spaces.
1.4.21 "Service spaces" are spaces outside the cargo area used for galleys, pantries containing cooking appliances, lockers and store-rooms, workshops other than those forming part of the machinery spaces and similar spaces and trunks to such spaces.
1.4.22 "Cargo service spaces" are spaces within the cargo area used for workshops, lockers and store-rooms of more than 2 m² in area.
1.4.23 "Control stations" are those spaces in which ships radio or main navigating equipment or the emergency source of power is located or where the fire recording or fire control equipment is centralized, this does not include special fire control equipment which can be most practically located in the cargo area.
1.4.24 "Cargo control room" is a space used in the control of cargo handling operations and complying with the requirements of 3.4.
1.4.25 "Length (L)" means ninety-six per cent of the total length on a water-line at eighty five per cent of the least moulded depth measured from the top of the keel, or the length from the foreside of the stem to the axis of the rudder stock on that water-line, if that be greater. In ships designed with a rake of keel, the water-line on which this length is measured should be parallel to the designed water-line. The length (L) should be measured in metres.
1.4.26 "Breadth (B)" means the maximum breadth of the ship, measured amidships to the moulded line of the frame in a ship with a metal shell and to the outer surface of the hull in a ship with a shell of any other material. The breadth (B) should be measured in metres.
1.4.27 "Permeability of a space" means the ratio of the volume within that space which is assumed to be occupied by water to the total volume of that space.
1.4.28 "1974 Safety Convention" means the International Convention on Safety of Life at Sea, 1974.
1.4.29 " 'A'Class divisions" mean divisions as defined in Regulation 3 of Chapter II-2 of the 1974 Safety Convention.
11
Bilaga
1.4.30 "MARVS" means the maximum allowable relief valve setting of a cargo tank.
1.4.31 "Administration" means the Government of the country in which the ship is registered
1.4.32 "Organization" means the Inter-Governmental Maritime Consultative Organization ( IMCO).
1.4.33 For the purposes of Chapters IV, V and VI of the Code, "Recognized Standards" are standards laid down and maintained by a classification society recognized by the Administration.
1.4.34 "Flammable products" are identified by an "I" in column "f" of Chapter XIX,
1.4.35 ''Toxic products" are identified by a "T" in column "f" of Chapter XIX.
1.5 Equivalents
1.5.1 Where the Code requires that a particular fitting, material, appliance, apparatus, item of equipment or type thereof should be fitted or carried in a ship, or that any particular provision should be made, or any procedure or arrangement should be complied with, the Administration may allow any other fitting, material, appliance, apparatus, item of equipment or type thereof to be fitted or carried, or any other provision, procedure or arrangement to be made in that ship, if it is satisfied by trial thereof or otherwise that such fitting, material, appliance, apparatus, item of equipment or type thereof or that any particular provision, procedure or arrangement is at least as effective as that required by the Code. This authority of the Administration should not extend to substitution of operational methods or procedures for a particular fitting, material, appliance, apparatus, item of equipment, or type thereof which are prescribed by the Code.
1.5.2 When an Administration so allows any fitting, material, appliance, apparatus, item of equipment, or type thereof, or provision. procedure or arrangement to be substituted, it should communicate to the Organization the particulars thereof together with a report on the evidence submitted, so that the Organization may circulate them.
1.6 Surveys and certification
1.6.1 Every ship should be subject to the surveys specified below:
(a) An initial survey before the ship is put into service or before the Certificate of Fitness required under this section of the Code is issued for the first lime which should include a complete survey of its structure, equipment, fittings, arrangements and material in so far as the ship is covered by the Code. This survey should be such as to ensure that the structure, equipment, fittings, arrangements and material fully comply with the applicable provisions of the Code.
(b) Periodical surveys at intervals specified by the Administration, but not exceeding five years, which should be such as to ensure that the structure, equipment, fittings, arrangements and material fully comply with the applicable provisions of the Code. However, where the duration of the Certificate of Fitness is extended as specified in 1.6.8, the interval of the periodical survey may be extended correspondingly.
(c) Intermediate surveys at intervals specified by the Administration but not exceeding 30 months which should be such as to ensure that the safety equipment, and other equipment, and associated pump and piping systems fully comply with the applicable provisions of this Code and are in good working order Such intermediate surveys should be endorsed on the Certificate of Fitness issued under the provisions of this section.
1.6.2 These surveys should be carried out by officers of the Administration. The Administration may, however, entrust the surveys either to surveyors nominated for the purpose or to organizations recognized by it. In every case the Administration concerned should fully guarantee the completeness and efficiency of the surveys.
1.6.3 After any survey under this section has been completed no significant change should be made in the structure, equipment, fittings, arrangements or material covered by the survey, without the sanction of the Administration, except the direct replacement of such equipment and fittings for the purpose of repair or maintenance.
1.6.4 A Certificate of Fitness for the carriage of liquefied gases in bulk may be issued, after survey in accordance with this section, either by the Administration or any person or Organization duly authorized by it. In every case the Administration assumes full responsibility for the Certificate.
1.6.5 The Certificate of Fitness for the Carriage of Liquefied Gases in Bulk should be drawn up in an official language of the issuing country in the form corresponding to the model given in the Appendix to the Code. If the language used is neither English nor French, the text should include a translation into one of these languages.
1.6.6 A Certificate of Fitness issued under the authority of Administrations under the provisions of this section should be accepted by other Administrations for all purposes covered by the Code and should be regarded as having the same force as certificates issued by them
1.6.7 A Certificate of fitness should be issued for a period specified by the Administration, and should nor exceed
12
Bilaga
5 years from the date of issue, except as provided in 1.6.8.
1.6.8 A Certificate of Fitness may be extended by the Administration for a period of grace of up to one month from the date of expiry staled thereon.
1.6.9 A Certificate of Fitness should cease to be valid if significant alterations have been made in the construction, equipment, fittings, arrangements or material required without the sanction of the Administration, except the direct replacement of such equipment or fittings for the purpose of repair or maintenance, or if intermediate surveys as specified by the Administration under the provisions of 1.6.1 (c) are not carried out.
1.6.10 A certificate issued to a ship should cease to be valid upon transfer of such a ship to the flag of another country.
1.7 Review of the Code
1.7.1 The Code will be reviewed by the Organization at intervals preferably not exceeding twelve months to consider revision of existing requirements and the formulation of requirements for new products and new developments in design and technology.
1.7.2 Where it is proposed to carry products which may be considered to come within the scope of the Code but are not at present designated in Chapter XIX, the Administrations involved in such carriage should establish suitable conditions of carriage based on the principles of the Code and notify the Organization of such conditions. During the periodical review of the Code these submissions will be considered for inclusion.
1.7.3 Where a new development in design and technology has been found acceptable to an Administration, that Administration may submit particulars of such development to the Organization for consideration for incorporation into the Code during the periodical review.
CHAPTER II- SHIP SURVIVAL CAPABILITY AND CARGO TANK LOCATION
2.1 General
2.1.1 Ships subject to the Code should survive the normal effects of flooding following assumed hull damage caused by some external force. in addition, to safeguard the ship and the environment, the cargo tanks should be protected from penetration in the case of minor damage to the ship resulting, for example, from contact with a jetty or tug, and given a measure of protection from damage in the case of collision or stranding, by locating them at specified minimum distances inboard from the ship's shell plating. Both the damage to be assumed and the proximity of the cargo tanks to the ship's shell should be dependent upon the degree of hazard considered to be presented by the product to be carried.
2.1.2 Ships subject to the Code should be designed to one of the following standards. Type IG for the transportation of products considered to present the greatest overall hazard and Types IIG/IIPG and IIIG for products of progressively lesser hazards. Accordingly, a Type IG ship should survive the greatest extent of hull damage and its cargo tanks should be located at the greatest distance inboard from the shell plating.
2.1.3 The ship type required for individual products is indicated in column "c" of Chapter XIX.
2.1.4 When it is intended to carry more than one product covered by the Code, or by the Code and the Code for the Construction and Equipment of Ships Carrying Dangerous Chemicals in Bulk, adopted by the Organization with Assembly Resolution A.212(7), the requirements for ship survival will be those appropriate to the product having the most stringent ship type requirement. The requirements for the location of cargo tanks, however, will be those related to the respective products.
2.2 Freeboard and stability
2.2.1 Ships subject to the Code may be assigned the minimum freeboard permitted by the International Convention on Load Lines,1966. The additional requirements in 2.5 and 2.6, taking into account any empty or partially filled tank as well as the weight and volume of products to be carried, should, however, govern the operating draught for any actual condition of loading.
2.2.2 The stability of the ship in all seagoing conditions and during the process of loading and unloading cargo should be positive and to a standard which is acceptable to the Administration.
2.2.3 The master of the ship should be supplied with a Loading and Stability Information booklet. This booklet should contain details of typical service conditions, loading and unloading and ballasting operations and a summary of the ship's survival capabilities and provisions for evaluating Other conditions of loading. In addition, the booklet Should Contain sufficient information regarding the ship and its cargo to enable the master to load and operate the ship in a safe and seaworthy manner.
2.3 Damage and flooding assumptions
2.3.1 The following permeability factors should be applied to spaces assumed to be flooded:
13
Bilaga
spaces permeability appropriated to stores 0.60 occupied by accommodation 0.95 occupied by machinery 0.85 voids 0.95 intended for consumable liquids 0 or 0.95* intended for other liquids 0 to 0.95** * Whichever results in the more severe requirements. ** The permeability of partially filled compartments should be consistent with the amount of liquid Carried. Wherever damage penetrates a cargo tank it should be assumed that the cargo is completely lost from that compartment and replaced by salt water up to the level of the final plane of equilibrium. 2.3.2 Assumed maximum extent of damage: (a) Side damage: (i) Longitudinal extent L2/3/3 or 14.5 m whichever is less. Transverse extent (inboard from the ship's side at right (ii) B/5 or 11.5 m whichever is less angles to the centreline at the level of the load line) (iii) Vertical extent: from the base line upwards without limit. (b) Bottom damage: For 0-3L from the forward Any other part perpendicular of ship of ship (i)Longitudinal extent : 1/3L2/3 or 14.5 m L/10 or 5 m, whichever is less. whichever is less. (ii)Transverse extent : B/6 or 10.0 m B/6 or 5 m whichever is less. whichever is less. (iii)Vertical extent : B/15 or 2m whichever is B/15 or 2m whichever less, measured from the is less, measured from moulded line of the shell the moulded line of at the centre line. the shell at the centreline. (c) If any damage of a lesser extent than the maximum specified would result in a more severe condition, such damage should be considered. 2.4 Survival requirements 2.4.1 Ships subject to the Code should be capable of surviving the damage assumed in 2.3 to the extent provided in 2.5 in a condition of startle equilibrium and should satisfy the following criteria. (a) In any stage of flooding: (i) The water-line taking into account sinkage, heel and trim should be below the lower edge of any opening through which progressive or down flooding may take place. Such openings should include air pipes and those which are closed by means of weathertight doors or hatch covers and may exclude those openings closed by means of watertight manhole covers and watertight flush scuttles, small watertight cargo tank hatch covers which maintain the high integrity of the deck, remotely operated watertight sliding doors, and side scuttles of the non-opening type. Credit may be given to any portion of the structure which remains watertight above or below the freeboard deck . (ii) Where damage produces an angle of heel, the maximum angle at any stage of flooding should not exceed 30°. (iii) The Administration should be satisfied that the residual stability is sufficient. (b) In the final stage of flooding: (i) The righting lever curve has a minimum range of 20°beyond the position of equilibrium in association with a maximum righting lever of at least 100 mm within this range. Unprotected openings should not be immersed within the minimum range of residual stability required unless the space concerned is included in damage stability calculations as a floodable space. Within this range the immersion of all openings listed in 2.4.1 (a)(i) and others capable of being closed weathertight may be permitted. (ii) The life-saving devices should be capable of operating at the final angle of heel from the lower side of
14
Bilaga
the vessel.
(iii)The emergency power supply should be capable of operating at the final angle of heel.
2.4.2 Under local damage conditions in the cargo area, extending in 760 mm measured normal to the hull shell and which for a Type lG ship and a Type IIG/IIPG ship in accordance with 2.5.1 or 2.5.2(a) and (b) respectively, may occur on a transverse watertight bulkhead, the maximum angle of heel should in no case exceed that applicable under 2.4.1 (a)(iii), and should not reach that angle which would prohibit the restoration of propulsion and steering engine power at reduced speed and the use of the ballast system.
2.4.3 The ship design should ensure that the possibility of hull damage causing asymmetrical flooding is kept to the minimum consistent with efficient arrangements. Equalization arrangements requiring mechanical aids such as valves or cross-levelling pipes, if lilted, should not be considered for the purpose of reducing an angle of heel or attaining the minimum range of stability to meet the requirements of 2.4.1 and 2.4.2 and, if used, sufficient residual stability should be maintained during all stages of equalization. Spaces which are linked by ducts of large cross-sectional area may be considered to be common.
2.4.4 If pipes, ducts, trunks or tunnels are situated within the assumed extent of damage penetration, as defined in 2.3.2, arrangements should be such that progressive flooding cannot thereby extend to compartments other than those assumed to be flooded for each case of damage.
2.5 Standard of damage to be applied
Ships subject to this Code should be designed and constructed so as to be capable of sustaining the damage indicated in 2.3 in the manner stated in 2.4 to the following standards:
2.5.1 All Type lG ships should be capable of sustaining damage anywhere in their lengths.
2.5.2
(a) A Type IIG ship of more than 150 m in length should be capable of sustaining damage anywhere in her length.
(b) A Type IIG ship of 150 m or less in length should be capable of sustaining damage anywhere in her length except involving either of the bulkheads bounding a machinery space located aft; alternatively a Type IIG ship of 150 m or less in length with independent tanks type C design for a MARVS of at least 7 kp/cm² and where the design temperature of the cargo containment system is not below -55 °C, need only be capable of sustaining damage anywhere in her length except involving transverse bulkheads spaced further apart than the longitudinal extent of damage as specified in 2.3.2(a)(i). Such a ship should be designated a Type IIPG ship and so indicated on the Certificate of Fitness provided for in 1.6.
2.5.3
(a) A Type IIIG ship of 125 m in length and over should be capable of sustaining damage anywhere in her length except involving transverse bulkheads spaced further apart than the longitudinal extent of damage specified in 2.3.2(a)(i).
(b) A Type IIIG ship below 125 m in length should be capable of sustaining damage anywhere in her length except involving transverse bulkheads spaced further apart than the longitudinal extent of damage specified in 2.3.2(a) (i) and except involving damage to the machinery space. However, the ability to survive flooding of the machinery space should be considered by the Administration.
2.5.4 Where the damage between adjacent transverse watertight bulkheads is envisaged as specified in 2.5.2(b) and 2.5.3, a main transverse bulkhead or a transverse bulkhead bounding side tanks or double bottom tanks should be assumed damaged if there is a step or a recess in a transverse bulkhead of more than 3.05 m in length, located within the extent of penetration of assumed damage. The step formed by the after peak bulkhead and after peak tank top should not be regarded as a step for the purpose of this paragraph.
2.6 Location of cargo tanks
2.6.1 Cargo tanks should be located at the following minimum distances inboard:
(a) Type IG ships: from the side shell plating not less than the transverse extent of damage specified in 2.3.2 (a)(ii) and from the moulded line of the bottom shell plating at centre line not less than the vertical extent of damage specified in 2.3.2(b) (iii), and nowhere less than 760 mm from the shell plating.
(b) Types IIG/IIPG and IIIG ships: from the moulded line of the bottom shell plating at centre line not less than the vertical extent of damage specified in 2.3.2(b)(iii) and nowhere less than 760 mm from the shell plating.
2.6.2 For the purpose of tank location, the vertical extent of damage should be measured to the inner bottom when membrane or semi-membrane tanks are used, otherwise to the bottom of the cargo tanks. The transverse
15
Bilaga
extent of damage should be measured to the longitudinal bulkhead when membrane or semi-membrane tanks are used, otherwise to the side of the cargo tanks. (See Figure 2.1) .
Figure 2.1 - Tank Location Requirements as set out in 2.6
2.6.3 Except for Type IG ships suction wells installed in cargo tanks may protrude into the area of bottom damage provided that such wells are as small as practicable and tee penetration does not exceed 25 percent of double bottom height or 350 mm whichever is less.
2.6.4 Solid ballast should not normally be used in double bottom spaces in the cargo areas. Where, however, because of stability considerations the fitting of solid ballast in such spaces becomes unavoidable. then the quantity and its disposition should be governed by the need to ensure that the impact loads resulting from bottom damage are not directly transmitted on to the cargo tank structure.
2.7 Special consideration for small ships
2.7.1 In the case of small ships intended for the carriage of products requiring Type IIG/IIPG ships and Type IIIG ships which do not comply in all respects with the appropriate requirements of 2.5.2 and 2.5.3, special dispensations may only be considered by the Administration where alternate measures can be taken which maintain the same degree of safety.
2.7.2 In the approval of the design of a ship for which a dispensation has been granted, the nature of the alternate measures prescribed should be clearly stated and be available to the Administration in the countries the ship will visit and any such dispensation should be duly noted on the Certificate of Fitness referred to in 1.6.
CHAPTER III - SHIP ARRANGEMENTS
3.1 Segregation of the cargo area
3.1.1 Hold spaces should be segregated from machinery and boiler spaces, accommodation, service and control station spaces, chain lockers, drinking and domestic water tanks and from stores.
3.1.2 Where cargo is carried in a cargo containment system not requiring a secondary barrier, segregation of hold spaces from spaces referred to in 3.1.1 or spaces either below or outboard of the hold spaces may be effected by cofferdams, fuel oil tanks, or a single gas-tight bulkhead of all welded construction forming an A-60
16
Bilaga
Class division. A gas-tight A-0 Class division is satisfactory if there is no source of ignition or fire hazard in the adjoining spaces.
3.1.3 Where cargo is carried in a cargo containment system requiring a secondary barrier, segregation of hold spaces from spaces referred to in 3.1.1 or spaces either below or outboard of the hold spaces which contain a source of ignition or fire hazard should be effected by cofferdams or fuel oil tanks. If there is no source of ignition or fire hazard in the adjoining space, segregation may be by a single A-0 Class division which is gas-tight.
3.1.4 When cargo is carried in a cargo containment system requiring a secondary barrier :
(a) at temperatures below -10°C, hold spaces should be segregated from the sea by a double bottom; and
(b) at temperatures below -55°C, the ship should also have a longitudinal bulkhead forming side tanks.
3.1.5 Any piping system which may contain cargo or cargo vapour should :
(a) be segregated from other piping systems, except where inter-connexions are required for cargo related operations such as purging, gas freeing or inerting. In such cases, precautions should be taken to ensure that cargo or cargo vapour cannot enter such other piping systems through the inter-connections;
(b) except as provided in Chapter XVI, not pass through any accommodation, service or control station space or through a machinery space ocher than a cargo pump room or cargo compressor space. Emergency cargo dumping arrangements may be led aft externally to accommodation, service or control station spaces or machinery spaces, but should not pass through them;
(c) be connected into the cargo containment system directly from the open deck except that pipes installed in a vertical trunkway or equivalent arrangement may be used to traverse void spaces above a cargo containment system and except that pipes for drainage, venting or purging may traverse cofferdams ;
(d) except for bow or stern loading provisions in accordance with 3.8, and except in accordance with Chapter XVI , be located in the cargo area above the open deck; and
(e) except for thwartship shore connection piping not subject to internal pressure at sea or emergency cargo dumping arrangements, be located inboard of the transverse tank location requirement of 2.6.1.
3.1.6 Arrangements should be made for sealing the weather decks in way of openings for cargo containment systems.
.2 Accommodation, service and control station spaces
3.2.1 No accommodation, service or control station space should be located within the cargo area. The bulkhead of accommodation, service or control station spaces which face the cargo area should be located so as to avoid gas from the hold space entering such spaces through a single failure of a deck or bulkhead on a ship having a containment system requiring a secondary barrier.
3.2.2 In order to guard against the danger of hazardous vapours, due consideration should be given to the location of air intakes and openings into accommodation and machinery spaces in relation to cargo piping, cargo vent systems and machinery space exhausts from gas burning arrangements.
3.2.3 Access through doors, gas-tight or otherwise, should not be permitted from a gas-safe space to a gasdangerous space, except for access to service spaces forward of the cargo area through air-locks as permitted by 3.6.1 when accommodation spaces are aft.
3.2.4 Entrances, air inlets and openings to accommodation, service and control station spaces should not face the cargo area. They should be located on the end bulkhead not facing the cargo area and/or on the outboard side of the house at a distance of at least L/25 but not less than 3.05 m from the end of the house facing the cargo area. This distance, however, need not exceed 5 m. Port lights facing the cargo area and on the sides of the houses within the distance mentioned above should be of the fined (non-opening) type. Wheelhouse windows may be non-fixed and wheelhouse doors may be located within the above limits so long as they are so designed that a rapid and efficient gas and vapour tightening of the wheelhouse can be ensured.
3.2.5 Side scuttles in the shell below the uppermost continuous deck and in the first tier of the superstructure are to be of the fixed (non-opening) type.
3.2.6 All air intakes and openings into the accommodation, service and control station spaces should be fitted with closing devices. For toxic gases they are to be operated from inside the space.
.3 Cargo pump rooms and cargo compressor rooms
3.3.1 Cargo pump rooms and cargo compressor rooms should be situated above the weather deck unless specially approved by the Administration and should be located within the cargo area ,
3.3.2 Where pumps and compressors are driven by shafting passing through a bulkhead or deck, gas-tight seals
17
Bilaga
with efficient lubrication or other means of ensuring the permanence of the gas seal should be fitted in way of the bulkhead or deck.
3.3.3 Arrangements of cargo pump rooms and cargo compressor rooms should be such as to ensure safe unrestricted access for personnel wearing protective clothing and breathing apparatus, and in the event of injury to allow unconscious personnel to be removed. All valves necessary for cargo handling should be readily accessible to personnel wearing protective clothing. Suitable arrangements should be made to deal with drainage of pump and compressor rooms.
3.4 Cargo control rooms
3.4.1 Any cargo control room should be above the weather deck and may be located within accommodation, service or control station spaces or have access thereto providing that:
(a) the cargo control room is a gas-safe space, and
(b) the entrance from the cargo area complies with 3.2.4.
3.4.2 If the cargo control room is designed to be a gas-safe space, instrumentation should, as far as possible, be by indirect reading systems and should in any case be designed to prevent any escape of gas into the atmosphere of that space. Location of the gas detector within the cargo control room will not violate the gas-safe space if installed in accordance with 13.6.5.
3.4.3 If the cargo control room for ships carrying flammable cargoes is a gas-dangerous space, sources of ignition should be excluded. Consideration should be paid to the safety characteristics of any electrical installations.
3.5 Access to spaces in the cargo area
3.5.1 Visual inspection should be possible of at least one side of the inner hull structure without the removal of any fixed structure or fitting.
3.5.2 Inspection of one side of any insulation in hold spaces should be possible. If the integrity of the insulation system can be verified by inspection of the outside of the hold space boundary when tanks are at service temperature, inspection of one side of the insulation in the hold space need not be required.
3.5.3 Arrangements for hold spaces, void spaces and other spaces that could be considered gas-dangerous and cargo tanks should be such as to allow entry and inspection of any such space by personnel wearing protective clothing and breathing apparatus and in the event of injury to allow unconscious personnel to be removed from the space and should comply with the following:
(a) Access should be provided :
(i) to cargo tanks direct from the open deck;
(ii) through horizontal openings, hatches or manholes, the dimensions of which should be sufficient to allow a person wearing a breathing apparatus to ascend or descend any ladder without obstruction and also to provide a clear opening to facilitate the hoisting of an injured person from the bottom of the space, the minimum clear opening of which should be not less than 600 mm by 600 mm; and
(iii) through vertical openings, or manholes providing passage through the length and breadth of the space, the minimum clear opening of which should be not less than 60mm by 800 mm at a height of not more than 600 mm from the bottom plating unless gratings or other footholds are provided.
(b) The dimensions referred to in sub-paragraphs (a) (ii) and (a)(iii) of this paragraph may be decreased if the ability to traverse such openings or to remove an injured person can be proved to the satisfaction of the Administration.
(c) The requirements of sub-paragraphs (a) and (b) of this paragraph do not apply to those spaces described in 1.4.16(e).
3.5.4 Access from the open weather deck to gas-safe spaces should be located in a gas-safe zone at least 2.4 m above the weather deck unless the access is by means of an air-lock in accordance with 3.6.
3.6 Air-locks
3.6.1 An air-lock should only be permitted between a gas-dangerous zone on the open weather deck and a gassafe space and should consist of two steel doors substantially gas-tight spaced not less than 2 m apart.
3.6.2 The doors should be self-closing and without any holding back arrangements.
3.6.3 An audible and visual alarm to give a warning on both sides of the air-lock should be provided to indicate if the securing devices on more than one door are moved from the fully closed position .
18
Bilaga
3.6.4 In ships carrying flammable products, motors in spaces protected by air-locks should be do-energized upon loss of over-pressure in the space.
3.6.5 The air-lock space should be mechanically ventilated from a gas-safe space ann maintained at an overpressure to the gas-dangerous zone on the open weather deck.
3.6.6 The air-lock space should be monitored for cargo vapour.
3.6.7 Subject to the requirements of the International Convention on Load Lines, 1966, the door sill should not be less than 300 mm in height.
3.7 Bilge and ballast arrangements
3.7.1
(a) Where cargo is carried in a cargo containment system not requiring a secondary barrier, hold spaces should be provided with suitable drainage arrangements not connected with the machinery space. Means of detecting such leakage should be provided.
(b) Where there is a secondary barrier, suitable drainage arrangements for dealing with any leakage into the hold or insulation spaces through adjacent ship structure should be provided. The suction should not be led to pumps inside the machinery space. Means of detecting such leakage should be provided.
3.7.2 The interbarrier space should be provided with a drainage system suitable for handling liquid cargo in the event of cargo tank leakage or rupture. Such arrangements should provide for the return of leakage to the cargo tanks.
3.7.3 Ballast spaces and gas-safe spaces may be connected to pumps in the machinery space.
3.8 Bow or stern loading and discharge arrangements
3.8.1 Subject to the approval of the Administration, cargo pipes may be arranged to permit bow or stern loading or discharge subject to the requirements of this section, and of 17.7.
3.8.2 Cargo pipes and related piping and equipment forward or aft of the cargo area should have only welded connexions in way of the house and should be led externally past accommodation, service and control station spaces and machinery spaces and, except for thwartships shore connexion piping, be at least 760 mm inboard. Such pipes should be clearly identified and segregated by at least two valves situated in the cargo area, which can be locked closed under the control of the master, or by one valve and other means together providing an equivalent standard of segregation. Means should be provided between the two valves if fitted, or in an equivalent position with other arrangements, to enable the efficiency of the segregation to be checked.
3.8.3 Arrangements should be made to allow such pipes to be purged after use and maintained gas-safe when not in use. The vent pipes connected with the purge should be located in the cargo area.
3.8.4 Entrances, air inlets and openings to accommodation, service and control stations should not face the bow or stern loading or discharge arrangements. They should be located on the outboard side of the houses at a distance of at least L/25 but not less than 3.05 m from the end of the house facing the bow or stern loading or discharge arrangements (reference is also made to 3.2.4). This distance, however, need not exceed 5 m. Port lights facing these loading and discharging arrangements and on the sides of the house within the distance mentioned above should be of the fixed (non-opening) type. In addition, during the use of the bow or stern loading and discharge arrangements. all doors, ports and other openings on the corresponding house side should be kept closed.
3.8.5 Fire-fighting arrangements for the bow or stern loading and discharge areas should be in accordance with 11.4.7.
CHAPTER IV - CARGO CONTAINMENT
4.1 General
Administrations should take appropriate steps to ensure uniformity in the implementation and application of the provisions of this chapters.*
* Reference is made to the published Rules of members and associate members of the International Association of Classification Societies and in particular to IACS Unified Requirements Nos. 92 and 93.
4.2 Definitions
In addition to those in 1.4, the following definitions apply throughout the Code.
4.2.1 Integral tanks
(a) Integral tanks form a structural part of the ship's hull and are influenced in the same manner and by the
19
Bilaga
same loads which stress the adjacent hull structure. (b) The "design vapour pressure" Po as defined in 4.2.5 should not normally exceed 0.25 kp/cm². If, however, the hull scantlings are increased accordingly, Po may be increased to a higher value but less than 0.7kp/cm². (c) Integral tanks may be used for the products provided that the lowest temperature in any part of the hull structure under no circumstances will fall below -10°C. A lower temperature may be accepted by the Administration subject to special consideration . 4.2.2 Membrane tanks (a) Membrane tanks are non-self-supporting tanks which consist of a thin layer (membrane) supported through insulation by the adjacent hull structure. The membrane is designed in such a way that thermal and other expansion or contraction is compensated for without undue stressing of the membrane. (b) The design vapour pressure Po should not normally exceed 0.25 kp/cm². If, however, the hull scantlings are increased accordingly, and consideration is given, where appropriate, to the strength of the supporting insulation, Po may be increased to a higher value but less than 0.7 kp/cm² (c) The definition of membrane tanks does not exclude designs such as those in which non-metallic membranes are used or in which membranes are included or incorporated in ins- ulation. Such designs require, however, special consideration by the Administration. 4.2.3 Semi-membrane tanks (a) Semi-membrane tanks are non-self-supporting tanks in the loaded condition and consist of a layer, parts of which are supported through insulation by the adjacent hull structure, whereas the rounded parts of this layer connecting the above-mentioned supported parts are designed also to accommodate the thermal and other expansion or contraction. (b) The design vapour pressure Po should not normally exceed 0.25 kp/cm². If, however, the hull scantlings are increased accordingly, and consideration is given, where appropriate, to the strength of the supporting insulation, Po may be increased to a higher value but less than 0.7 kp/cm². 4.2.4 Independent tanks Independent tanks are self-supporting; they do not form part of the ship's hull and are not essential to the hull strength. The three categories of independent tanks are: (a) Independent tanks type A which are designed primarily using Recognized Standards of classical shipstructural analysis procedures. Where such tanks are primarily constructed of plane surfaces (gravity tanks), the design vapour-pressure Po should be less than 0.7 kp/cm². (b) Independent tanks type B which are designed using model tests, refined analytical tools and analysis methods to determine stress levels, fatigue life and crack propagation characteristics. Where such tanks are primarily constructed of plane surfaces (gravity tanks ) the design vapour pressure Po should be less than 0.7 kp/cm². (c) Independent tanks type C (also referred to as pressure vessels) are tanks meeting Pressure vessel criteria and having a design vapour pressure not less than : P =2+AC(Ǐ)3/2 [kp/cm²] --> 0 where
-->
with ıȺ -->=design primary membrane stress -->=allowable dynamic membrane stress (double amplitude at probability level Q=10-8 ) ƩıA 5.5 kp/mm² for ferritic/martensitic steel 2.5 kp/mm² for aluminium alloy (5083-0) C = a characteristic tank dimension to be taken as the greatest of the following: h; 0.75b ; or 0.45 Ǻ with
20
Bilaga
h : height of tank (dimension in Ship's Vertical direction) (m) b : width of tank (dimension in ship's transverse direction) (m) Ǻ : length of tank (dimension in ship's longitudinal directional (m) Ǐ : the relative density of the cargo (Ǐ: 1 for fresh water ) at the design temperature. However, the Administration may allocate a tank complying with the criterion of this sub-paragraph to type A or type B, dependent on the configuration of the tank and the arrangement of its supports and attachments. 4.2.5Design vapour pressure P0 is the maximum gauge pressure at the top of the tank which has been used in the design of the tank. (a) For cargo tanks where there is no temperature control and where the pressure of the cargo is dictated only by the ambient temperature, should not be less than the gauge vapour pressure of the cargo at a temperature of 45°C. However, lesser values of this temperature may be accepted by the Administration for ships operating in restricted areas or on voyages of restricted duration and account may be taken in such cases of any insulation of the tanks. Conversely, higher values of this temperature may be required for ships permanently operating in areas of high ambient temperature. (b) In all cases, including sub-paragraph (a) of this paragraph, Po should not be less than MARVS. (c) Subject to special consideration by the Administration and to the limitations given in 4.2.1 to 4.2.4 for the various tank types, a vapour pressure higher than P0 may be accepted in harbour conditions, where dynamic loads are reduced. 4.2.6 Design temperature for selection of materials is the minimum temperature at which cargo may be loaded and/or transported in the cargo tanks. Provisions to the satisfaction of the Administration should be made so that the tank or cargo temperature cannot be lowered below the design temperature. 4.3 Design loads 4.3.1 (a) Tanks together with their supports and other fixtures should be designed taking into account proper combinations of the various loads listed hereafter: Internal pressure External pressure Dynamic loads due to the motion of the ship Thermal loads Sloshing loads Loads corresponding to ship deflection Tank and cargo weight with the corresponding reactions in way of supports Insulation weight Loads in way of towers and other attachments. The extent to which these loads should be considered depends on the type of tank, and is more fully detailed in the following paragraphs of this section. (b) Account should be taken of the loads corresponding to the pressure test referred to in 4.10. (c) Account should be taken of an increase of vapour pressure in harbour conditions referred to in 4.2.5(c). (d) The tanks should be designed for the most unfavourable static heel angle within the range 0° to 30° without exceeding allowable stresses given in 4.5. 4.3.2 Internal pressure (a) Internal pressure head ( ) in metres of fresh water resulting from the design vapour pressure (P0) and the liquid pressure ( ) defined in sub-paragraph
Equivalent calculation procedures may be applied.
21
Bilaga
The internal liquid pressures are those created by the resulting acceleration of the centre of gravity of the cargo due to the motions of the ship referred to in 4.3.4. The value of internal pressure head ( ) in metres of fresh water resulting from combined effects of gravity and dynamical accelerations should be calculated as follows:
where = dimensionless acceleration (i.e. relative to the acceleration of gravity), resulting from gravitational and dynamical loads, in an arbitrary direction ǃ (see Figure 4.1) = largest liquid height (m) above the point where the pressure is to be determined, in the ǃ direction (see Figure 4.2) = maximum specific weight of the cargo (t/m³ ) at the design temperature. The direction which gives the maximum value of should be considered. Where acceleration in three directions needs to be considered, an ellipsoid should be used instead of the ellipse in Figure 4.1 The above formula applies only to full tanks. 4.3.3 External pressure - External design pressure loads should be based on the difference between the minimum nternal pressure (maximum vacuum) and the maximum external pressure to which any portion of the tank may be subjected simultaneously. 4.3.4 Dynamic loads due to ship motions (a) The determination of dynamic loads should take account of the long-term distribution of ship motions, including the effects of surge, sway, heave, roll, pitch and yaw on irregular seas which the ship will experience during her operating life (normally taken to correspond to wave encounters). Account may be taken of reduction in dynamic loads due to necessary speed reduction and variation of heading when this consideration has also formed part of the hull strength assessment. (b) For design against plastic deformation and buckling the dynamic loads should be taken as the most probable largest loads the ship will encounter during her operating life (normally taken to correspond to a probability level of ). Guidance formulae for acceleration components are given in 4.12. (c) When design against fatigue is to be considered, the dynamic spectrum should be determined by longterm distribution calculation based on the operating life of the ship (normally taken to correspond to 108 wave encounters). If simplified dynamic loading spectra are used for the estimation of the fatigue life, those should be specially considered by the Administration. (d) In order to practically apply crack propagation estimates, simplified load distribution over a period of 15 days may be used. Such distributions may be obtained as indicated in Figure 4.3. (e) Ships for restricted service may be given special consideration. (f) The accelerations acting on tanks are estimated at their centre of gravity and include the tool lowing components: vertical acceleration : motion accelerations of heave, pitch and, possibly, roll (normal to the ship base); transverse acceleration : motion accelerations of sway, yaw and roll; and gravity component of roll; longitudinal acceleration : motion accelerations of surge and pitch; and gravity component of pitch. 4.3.5 Sloshing loads (a) When partial filling is contemplated, the risk of significant loads due to sloshing induced by any of the ship motions referred to in 4.3.4(f) should be considered. (b) When risk of significant sloshing induced loads is found to be present, special tests and calculations should be required. 4.3.6 Thermal loads (a) Transient thermal loads during cooling down periods should be considered for tanks intended for cargo temperatures below -55°C (b) Stationary thermal loads should be considered for tanks where design supporting arrangement and operating temperature may give rise to significant thermal stresses. 4.3.7 Loads on supports - The loads on supports are covered by 4.6. Structural analysis
22
Bilaga
4.4.1 Integral tanks
The structural analysis of integral tanks should be in accordance with Recognized Standards. The tank boundary scantlings should meet at least the requirements for deep tanks taking into account the internal pressure as indicated in 4.3.2, but the resulting scantling should not be less than normally required by such Standards.
4.4.2 Membrane tanks
(a) For membrane tanks, the effects of all static and dynamic loads should be considered to determine the suitability of the membrane and of the associated insulation with respect to plastic deformation and fatigue.
(b) Before approval is given, a model of both the primal and secondary barriers, including corners and joints, should normally be tested to verify that they will withstand the expected combined strains due to static dynamic and thermal loads. Test conditions should represent the most extreme service conditions the cargo containment system will see in its life. Material tests should ensure that ageing is not liable to prevent the materials from carrying out their intended function.
(c) For the purpose of the test referred to in sub-paragraph (b) of this paragraph, a complete analysis of the particular motions, accelerations and response of ships and cargo containment systems should be performed, unless these data are available from similar ships.
(d) Special attention should be paid to the possible collapse of the membrane due to an over-pressure in the interbarrier space, to a possible vacuum in the cargo tank, to the sloshing effects and to hull vibration effects.
(e) A structural analysis of the hull should be to the satisfaction of the Administration, taking into account the internal pressure as indicated in 4.3.2. Special attention, however, should be paid to deflections of the hull and their compatibility with the membrane and associated insulation. Inner hull plating thickness should meet at least the requirements of Recognized Standards for deep tanks taking into account the internal pressure as indicated in 4.3.2. The allowable stress for the membrane, membrane supporting material and insulation should be determined in each particular case.
4.4.3 Semi-membrane tanks - A structural analysis should be performed in accordance with the requirements for membrane tanks or independent tanks as appropriate, taking into account the internal pressure as indicated in 4.3.2.
4.4.4 Independent tanks type A
(a) A structural analysis should be performed to the satisfaction of the Administration taking into account the internal pressure as indicated in 4.3.2. The cargo tank plating thickness should meet at least the requirements of Recognized Standards for deep tanks taking into account the internal pressure as indicated in 4.3.2 and any corrosion allowance required by 4.5.2(a).
(b) For parts, such as structure in ways of supports, not otherwise covered by Recognized Standards, stresses should be determined by direct calculations, taking into account the loads referred to in 4.3 as far as applicable, and the ship deflection in way of supports.
4.4.5 Independent tanks type B
(a) The effects of all dynamic and static loads should be used to determine the suitability of the structure with respect to:
plastic deformation
buckling
fatigue failure
crack propagation
Statistical wave load analyses in accordance with 4.3.4, finite element analyses or similar methods and fracture mechanics analyses or an equivalent approach, should be carried out.
(b) A three-dimensional analysis should be carried out to evaluate the stress levels contributed by the ship's hull. The model for this analysis should include the cargo tank with its supporting and keying system as a reasonable part of the hull.
(c) A complete analysis of the particular ship accelerations and motions in irregular waves and of the response of ships and cargo tanks to these forces and motions should be performed unless these data are available from similar ships.
(d) A buckling analysis should consider the maximum construction tolerances.
(e) Where deemed necessary by the Administration, model tests may be required to determine stress
23
Bilaga
concentration factors and fatigue life of structural elements. (f) The cumulative effect of the fatigue load should comply with:
where
Nj=number of stress cycles at each stress level during the life of the ship Nj=number of cycles to fracture for the respective stress level according to the Wohler (S-N) curve Ni=number of cycles to fracture for the fatigue loads due to loading and unloading Cw=should be less than or equal to 0.5, except that the Administration may give special consideration to the use of a value greater than 0.5 but not greater than 1.0, dependent on the test procedure and data used to establish the Wohler (S-N) curve. 4.4.6 Independent tanks type C (a) Scantlings based on internal pressure
(i) The thickness and form of pressure containing parts of pressure vessels under internal pressure, including flanges should be determined according to a standard acceptable to the Administration. These calculations in all cases should be based on generally accepted pressure vessel design theory. Openings in pressure containing parts of pressure vessels should be reinforced in accordance with a standard acceptable to the Administration.
(ii) The design liquid pressure defined in 4.3.2 should be taken into account when calculations are made according to 4.4.6(a)(i). (iii) The welded joints efficiency factor to be used in the calculation according to 4.4.6(a) (i) should be 0.95 when the inspection and the non-destructive testing referred to in 4.10.7 are carried out. This figure may be increased up to 1.0 when account is taken of other considerations, such as the material used, type of joints, welding procedure and type of loading. For process pressure vessels the Administration may accept partial nondestructive examinations, but not less than those of 4.10.7(b) (ii) depending on such factors as the material used, the design temperature, the nil ductility transition temperature of the material as fabricated, the type of joint and welding procedure, but in this case an efficiency factor of not more than 0.85 should be adopted. For special materials, the above-mentioned factors should be reduced depending on the specified mechanical properties of the welded joint. (b) Buckling criteria
(i) The thickness and form of pressure vessels subject to external pressure and other loads causing compressive stresses should be to a standard acceptable to the Administration. These calculations in all cases should be based on generally accepted pressure vessel buckling theory and should adequately account for the difference in theoretical and actual buckling stress as a result of plate edge misalignment, ovality and deviation from true circular form over a specified arc or chord length.
(ii) Design external pressure The design external Pressure (Pe) used for verifying the buckling of the pressure vessels should not be less than that given by: Po=P1+P2+P3+P4(kp/cm3)
where P1=setting value of vacuum relief valves. For vessels not fitted with vacuum relief valves P1 should be specially considered, but should not in general be taken as less than 0.25 kp/ cm² . P2=the set pressure of the pressure relief valves for completely closed spaces containing pressure vessels or parts of pressure vessels ; elsewhere, P2=0. P3=compressive actions in the shell due to the weight and contraction of insulation, weight of shell, including corrosion allowance, and other miscellaneous external pressure loads to which the pressure vessel may be subjected. These include, but are nor limited to, weight of domes, weight of towers and piping, effect of product in the partially filled condition, accelerations and hull deflection. In addition the local effect of external and/or internal pressure should be taken into account. P4=external pressure due to head of water for pressure vessels or part of pressure vessels on exposed decks; elsewhere P4 = 0.
24
Bilaga
(c) Stress analysis in respect of static and dynamic loads (i) Pressure vessel scantlings should be determined in accordance with sub-paragraphs (a) and (b) of this paragraph. (ii) Calculations of the loads and stresses in way of the supports and the shell attachment of the support should be made. Loads referred to in 4.3 should be used, as applicable. Stresses in way of the supports should be to a standard acceptable to the Administration. In special cases a fatigue analysis may be required by the Administration. (iii) If required by the Administration, secondary stresses and thermal stresses should be specially considered. (d) Plate tolerance For pressure vessels, the thickness calculated according to 4.4.6(a) or the thickness required by 4.4.6(b) plus the corrosion allowance, if any, should be considered as a minimum without any negative tolerance. (e) Minimum thickness of shell and heads For pressure vessels, the minimum thickness of shell and heads including corrosion allowance, after forming. should not be less than 5 mm for carbon-manganese steels and nickel steels, 3 mm for austenitic steels or 7 mm for aluminium alloys. 4.5 Allowable stresses and corrosion allowance 4.5.1 Allowable stresses (a) For integral tanks, allowable stresses should normally be those given for hull structure in Recognized Standards. (b) For membrane tanks, reference is made to the requirements of 4.4.2(e) (c) For independent tanks type A primarily constructed of plane surfaces, the stresses for primary and secondary members (stiffeners, web frames, stringers, girders) when calculated by classical analysis procedures should not exceed the lower of or for carbon-manganese steels and aluminium alloys, where and are defined in sub-paragraph (f) of this paragraph. However, if detailed calculations are carried out for the primary members, the equivalent stress, as defined in sub-paragraph (f) may be increased over that indicated above to a stress acceptable to the Administration; calculations should take into account the effects of bending, shear, axial and torsional deformation as well as the hull cargo tank interaction forces due to the deflection of the double bottom and cargo tank bottoms. (d) (i) For independent tanks type B, primarily constructed of bodies of revolution, the at towable stresses should not exceed :
where =equivalent primary general membrane stress =equivalent primary local membrane stress =equivalent primary bending stress =the lesser of or
=the lesser of or with , , as defined in 4.13 and the equivalent stress and as defined in sub-paragraph (f) of this paragraph. The values of A, B, C and D should be shown on the Certificate of Fitness provided for in 1.6, and should
25
Bilaga
have at least the following minimum values: Nickel steels and carbon- Austenitic Aluminum manganese steels steels alloys A 3 3.5 4 B 2 1.6 1.5 C 3 3 3 D 1.5 1.5 1.5
(ii) For independent tanks type B, primarily constructed of plane surfaces, the Administration may require compliance with additional or other stress criteria. (e) For independent tanks type C the maximum allowable equivalent membrane stress to be used in calculation according to 4.4.6(a)(i) should be the lower of : where and are as defined in sub-paragraph (f) of this paragraph. The values of A and B should be shown on the Certificate of Fitness provided for in 1.6, and should have at least the minimum values indicated in the table of 4.5.1 (d)(i). (f) For the purpose of sub-paragraphs (c), (d) and (e) of this paragraph the following apply: (i) =specified minimum yield stress at room temperature. If the stress-strain curve does not show a defined yield stress, the 0.2 percent proof stress applies. =specified minimum tensile strength at room temperature. For welded connexions in aluminium alloys, the tensile strength in annealed conditions should be used. The above properties should correspond to the minimum specified mechanical properties of the material, including the weld metal in the as fabricated condition. Subject to special consideration by the Administration account may be taken of enhanced yield stress and tensile strength at low temperature. The temperature on which the material properties are based should be shown on the Certificate of Fitness provided for in 1.6. (ii) The equivalent stress ( ) (von Mises, Huber) should be determined by:
where =total normal stress in x-direction =total normal stress in y-direction =total shear stress in x-y plane. (iii) When the static and dynamic stresses are calculated separately and unless other methods of calculation are justified, the total stresses should be calculated according to:
where , and are static stresses and , and are dynamic stresses all determined separately from acceleration components and hull strain components due to deflection and torsion . (g) (i) Allowable stresses for materials other than those covered by Chapter VI should be subject to approval by the Administration in each case. (ii)Stresses may be further limited by fatigue analysis, crack propagation analysis and buckling criteria. 5.2 Corrosion allowance
26
Bilaga
(a) No corrosion allowance should generally be required in addition to the thickness resulting from the structural analysis. However, where there is no environmental control around the cargo tank, such as inerting, or where the cargo is of a corrosive nature, the Administration may require a suitable corrosion allowance.
(b) For pressure vessels no corrosion allowance is generally required if the contents of the pressure vessel are non-corrosive and the external surface is protected by inert atmosphere or by an appropriate insulation with an approved vapour barrier, Paint or other thin coatings should not be credited as protection. Where special alloys are used with acceptable corrosion resistance, no corrosion allowance should be required, If the above conditions are not satisfied, the scantlings calculated according to 4.4.6 should be increased as appropriate.
4.6 Supports
4.6.1 Cargo tanks should be supported by the hull in a manner which will prevent bodily movement of the tank under static and dynamic loads while allowing contraction and expansion of the tank under temperature variations and hull deflections without undue stressing of the tank and of the hull.
4.6.2 The tanks with supports should also be designed for a static angle of heel of 30° without exceeding allowable stresses given in 4.5.1.
4.6.3 The supports should be calculated for the most probable largest resulting acceleration, taking into account rotational as well as translational effects. This acceleration in a given direction may be determined as shown in Figure 4.1. The half axes of the "Acceleration Ellipse" should be determined according to 4.3.4(b) .
4.6.4 Suitable supports should be provided to withstand a collision force acting on the tank corresponding to onehalf the weight of the tank and cargo from forward and one-quarter the weight of the tank and cargo from aft without deformation likely to endanger the tank structure.
4.6.5 The loads mentioned in 4.6.2 and 4.6.4 need not be combined with each other or with wave induced loads.
4.6.6 For independent tanks and, where appropriate, for membrane and semi-membrane tanks, provisions should be made to key the tanks against the rotational effects referred to in 4.6.3.
4.6.7 Antiflotation arrangements should be provided for independent tanks. The antiflotation arrangements should be suitable to withstand an upward force caused by an empty tank in a hold space flooded to the summer load draught of the ship, without plastic deformation likely to endanger the hull structure.
4.7 Secondary barrier
4.7.1 Where the cargo temperature at atmospheric pressure is below -10°C, a secondary barrier should be provided when required by 4.7.3 to act as a temporary containment for any envisaged leakage of liquid cargo through the primary barrier.
4.7.2 Where the cargo temperature at atmospheric pressure is not below -55°C, the hull structure may act as a secondary barrier. In such a case:
(a) the hull material should be suitable for the cargo temperature at atmospheric pressure as required by 4.9.2; and
(b) the design should be such that this temperature will not result in unacceptable hull stresses.
4.7.3 Secondary barriers in relation to tank types should normally be provided in accordance with the following table. For tanks which differ from the basic tank types as defined in
4.2 the secondary barrier requirements should be decided by the Administration in each case.
Cargo temperature at Below -10ႏ -10ႏ and above Below -55ႏ
| atmospheric pressure | down to -55ႏ |
| No secondary Basic tank type barrier required | Hull may act as Separate secondary secondary barrier barrier where required |
| Integral | Tank type not normally allowed1 |
| Membrane Semi-membrane | Complete secondary barrier Complete secondary barrier2 |
Independent
| Type A | Complete secondary barrier |
| Type B | Partial secondary barrier |
| Type C | No secondary barrier required |
1/ A complete secondary barrier should normally be required if cargoes with a temperature at atmospheric pressure below -10°C are permitted in accordance with 4.2.1. 2/ In the case of semi-membrane tanks which comply in all respects with the requirements applicable to independent tanks type B, except for the manner of support, the Administration may, after special consideration,
27
Bilaga
accept a partial secondary barrier.
4.7.4 The secondary barrier should be designed so that:
(a) it is capable of containing any envisaged leakage of liquid cargo for a period of 15 days, unless different requirements apply for particular voyages, taking info account the load spectrum referred to in 4.3.4(d) ;
(b) it will prevent lowering of the temperature of the ship structure to an unsafe level in the case of leakage of the primary barrier as indicated in 4.8,2; and
(c) the mechanism of failure for the primary barrier does not also cause the failure of the secondary barrier and vice versa.
4.7.5 The secondary barrier should fulfil its functions at a static angle of heel of 30°.
4.7.6
(a) Where a partial secondary barrier is required, its extent should be determined on the basis of cargo leakage corresponding to the extent of failure resulting from the load spectrum referred to in 4.3.4(d) after the initial detection of a primary barrier leak. Due account may be taken of liquid evaporation, rate of leakage, reliable pumping capacity and other relevant factors. In all cases, however, the inner bottom in way of cargo tanks should be protected against liquid cargo.
(b) Clear of the partial secondary barrier, provision such as a spray shield should be made to deflect any liquid cargo down into the space between the primary and secondary barriers and to keep the temperature of the hull structure to a safe level.
4.7.7 The secondary barrier should be capable of being periodically checked for its effectiveness, by means of a pressure vacuum test, a visual inspection or another suitable method acceptable to the Administration. The method should be submitted to the Administration for approval.
4.8 Insulation
4.8.1 Where a product is carried at a temperature below -10°C suitable insulation should be provided to ensure that the temperature of the hull structure does not fall below the minimum allowable service temperature given for the concerned grade of steel in Chapter VI when the cargo tanks are at their design temperature and the ambient temperatures are 5°C for air and 0°C for sea-water. These conditions may generally be used for worldwide service. However higher values of the ambient temperatures may be accepted by the Administration for ships operated in restricted areas. Conversely, lesser values of the ambient temperatures may be fixed by the Administration for ships trading occasionally or regularly to areas in latitudes where such lower temperatures are expected during the winter months. The ambient temperatures used in the design should be shown on the Certificate of Fitness as provided for in 1.6.
4.8.2 Where a complete or partial secondary barrier is required, calculations should be made with the assumptions in 4.8.1 to check that the temperature of the hull structure does not fall below the minimum allowable service temperature given for the concerned grade of steel in Chapter VI. The complete or partial secondary barrier should be assumed to be at the cargo temperature at atmospheric pressure.
4.8.3 Calculations required by 4.8.1 and 4.8.2 should be made assuming still air and still water, and except as permitted by 4.8.4, no credit should be given for means of heating. In the case referred to in 4.8.2, the cooling effect of the rising boil-off vapour from the leaked cargo should be considered in the heat transmission studies. For members connecting inner and outer hulls, the mean temperature may be taken for determining the steel grade.
4.8.4 In all cases referred to in 4.8.1 and 4.8.2 and for ambient temperature conditions of 5°C for air and 0°C for sea-water, approved means of heating transverse hull structural material may be used to ensure that the temperatures ol this material do not fall below the minimum allowable values. If lower ambient temperatures are specified, approved means of heating may also be used for longitudinal hull structural material, provided this material remains suitable for the temperature conditions of 5°C for air and 0°C for sea-water without heating. Such means of heating should comply with the following requirements:
(a) sufficient heat should be available to maintain the hull structure above the minimum allowable temperature in the conditions referred to in 4.8.1 and 4.8.2;
(b) the heating system should be arranged so that, in the event of a failure in any part of the system, standby heating could be maintained equal to not less than 100 percent of the theoretical heat load;
(c) the heating system should be considered as an essential auxiliary: and
(d) the design and construction of the heating system should be to the satisfaction of the Administration.
4.8.5 In determining the insulation thickness, due regard should be paid to the amount of acceptable boil-off in
28
Bilaga
association with the reliquefaction plant on board, main propulsion machinery or other temperature control system. 4.9 Materials 4.9.1 The shell and deck plating of the ship and all stiffeners attached thereto should be in accordance with Recognized Standards, unless the operating temperature of the material is normally below 0°C due to the effect of the low temperature cargo, in which case the material should be in accordance with Table 6.5 assuming the ambient sea and air temperature of 0°C and 5°C respectively. 4.9.2 Hull material forming the secondary barrier should be in accordance with Table 6.2. Metallic materials used in secondary barriers not forming part of the hull structure should be in accordance with Table 6.2 or 6.3 as applicable. 4.9.3 Materials used in the construction of cargo tanks should be in accordance with Tables 6.1, 6.2 or 6.3. 4.9.4 Materials other than those referred to in 4.9.1, 4.9.2 and 4.9.3 used in the construction of the ship which are subject to reduced temperature due to the cargo and which do not form part of the secondary barrier should be in accordance with Table 6.5 for temperatures as determined by 4.8. This includes inner bottom plating, longitudinal but knead plating, transverse bulkhead plating, floors, webs, stringers and all attached stiffening members. 4.9.5 The insulation materials should be suitable for loads which may be imposed on them by the adjacent structure. 4.9.6 Where applicable, due to location and/or environmental conditions, insulation material should have suitable properties of fire resistance and flame spread and should be adequately protected against penetration of water vapour and mechanical damage. 4.9.7 Insulation materials should be tested and found acceptable for the following properties applicable: compatibility with the cargo solubility in the cargo absorption of the cargo shrinkage ageing closed cell content density mechanical properties thermal expansion abrasion cohesion thermal conductivity resistance to vibrations resistance to fire and flame spread. 4.9.8 The procedure for fabrication, storage, handling, erection, quality control and control against harmful exposure to sunlight of insulation materials should be to the satisfaction of the Administration. 4.9.9 Where powder or granulated insulation is used, the arrangements should be such as to prevent compacting of the material due to vibrations. The design should incorporate means to ensure that the material remains sufficiently buoyant to maintain the required thermal conductivity and also prevent any undue increase of pressure on the containment system. 4.10 Construction and testing 4.10.1 (a) All welded joints of the shells of independent tanks should be of the butt weld full penetration type. For dome to shell connections, the Administration may approve tee welds of the full penetration type. Except for small penetrations on domes, nozzle welds are also generally to be designed with full penetration,
29
Bilaga
(b) Welding joint details for independent tanks type C should be as follows:
(i) All longitudinal and circumferential joints of pressure vessels should be of butt welded, full penetration, double vee or single vee type. Full penetration butt welds should be obtained by double welding or by the use of backing rings. If used, backing rings should be removed, unless specifically approved by the Administration for very small process pressure vessels. Other edge preparations may be at lowed by the Administration depending on the results of the tests carried out at the approval of the welding procedure.
(ii) The bevel preparation of the joints between the pressure vessel body and domes and between domes and relevant fittings should be designed according to a standard for pressure vessels acceptable to the Administration. All welds connecting nozzles, domes or other penetrations of the vessel and all welds connecting flanges to the vessel or nozzles should be full penetration welds extending through the entire thickness of the vessel wall or nozzle wall, unless specially approved by the Administration for small nozzle diameters.
4.10.2 Workmanship should be to the satisfaction of the Administration. Inspection and non-destructive testing of welds for tanks other than independent tanks type C should be in accordance with the requirements of 6.3.7.
4.10.3 For membrane tanks, quality assurance measures, weld procedure qualification, design details, materials, construction, inspection and production testing of components, should be to standards developed during the prototype testing programme.
4.10.4 For semi-membrane tanks the relevant requirements in this section for independent tanks or for membrane tanks should be applied as appropriate.
4.10.5 Integral tanks should be hydrostatically or hydropneumatically tested to the satisfaction of the Administration. The test in general should be performed so that the stresses approximate, as far as practicable, the design stresses and so that the pressure at the top of the tank corresponds at least to the MARVS.
4.10.6 In ships fitted with membrane or semi-membrane tanks, cofferdams and all spaces which may normally contain liquid and are adjacent to the hull structure supporting the membrane should be hydrostatically or hydropneumatically tested in accordance with Recognized Standards. In addition, any other hold structure supporting the membrane should be tested for tightness. Pipe tunnels and other compartments which do not normally contain liquid need not be hydrostatically tested.
4.10.7 For independent tanks type C, inspection and non-destructive testing should be as follows:
(a) Manufacture and workmanship - The tolerances relating to manufacture and workmanship such as out-ofroundness local deviations from the true form, welded joints alignment and tapering of plates having different thicknesses, should comply with standards acceptable to the Administration. The tolerances should also be related to the buckling analysis referred to in 4.4.6(b).
(b) Non-destructive testing - As far as completion and extension of non-destructive testing of welded joints are concerned, the extent of non-destructive testing should be total or partial according to standards acceptable to the Administration, but the controls to be carried out should not be less than the following:
(i) Total non-destructive testing referred to in 4.4.6(a)(iii) :
Radiography:
butt welds 100 percent and
Surface crack detection :
all welds 10 percent
reinforcement rings around holes, nozzles, etc. 100 percent.
As an alternative, ultrasonic testing may be accepted as a partial replacement of the radiographic testing, if specially allowed by the Administration. In addition, the Administration may require total ultrasonic testing on welding of reinforcement rings around holes, nozzles, etc.
(ii) Partial non-destructive testing referred to in 4.4.6(a)(iii):
Radiography:
butt welds: all welded crossing joints and at least 10 percent of the full length at selected positions uniformly distributed and Surface crack detection :
reinforcement rings around holes, nozzles, etc. 100 percent Ultrasonic testing :
as may be required by the Administration in each instance.
4.10.8 Each independent tank should be subjected to a hydrostatic or hydropneumatic test as tool lows:
30
Bilaga
(a) For independent tanks type A, this test should be performed so that the stresses approximate, as far as practicable, the design stresses and so that the pressure at the top of the tank corresponds at least to the MARVS. When a hydropneumatic test is performed the conditions should simulate, as far as practicable, the actual loading of the tank and of its supports.
(b) For independent tanks type B, the test should be performed as required in subparagraph (a) of this paragraph for independent tanks type A. In addition, the maximum primary membrane stress or maximum bending stress in primary members under test conditions should not exceed 90 percent of the yield strength of the material (as fabricated) at the lest temperature. To ensure that this condition is satisfied, when calculations indicate that this stress exceeds 75 percent of the yield strength the prototype lest should be monitored by the use of strain gauges or other suitable equipment.
(c) Independent tanks type C should be tested as follows:
(i) Each pressure vessel, when completely manufactured, should be subjected to a hydrostatic tests at a pressure measured at the top of the lacks, of not less than 1.5 , but in no case during the pressure test should the calculated primary membrane stress at any points exceed 90 percent of the yield stress of the material. The definition of is given in 4.2.5. To ensure that this condition is satisfied where calculations indicate that this stress will exceed 0.75 times the yield strength, the prototype test should be monitored by the use of strain gauges or other suitable equipment in pressure vessels except simple cylindrical and spherical pressure vessels.
(ii) The temperature of the water used for the test should be at least 30°C above the nil ductility transition temperature of the material as fabricated.
(iii) The pressure should be held for two hours per 25 mm of thickness but in no case less than two hours.
(iv) Where necessary for cargo pressure vessels, and with the specific approval of the Administration, a hydropneumatic test may be carried out under the conditions prescribed in sub-paragraphs (i), (ii)and (iii) of this sub-paragraph.
(v) Special consideration may be given by the Administration to the testing of tanks in which higher allowable stresses are used, depending on service temperature. However, the requirements of (i) of this sub-paragraph should be fully complied with.
(vi) After completion and assembly, each pressure vessel and its related fittings should be subjected to an adequate tightness test.
(vii) Pneumatic testing of pressure vessels other than cargo tanks should be considered on an individual case basis by the Administration. Such testing should be permitted only for those vessels which are so designed and/or supported that they cannot be safely filled with water, or for those vessels which cannot be dried and are to be used in service where traces of the testing medium cannot be tolerated.
4.10.9 All tanks should be subjected to a tightness test which may be performed in combination with the pressure test referred to in 4.10.8 or separately.
4.10.10 Requirements with respect to inspection of secondary barriers should be decided by the Administration in each case.
4.10.11 In ships fitted with independent tanks type B, at least one tank and its support should be instrumented to confirm stress levels unless the design and arrangement for the size of ship involved are supported by full scale experience. Similar instrumentation may be required by the Administration for independent tanks type C dependent on their configuration and on the arrangement of their supports and attachments.
4.10.12 The overall performance of the cargo containment system should be verified for compliance with the design parameters during the initial cool down, loading and discharging of the cargo. Records of the performance of the components and equipment essential to verify the design parameters should be maintained and be available to the Administration.
4.10.13 Heating arrangements, if fitted in accordance with 4.8.4, should be tested for required heat output and heat distribution.
4.10.14 The hull should be inspected for cold spots following the first loaded voyage.
4.10.15 For independent tanks type C, the required marking of the pressure vessel should be achieved by a method which does not cause unacceptable local stress raisers.
.11 Stress relieving for independent tanks type C
(a) For independent tanks type C of carbon and carbon-manganese steel, post-weld heat treatment should be performed after welding if the design temperature is below -10°C. Post-weld heat treatment in all other cases and for materials other than those mentioned above should be to the satisfaction of the Administration. The
31
Bilaga
soaking temperature and holding time should be to the satisfaction of the Administration. (b) In the case of large cargo pressure vessels of carbon or carbon-manganese steel for which it is difficult to perform the heat treatment, mechanical stress relieving by pressurizing may be carried out as an alternative to the heat treatment with the approval of the Administration and subject to the following conditions: (i) Complicated welded pressure vessel parts such as sumps or domes with nozzles, with adjacent shell plates should be heat treated before they are welded to larger parts of the pressure vessel. (ii) The plate thicknesses should not exceed those given by a standard acceptable to the Administration. (iii) The performance of a detailed stress analysis to ascertain that the maximum primary membrane stress during the mechanical stress relieving, closely approaches, but does not exceed, 90 per cent of the yield stress of the material. Strain measurements during the stress relief pressurization may be required by the Administration for verifying the calculations. (iv) The procedure for mechanical stress relieving should be submitted before-hand to the Administration for approval. 4.12 Guidance formulae for acceleration components The following formulae are given as guidance for the components of acceleration due to ship's motions in the -8 case of ships with a length greater than 50 m. These formulae corresponding to a probability level of 10 in the North Atlantic. (a) vertical acceleration as defined in 4.3.4(f)
(b) transverse acceleration as defined in 4.3.4(f)
(c)longitudinal acceleration as defined in 4.3.4(f)
in which (d) In the formulae given in this paragraph: (i) =Length of ship for determination of scantlings as defined in Recognized Standards (m) =block Coefficient =greatest moulded breadth (m) =longitudinal distance (m) from amidships to the centre of gravity of the tank with content. x is positive forward of amidships, negative aft of amidships =vertical distance (m) from the ship's actual water-line to the centre of gravity of tank with. content. z is positive above and negative below the water-line
where V = service speed in knots
=1 in general. For particular loading conditions and hull forms, determination of K according to the formula below may be necessary. , where and GM = metacentric height (m) (ii) , , and are the maximum dimensionless accelerations (i.e. relative to the acceleration of gravity) in the respective directions and they are considered as acting separately for calculation purposes. does not include the static weight, includes the component of the static weight in the transverse direction dice to rolling, and includes the component of the static weight in the longitudinal direction due to pitching. 4.13 Stress categories
32
Bilaga
For the purpose of stress evaluation referred to in 4.5.1 (d), stress categories are defined in this section. 4.13.1 Normal stress: the component of stress normal to the plane of reference. 4.13.2 Membrane stress: the component of normal stress which is uniformly distributed and equal to the average value of the stress across the thickness of the section under consideration. 4.13.3 Bending stress: the variable stress across the thickness of the section under consideration, after the subtraction of the membrane stress. 4.13.4 Shear stress: the component of the stress acting in the plane of reference. 4.13.5 Primary stress: a stress Produced by the imposed loading and which is necessary to balance the external forces and moments. The basic characteristic of a primary stress is that it is not self-limiting. Primary stresses which considerably exceed the yield strength will result in failure or at least in gross deformations. 4.13.6 Primary general membrane stress: a Primary membrane stress which is so distributed in the structure that no redistribution of load occurs as a result of yielding. 4.13.7 Primal local membrane stress: cases arise where a membrane stress produced by pressure or other mechanical loading and associated with a primary and/or a discontinuity effect produces excessive distortion in the transfer of loads for other portions of the structure. Such a stress is classified as a primary local membrane stress although it has some characteristics of a secondary stress. A stress region may be considered as local if: and where: =distance in the meridional direction over which the equivalent stress exceeds 1.1 f =distance in the meridional direction to another region where the limits for primary general membrane stress are exceeded =mean radius of the vessel =wall thickness of the vessel at the location where the primary general membrane stress limit is exceeded =allowable primary general membrane stress. 4.13.8 Secondary stress: a normal stress or shear stress developed by constraints of adjacent parts or by selfconstraint of a structure. The basic characteristic of a secondary stress is that it is self-limiting. Local yielding and minor distortions can satisfy the conditions which cause the stress to occur.
aǃ = resulting acceleration (static and dynamic) in arbitrary direction ǃ ay = transverse component of acceleration az = vertical component of acceleration
33
Bilaga
Figure 4.1 - Acceleration ellipse
Figure 4.2 - Determination of Internal Pressure Heads
Response cycles
ı0 = most probable maximum stress over the life of the ship Response cycle scale is logarithmic; the value of 2.105 is given as an example of estimate Figure 4.3. - Simplified load distribution CHAPTER V - PROCESS PRESSURE VESSELS AND LIQUID, VAPOUR, AND PRESSURE PIPING SYSTEMS 5.1 General 5.1.1 Administrations should take appropriate steps to ensure uniformity in the implementation the provisions of this chapter.* * Reference is made to the published Rules of members and associate members of the Internatio Classification Societies and in particular to IACS Unified Requirement No 94. 5.1.2 The requirements for independent tanks type C in Chapter IV may also apply to process required by the Administration. If so required the words "pressure vessels" as used in Chap
34
Bilaga
independent tanks type C and process pressure vessels. 5.2 Cargo and process piping 5.2.1 (a) The requirements in this section apply to product and process piping including vapour piping and vent lines of safely valves or similar piping. Instrument piping not containing cargo is exempt from these requirements. (b) Provision should be made by the use of offsets, loops, bends, mechanical expansion joints such as bellows, slip joints and ball joints or similar suitable means to protect the piping, piping system components and cargo tanks from excessive stresses due to thermal movement and from movements of the tank and the hull structure. Where mechanical expansion joints are used in piping they should be held to a minimum and, where located outside of cargo tanks, should be of the bellows type. 5.2.2 Low temperature piping should be thermally isolated from the adjacent hull structure, where necessary, to prevent the temperature of the hull from falling below the design temperature of the hull material. Where liquid piping is dismantled regularly, or where liquid leakage may be anticipated, such as at shore connexions and at pump seals, protection for the hull beneath should be provided. 5.2.3 Where tanks or piping are separated from the ship's structure by thermal isolation, provision should be made for electrically bonding both the piping and the tanks. All gasketed pipe joints and hose connexions should be electrically bonded. 5.2.4 Suitable means should be provided to relieve the pressure and remove liquid contents from cargo loading and discharging crossover headers and/or cargo hoses to the cargo tanks or other suitable location, prior to disconnecting the cargo hoses. 5.2.5 Relief valves discharging liquid cargo from the cargo piping system should discharge into the cargo tanks; alternatively they may discharge to the cargo vent mast if means are provided to detect and dispose of any liquid cargo which may flow into the vent system. Relief valves an cargo pumps should discharge to the pump suction. 5.2.6 Scantlings based on internal pressure (a) General Subjects to the conditions stated in sub-paragraph (d) of this paragraph, the wall thickness of pipes should not be less than.
-->
where : =minimum thickness (mm) =theoretical thickness (mm) =PD / (200 Ke + P) with =design pressure (kp/cm²) referred to in sub-paragraph (b) of this paragraph =outside diameter (mm) =allowable stress (kp/mm²) referred to in sub-paragraph (c) of this paragraph =efficiency factor where e is 1.0 for seamless pipes and for longitudinally or spirally welded pipes, delivered by manufacturers approved for making welded pipes, which are considered equivalent to seamless pipes when non-destructive testing on welds is carried out in accordance with Recognized Standards. In other cases an efficiency factor value depending on the manufacturing process may be determined by the Administration. b = allowance for bending (mm). The value of b should be chosen so that the calculated stress in the bend, due to internal pressure only, does not sad the allowable stress. Where such justification is not given, b should be:
with =mean radius of the bend (mm)
35
Bilaga
c = corrosion allowance (mm). If corrosion or erosion is expected, the wall thickness of the Piping should be increased over that required by other design requirements. This allowance should be consistent with the expected of the piping. a = negative manufacturing tolerance for thickness (%) . (b) Design pressure (i) The design pressure P in the formula for to in sub-paragraph (a) of this paragraph is the maximum pressure to which the system may be subjected service, taking into account the highest set pressure of any safety valve the system. (ii) Piping and piping system components which are not protected by a valve, or which may be isolated from their relief valve, should be design for at least the greatest of: (1) the cargo vapour pressure at 45°C; or (2) the MARVS of the cargo tank; or (3) the pressure setting of the associated pump or compressor discharge relief valve; or (4) the maximum total discharge head of the associated pump or compressor when a discharge relief valve is not installed. (c) Allowable stress For pipes, the permissible stress to be considered in the formula for t in sub-paragraph (a) of this paragraph is the lower of the following values: or where : =specified minimum tensile strength at room temperature (kp/mm²) =specified lower minimum yield stress or 0.2 per cent proof stress at room temperature (kp/mm²). The values of A and B should be shown on the Certificate of fitness as provided for in 1.6 and have values of at least A= 2.7 and B = 1.8. (d) Minimum nil thickness (i) The minimum thickness should be in accordance wish Recognized Standards. (ii) Where necessary for mechanical strength to prevent damage, collapse, excessive sag or buckling of pipes due to superimposed loads from supports, ship deflection or other causes, the wall thickness should be increased over that required by sub-paragraph (a) of this paragraph, or, if this is impracticable or would cause excessive local stresses, these loads should be reduced, protected against or eliminated by other design methods. (e) Flanges, valves and other fittings (i) For selection of flanges, valves and other fittings, a standard acceptable to the Administration should be used taking into account the design pressure defined under sub-paragraph (b) of this paragraph with a minimum of 10 kp/cm². For open ended lines such a pressure should not be less than 5 kp/cm². For bellows expansion joints used in vapour service, a lower minimum design pressure may be accepted by the Administration. (ii) For flanges not complying with a standard, the dimensions of flanges and relative bolts should be to the satisfaction of the Administration. 5.2.7 Stress analysis When the design temperature is -110°C or lower, a complete stress analysis, taking into account all the stresses due to weight of pipes, including acceleration loads if significant, internal pressure, thermal contraction and loads induced by hog and sag of the ship for each branch of the piping system should be submitted to the Administration. For temperatures of above -110°C, a stress analysis may be required by the Administration in relation to such matters as the design or stiffness of the piping system and the choice of materials. In any case, consideration should be given to thermal stresses, even though calculations are not submitted. The analysis may be carried out according to a code of practice acceptable to the Administration. 5.2.8 Materials
36
Bilaga
(a) The choice and testing of materials used in piping systems should comply with the requirements of Chapter VI taking into account the minimum design temperature. However, some relaxation may be permitted in the quality of the material of open ended vent piping, provided the temperature of the cargo at the pressure relief valve setting is -55°C or greater and provided no liquid discharge to the vent piping can occur.
(b) Materials having a melting point below 925°C should not be used for piping out-side the cargo tanks except for short lengths of pipes attached to the cargo tanks in which case fire resisting insulation should be provided.
5.2.9 Type tests on piping components
Each type of piping component should be subjected to type tests as follows:
(a) Valves - Each size and type intended to be used at a working temperature below -55°C should be subjected to a tightness test to the minimum design temperature or lower, and to a pressure not lower than the design pressure of the valves. During the test the satisfactory operation of the valve should be ascertained.
(b) Expansion - The following type tests should be performed on each type of expansion bellows intended for use on cargo piping outside the cargo tank and, where required, on those expansion bellows installed within the cargo tanks:
(i) A type element of the bellows, not precompressed, should be pressure tested at not less than five times the design pressure without bursting. The duration of the test should not be less than five minutes.
(ii) A pressure test on a type expansion joint complete with all the accessories such as flanges, stays and articulations, at twice the design pressure at the extreme displacement conditions recommended by the manufacturer without permanent deformation. Depending on the materials used, the Administration may require the test to be at the minimum design temperature.
(iii) A cyclic test (thermal movements) should be performed on a complete expansion joint, which is to successfully withstand at least as many cycles, under the conditions of pressure, temperature, axial movement, rotational movement and transverse movement, as it will encounter in actual service. Testing at room temperature is permitted, when this testing is at least as severe as testing at the service temperature.
(iv) A cyclic fatigue test (ship deformation) should be performed on a complete expansion joint, without internal pressure, by simulating the bellows movement corresponding to a compensated pipe length, for at least 2,000,000 cycles at a frequency not higher than 5 cycles/second. This test is only required when, due to the piping arrangement, ship deformation loads are actually experienced.
(v) The Administration may waive performance of the tests referred to in this paragraph provided that complete documentation is supplied to establish the suitability of the expansion joints to withstand the expected working conditions. When the maximum internal pressure exceeds 1.0 kp/cm² this documentation is to include sufficient test data to substantiate the design method used, with particular reference to correlation between calculation and test results.
5.2.10 Piping fabrication and joining details
(a) The requirements of this paragraph apply to piping inside and outside the cargo tanks. However, the Administration may accept relaxations from these requirements for piping inside cargo tanks and open ended piping.
(b) The following direct connexion of pipe lengths, without flanges, may be considered :
(i) Butt welded joints with complete penetration at the root may be used in all applications. For design temperatures below -10°C, butt welds should be either double welded or equivalent to a double welded butt joint. This may be accomplished by use of a backing ring, consumable insert or inert gas back-up on the first pass. For design pressures in excess of 10 kp/cm² and design temperatures of -10°C or lower, backing rings should be removed.
(ii) Slip-on welded joints with sleeves and related welding, having dimensions satisfactory to the Administration should only be used for open ended lines with external diameter of 50 mm or less and design temperatures not lower than -55°C.
(iii) Screwed couplings acceptable to the Administration should only be used for accessory lines and instrumentation lines with external diameters of 25 mm or less.
(c) Flange connexions
(i) Flanges should be of the welding neck, clip-on or socket welding type.
(ii) Flanges should be selected as to type, and made and tested in accordance with a standard acceptable
37
Bilaga
to the Administration. In particular, for all piping except open ended, the following restrictions apply:
(1) For design temperatures lower than -55°C, only welding neck flanges should be used.
(2) For design temperatures lower than -10°C, slip-on flanges should not be used in nominal sizes above 100 mm and socket welding flanges should not be used in nominal sizes above 50 mm.
(d) Piping connexions, other than those mentioned in sub-paragraphs (b) and (c) of this paragraph, may be accepted by the Administration in each case.
(e) Bellows and expansion joints
(i) If necessary, bellows should be protected against icing.
(ii) Slip joints should not be used except within the cargo tanks.
(f) Welding, post-weld heat treatments and non-destructive testing
(i) Welding should be carried out in accordance with 6.3.
(ii) Post-weld heat treatments should be required for all bull welds of pipes made with carbon, carbonmanganese and low alloy steels. The Administration may waive the requirement for thermal stress relieving of pipes having wall thickness less than 10 mm in relation to the design temperature and pressure of the concerned piping system.
(iii) In addition to normal controls before and during the welding and to the visual inspection of the finished welds, as necessary for proving that the welding has been carried out correctly and according to the requirements of this paragraph, the following tests should be required:
(1) 100 percent radiographic testing of butt welded joints for piping systems with service temperatures lower than -10°C and with inside diameters of more than 75 mm and/or wall thicknesses greater than 10mm.
(2) For other butt welded Joints of pipes, spot radiographic tests or other non-destructive tests should be carried out at the discretion of the Administration depending upon service, position and materials. In general at least 10 per cent of butt welded joints of pipes should be radiographed.
5.2.11 Tests
(a) The requirements of this paragraph apply to piping inside and outside the cargo tanks. However, the Administration may accept relaxations from these requirements for piping inside cargo tanks and open ended piping.
(b) Pressure tests (strength and leak tests)
(i) After assembly, all cargo and process piping should be subjected to a hydrostatic lest to at least 1.5 times the design pressure. However, when piping systems or parts of systems are completely manufactured and equipped with all fittings, the hydrostatic test may be conducted prior to installation aboard ship. Joints welded on board should be hydrostatically tested to at least 1.5 times the design pressure. Where water cannot be tolerated and the piping cannot be dried prior to putting the system into service, proposals for alternative testing fluids or testing means should be submitted to the Administration for approval.
(ii) After assembly on board, each cargo and process piping system should be subjected to a leak test using air, halides, or older suitable medium to a pressure depending on the leak detection method applied.
(c) Functional tests
All piping systems including valves, fittings and associated equipment for handling cargo or vapours should be tested under normal operating conditions not later than at the first loading operation.
5.3 Cargo system valving requirements
5.3.1 Every cargo piping system and cargo tank should be provided with the following valves, as applicable:
(a) For cargo tanks with a MARVS not exceeding 0.7 kp/cm², all liquid and vapour connexions, except safety relief valves and liquid level gauging devices, should have shut-off valves located as close to the tank as practicable. These valves may be remotely controlled but should be capable of local manual operation and provide full closure. One or more remotely controlled quick-closing shut-off valves should be provided on the ship for shutting down liquid and vapour cargo transfer between ship and shore. Such valves may be arranged to suit the ship's design and may be the same valve as required in 5.3.3 and should comply with the requirements of 5.3.4.
(b) For cargo tanks with a MARVS exceeding 0.7 kp/cm², all liquid and vapour connexions , except safety
38
Bilaga
relief valves and liquid level gauging devices, should be equipped with a manually operated stop valve and a remotely controlled quick-closing shut-off valve. These valves should be located as close to the tank as practicable. Where the pipe size does not exceed 50 mm in diameter, excess flow valves may be used in lieu of the quick-closing valve. A single valve may be substituted for the two separate valves provided the valve complies with the requirements of 5.3.4, is capable of local manual operation and provides full closure of the line.
(c) Cargo pumps and compressors should be arranged to shut-down automatically if the quick-closing shut-off valves required by sub-paragraphs (a) and (b) of this paragraph are closed by the emergency shut-down system required by 5.3.4.
5.3.2 Cargo tank connexions for gauging or measuring devices need not be equipped with excess flow or quickclosing shut-off valves provided that the devices are constructed so that the outward flow of tank contents cannot exceed that passed by a 1.4 mm diameter circular hole.
5.3.3 One remote operated, quick-closing shut-off valve should be provided at each cargo hose connexion in use. Connexions not used in transfer operations may be blinded with blank flanges in lieu of valves.
5.3.4 The control system for all required quick-closing shut-off valves should be so arranged that all such valves may be operated by single controls situated in at least two remote locations on the ship. One of these locations should be the cargo loading station or cargo control room. The control system should also be provided with fusible elements designed to melt at temperatures between 98°C and 104°C which will cause the quick-closing shut-off valves to close in the event of fire. Locations for such fusible elements should include the tank domes and loading stations. Quick-closing shut-off valves should be of the fail-closed (closed on loss of power) type and be capable of local manual closing operation. Quick-closing shut-off valves in liquid piping should operate from fully open to fully closed under all service conditions in the minimum time consistent with the avoidance of excessive pressure surges in the attached piping, both on the ship and in the shore loading system. Closing time for such quick-closing valves in liquid piping systems should be acceptable to the Administration.
5.3.5 Excess flow valves should close automatically at the rated closing flow of vapour or liquid as specified by the manufacturer. The piping including fittings, valves, and appurtenances protected by an excess flow valve, should have a greater capacity than the rated closing flow of the excess flow valve. Excess flow valves may be designed with a bypass not exceeding an area of 1.0 mm diameter circular opening to allow equalization of pressure, after an operating shut-down.
5.4 Ship's cargo hoses
5.4.1 Liquid and vapour hoses used for cargo transfer should be compatible with the cargo and suitable for the cargo temperature.
5.4.2 Hoses subject to tank pressure, or the discharge pressure of pumps or vapour compressors, should be designed for a bursting pressure not less than five times the maximum pressure the hose will be subjected to during cargo transfer.
5.4.3 Each new type of cargo hose, complete with end fittings, should be prototype tested to a pressure not less than five times its specified maximum working pressure. The hose temperature during this prototype test should be the intended extreme service temperature. Hoses used for prototype testing should not be used for cargo service. Thereafter, before being places in service, each new length of cargo hose produced should be hydrostatically tested at ambient temperature to a pressure not less than 1.5 times its specified maximum working pressure nor more than two-fifths its bursting pressure. The hose should be stencilled or otherwise marked with its specified maximum working pressure, and if used in other than ambient temperature services, its maximum and/or minimum service temperature. The specified maximum working pressure should not be less than 10.5 kp/cm².
5.5 Cargo transfer methods
5.5.1 Where cargo transfer is by means of cargo pumps not accessible for repair with the tanks in service, at least two separate means should be provided to transfer cargo from each cargo tank and the design should be such that failure of one cargo pump, or means of transfer, will not prevent the cargo transfer by another pump or pumps, or other cargo transfer means.
5.5.2 The procedure for transfer of cargo by gas pressurization should preclude lifting of the relief valves during such transfer. Gas pressurization may be accepted as a means of transfer of cargo for those tanks so designed that the design factor of safety is not reduced under the conditions prevailing during the cargo transfer operation.
CHAPTER VI - MATERIALS OF CONSTRUCTION
6.1 General
6.1.1 Administrations should take appropriate steps to ensure uniformity in the implementation and application of
39
Bilaga
the provisions of this chapter.*
* Reference is made to the published Rules of members and associate members of the International Association of Classification Societies and in particular to IACS Unified Requirement No 95.
6.1.2 This chapter gives the requirements for plates, sections, pipes, forgings, castings and weldments used in the construction of cargo tanks, cargo process pressure vessels, cargo and process piping, secondary barriers and contiguous hull structures associated with the transportation of the products. The requirements for rolled materials, forgings and castings are given in 6.2 and Tables 6.1 to 6.5. The requirements for weldments are given in 6.3.
6.1.3 The manufacture, testing, inspection and documentation should be in accordance with Recognized Standards and the specific requirements given in this document.
6.1.4 (a) Acceptance tests should include Charpy V-notch toughness tests. The specified Charpy V-notch requirements are minimum average energy values for three full size (10 mm × 10 mm) specimens and minimum single energy values for individual specimens. Dimensions and tolerances of Charpy V-notch specimens should be in accordance with Recognized Standards. The testing and requirements for smaller than 5.0 mm size specimens should be in accordance with Recognized Standards. Minimum average values for subsized specimens and the minimum value for a single specimen should be :
Minimum energy Charpy V-notch specimen size Minimum enery average of 3 specimens single specimen 10 x 10 mm E 2/3 E 10 x 7.5 mm 5/6E 5/9 E 10 x 5.0 mm 2/3E 4/9 E where E : the values of energy (kpm) specified in Tables 6.1 to 6.4.
(b) In all cases, the largest size Charpy specimens possible for the material thickness should be machined with the specimens located as near as practicable to a point midway between the surface and the centre of the thickness and the length of the notch perpendicular to the surface. If the average value of the three initial Charpy V-notch specimens fails to meet the stated requirements, or the value for more than one specimen is below the required average value, or when the value for one specimen is below the minimum value permitted for a single specimen, three additional specimens from the same material may be tested and the results combined with those previously obtained to form a new average. This new average of six specimens should not be less than the specified minimum average. At the discretion of the Administration other types of toughness tests, such as a drop weight test, may be used. These may be either in addition to or in lieu of the Charpy V-notch test.
6.1.5 Tensile strength, yield stress and elongation should be to the satisfaction of the Administration. For carbonmanganese steel and other materials with definitive yield points consideration should be given to the limitation of the yield to tensile ratio.
6.1.6 The bend test may be omitted as a material acceptance test, but is required for weld tests.
6.1.7 Materials with alternative chemical composition or mechanical properties may be accepted by the Administration.
6.1.8 Where post-weld heat treatment is specified or required, the properties of the base material should be determined in the heat treated condition in accordance with the applicable table of this chapter and the weld properties should be determined in the heat treated condition in accordance with 6.3. In cases where a post-weld heat treatment is applied, the test requirements may be modified at the discretion of the Administration.
6.1.9 Where reference is made in this chapter to B, D and E hull structural steels, these steel grades are hull structural steels according to Recognized Standards.
6.2 Material requirements
The requirements for materials of construction in the tables are as follows:
TABLE 6.1 : plates, pipes (seamless and welded), sections and forgings for cargo tanks and process pressure vessels for design temperatures not lower than 0°C.
TABLE 6.2 : plates, sections and forgings for cargo tanks secondary barriers and process pressure vessels for design temperatures below 0°C and down to -55°C.
TABLE 6.3 : plates, sections and forgings for cargo tanks secondary barriers and process pressure vessels for design temperatures below -55°C and down to -165°C(alloy steels and aluminium alloys).
TABLE 6.4 : Pipes(seamless and welded), forgings and casting for cargo and process piping for design temperatures below 0°C and down to -165°C.
40
Bilaga
TABLE 6.5 : Plates and sections for hull structures required by 4.9.1 and 4.9.4. TABLE 6.1
PLATES, PIPES (SEAMLESS AND WELDED),1) SECTIONS AND FORGINGS FOR CARGO TANKS AND PROCESS PRESSURE VESSELS FOR DESIGN TEMPERATURES NOT LOWER THAN O°C CHEMICAL COMPOSITION AND HEAT TREATMENT CARBON-MANGANESE STEEL 2) Fully killed Fine grain steel where thickness exceeds 20 mm Small additions of alloying elements by agreement with the Administration Composition limits to be approved by the Administration Norrnalized, 3) or quenched and tempered TENSI LE AND TOUGHNESS (IMPACT) TEST REQUIREMENTS
| PLATES | Each "piece" to be tested |
| SECTIONS AND FORGINGS | Batch test |
| TENSILE PROPERTIES | Specified minimum yield stress not to exceed 65 kp/mm2 4) |
CHARPY V-NOTCH TEST PLATES Transverse test pieces. Minimum average energy value (E) 2.8 Kpm SECTIONS AND FORGINGS Longitudinal test pieces. Minimum average energy value (E) 4.2 Kpm
Thichkness t(mm) Test Temperature(°C)
TEST TEMPERATURE : t < 20 0 20 < t < 30 -20 30 < t < 40 -40 NOTES 1) For seamless pipes and fittings normal practice applies. The use of longitudinal and spirally welded pipe should be specially approved by the Administration. 2) Grade D up to 20 mm and E hull structural steel may be used subject to special agreement with the Administration except for independent tanks types B and C and process pressure vessels. In such cases impact tests should be conducted on each piece. 3) An approved controlled rolling procedure may be substituted for normalizing by special agreement with the Administration. 4) Where the specified minimum yield point exceeds 50 kp/mm² particular attention should be given to the hardness of the weld and heat affected zone. TABLE 6.2
PLATES, SECTIONS AND FORGINGS1) FOR CARGO TANKS, SECONDARY BARRIERS AND PROCESS PRESSURE VESSELS FOR DESIGN TEMPERATURES BELOW 0°C AND DOWN TO —55°C
Maximum thickness 20 mm 2)
CHEMICAL COMPOSITION AND HEAT TREATMENT CARBON-MANGANESE STEEL 3) Fully killed. Aluminium treated fine grain steel. Chemical composition (ladle analysis) C Mn Si S P 0.16% max. 4) 0.70-1.60% 0.10-0.50% 0.035% max. 0.035% max. Optional additions: Alloys and grain refining elements may be generally in accordance with the following: Ni Cr Mo Cu Nb V 0.80% max. 0.25% max. 0.08% max. 0.35% max. 0.05% max. 0.10% max. Normalized or quenched and tempered.5)
TENSILE AND TOUGHNESS (IMPACT) TEST REQUIREMENTS
PLATES Each "piece" to be tested SECTIONS Batch test Test temperatures 5°C below the design temperature or —20°C CHARPY V-NOTCH TEST whichever is lower
41
Bilaga
Transverse test pieces. Minimum PLATES average energy value (E) 2.8 kpm 1) Longitudinal test pieces. Minimum SECTIONS AND FORGINGS average energy value (E) 4.2 kpm NOTES 1) The Charpy V-notch and chemistry requirements for forgings may be specially considered by the Administration ,
2) For materials more than 20 mm thick, the Charpy V-notch values should be specially agreed with the Administration, but in no case should they be less than those given in this table.
3) Grade D and E hull structural steel may be used subject to special agreement with the Administration, except for independent tanks types B and C and process pressure vessels, provided a minimum temperature limitation of -10° C for Grade 0 and -25°C for Grade E is applied. In such cases an impact test should be conducted on each piece and should meet the requirements for the grade of steel referred to in 6.1.9.
4) By special agreement with the Administration, the carbon content may be increased to 0.18% maxi- mum provided the design temperature is not lower than -40°C.
5) A lower minimum design temperature may be specially agreed with the Administration for quenched and tempered steel, provided that the maximum carbon content does not exceed 0.14%.
TABLE 6.3
PLATES, SECTIONS AND FORGINGS 1) FOR CARGO TANKS, SECONDARY BARRIERS AND PROCESS PRESSURE VESSELS FOR DESIGN TEMPERATURES BELOW —55°C AND DOWN TO -165°C 2)
Maximum thickness 20 mm 3) Minimum design Impact test Chemical composition 4) and heat treatment temperature (°C) temperature (°C) —60 1.5% Nickel steel — normalized —65 2.25% Nickel steel — normalized or —65 —70 normalized and tempered 5) 3.5% Nickel steel — normalized or —90 —95 normalized and tempered 5) 5% Nickel steel — normalized or —105 —110 normalized and tempered 5) 6) 9% Nickel steel — double normalized and —165 —196 tempered or quenched and tempered Austenitic steels, such as types 304, 304L, 316, 316L, 321, 327
| —165 and 347 Solution treated 1) | —196 |
| —165 Aluminium alloys; such as type 5083 annealed | Not required |
| —165 Alloy steel — 36% nickel | Not required |
TENSILE AND TOUGHNESS (IMPACT) TEST REQUIREMENTS
PLATES Each "piece" to be tested SECTIONS AND FORGINGS Batch test CHARPY V-NOTCH TEST PLATES Transverse test pieces. Minimum average energy value (E) 2.8 kpm SECTIONS AND FORGINGS Longitudinal test pieces. Minimum average energy value (E) 4.2 kpm NOTES 1) The impact test required for forgings used in critical applications should be subject to special consideration by the Administration. 2) The requirements for design temperatures below -165°C should be specially agreed with the Administration . 3) For materials more than 20 mm thick the Charpy V-notch values should be specially agreed with the Administration but in no case should they be less than those given in this table. 4) The chemical composition limits should be approved by the Administration. 5) A lower minimum design temperature for quenched and tempered steels may be specially agreed with the Administration. 6) A specially heat treated, such as triple heat treated 5% Nickel steel may be used down to -165°C upon special
42
Bilaga
agreement with the Administration, provided that the impact tests are carried oui at -196°C. 7) The impact test may be omitted subject to agreement with the Administration. TABLE 6.4
PIPES (SEAMLESS AND WELDED)1), FORGINGS2), AND CASTINGS2) FOR CARGO AND PROCESS PIPING FOR DESIGN TEMPERATURES BELOW 0°C AND DOWN TO —165°C 3)
Maximum thickness 20 mrn 4)
Impact Test Minimum designtemperature Chemical Composition5) and Heat Treatment (°C) Minimum average Test temperature(°C) energy (E) (kp.m)
Carbon-manganese steel. Fully killed fine 6) —55 2.8 grain. Normalized or as agreed) 2.25% Nickel steel. Normalized or normalized —70 —75 3.5 and tempered) 3.5% Nickel steel. Normalized or normalized —105 —110 3.5 and tempered) 9% Nickel steel.8) Double normalized and —196 3.5 tempered or quenched and tempered Austenitic steels, such as types 304, 304L, —165 316, 316L, 321, 327 and 347. Solution —196 4.2 treated9) Aluminium alloys, such as type 5083 annealed Not required
TENSILE AND TOUGHNESS (IMPACT) TEST REQUIREMENTS Each batch to be tested IMPACT TEST — Longitudinal test pieces
NOTES 1) The use of longitudinal and spirally welded pipe should be specially approved by the Administration. 2) The requirements for forgings and castings may be subject to special consideration by the Administration 3) The requirements for design temperatures below -165°C should be specially agreed with the Administration . 4) For materials with a wall thickness exceeding 20 mm, the Charpy V-notch values should be approved by the Administration, but in no case should they be less than those given in this table. 5) The composition limits should be approved by the Administration. 6) The test temperature should be 5°C below the minimum design temperature. 7) A lower design temperature may be specially agreed with the Administration for quenched and tempered materials. 8) This chemical composition is not suitable for castings. 9/ Impact tests may be omitted subject to agreement wilts the Administration. TABLE 6.5
PLATES AND SECTIONS FOR HULL STRUCTURES REQUIRED BY 4.9.1 AND 4.9.4
43
Bilaga
Minimum design temperature of hull structures (°C) Thickness t(mm) Steel Grades 2)
0 and above — Normal practice t 12.5 B —10 12.5 < t 25.5 D t > 25.5 E t 12.5 D —25 t > 12.5 E In accordance Below —25 — 1) with Table 6.2 NOTES 1) The thickness limitation of Table 6.2 does not apply to plates and sections for hull structures. 2) Steel grades in accordance with 6.1.9. 6.3 Welding and non-destructive testing 6.3.1 General - The requirements of this section are those generally employed for carbon, carbon-manganese, nickel alloy and stainless steels, and may form the basis for acceptance testing of other material. At the discretion of the Administration, impact testing of stainless steel and aluminium alloy weldments may be omitted and other tests may be specially required for any material. 6.3.2 Welding consumables intended for welding of cargo tanks should be in accordance with Recognized Standards unless otherwise agreed with the Administration. Deposited weld metal tests and butt weld tests should be required for all welding consumables, unless otherwise specially agreed with the Administration. The results obtained from tensile and Charpy V-notch impact tests should be in accordance with Recognized Standards. The chemical composition of the deposited weld metal should be recorded for information and approval. 6.3.3 Welding Procedure tests for cargo tanks and Process Pressure vessels (a) Procedure tests are required for all butt welds and the test assemblies should be representative of : Each base material Each type of consumable and welding process Each welding position. For butt welds in plates, the test assemblies should be so prepared that the rolling direction is parallel to the direction of welding. The range of thickness qualified by each welding procedure test should be in accordance with Recognized Standards. Radiographic or ultrasonic testing may be performed at the option of the fabricator or the Administration. Procedure tests for consumables intended for fillet welding should be in accordance with Recognized Standards. In such cases consumables should be selected which exhibit satisfactory impact properties. (b) The following tests should be required from each tests assembly: (i) Cross-weld tests. (ii) Transverse bend tests: These bend tests may be face, root or side bends at the discretion of the Administration. However, longitudinal bend tests may be required in lieu of transverse bend tests in cases where the base material and weld metal have different strength levels. (iii) One set of three Charpy V-notch impacts should be made generally at each of the following locations, as shown in Figure 6.1 : Centre line of the welds Fusion line (F.L.) 1 mm from the F.L. 3 mm from the F.L. 5 mm from the F.L. (iv) Macrosection, microsection and hardness survey may also be required by the Administration. 6.3.4 Test requirements
44
Bilaga
(a) Tensile tests: Generally, tensile strength should not be less than the specified minimum tensile strength for the appropriate parent materials. The Administration may also require that the transverse weld tensile strength should not be less than the specified minimum tensile strength for the weld metal, where the weld metal has a lower tensile strength than that of the parent metal. In every case, the position of fracture is to be reported for information.
(b) Bend test. No fracture is acceptable after a 180°bend over a former of a diameter four times the thickness of the test pieces, unless otherwise specially required by or agreed with the Administration.
(c) Charpy V-notch impact tests : Charpy tests should be conducted at the temperature prescribed for the base material being joined. The results of weld metal impact tests, minimum average energy (E), should be no less than 2.8 kpm. The weld metal requirements for subsize specimens and single energy values should be in accordance with 6.1.4. The results of fusion line and heat affected zone impact tests should show a minimum average energy (E) in accordance with the transverse or longitudinal requirements of the base material, whichever is applicable, and for subside specimens, the minimum average energy (E) should be in accordance with 6.1.4. If the material thickness does not permit machining either full size or standard subsize specimens, the testing procedure and acceptance standards should be in accordance with Recognized Standards.
6.3.5 Welding procedure tests for piping should be carried out and should be similar to those detailed for cargo tanks in 6.3.3. Unless otherwise specially agreed with the Administration, the test requirements should be in accordance with 6.3.4.
6.3.6 Production weld tests
(a) For all cargo tanks and process pressure vessels except integral and membrane tanks, production tests should generally be performed for approximately each 50 m of butt weld joints and should be representative of each welding position. For secondary barriers, the same type production tests as required for primary tanks should be performed except that the number of tests may be reduced subject to agreement with the Administration. Tests, other than those specified in sub-paragraphs (b), (c) and (d) of this paragraph, may be required for cargo tanks or secondary barriers at the discretion of the Administration.
(b) The production tests for independent tanks types A and B and semi-membrane tanks should include the following tests:
(i) Bend tests, and where required for procedure rests one set of three Charpy V-notch tests should be made for each 50 m of weld. The Charpy V-notch tests should be made with specimens having the notch alternately located in the centre of the weld and in the heat affected zone (most critical location based on procedure qualification results). For austenitic stainless steel, all notches should be in the centre of the weld.
(ii) The test requirements are the same as the applicable test requirements listed in 6.3.4 except that impact tests that do not meet the prescribed energy requirements may still be accepted, upon special consideration by the Administration, by passing a drop weight test. In such cases, two drop weight specimens should be tested for each set of Charpy specimens that failed and both must show "no break" performance at the temperature at which the Charpy tests were conducted.
(c) In addition to those testis listed in sub-paragraph (a) of this paragraph for independent tank type C and process pressure vessels, transverse weld tensile tests are required. The test requirements are listed in 6.3.4 except that impact tests that do not meets the prescribed energy requirements may still be accepted upon special consideration by the Administration, by passing a drop weight test.
In such cases, two drop weight specimens should be tested for each set of Charpy specimens that failed, and both must show "no break" performance at the temperature at which the Chirpy tests were conducted.
(d) Production tests for integral and membrane tanks should be in accordance with Recognized Standards.
6.3.7 Non -destructive testing
(a)
(i) For independent tanks type A and semi-membrane tanks where the design tem -perature is -20°C or less, and for independent tanks type B regardless of temperature, all full penetration welds of the shell plating of cargo tanks should be 100 percent inspected by radiographic testing.
(ii) Where the design temperature is higher than -20°C, all full penetration welds in way of intersections and at least 10 percent of the remaining full penetration welds of tank structures should be inspected by radiographic testing.
(iii) In each case the remaining tank structure including the welding of stiffeners and other fittings and attachments should be examined by magnetic particle or dye penetrant methods as considered necessary by the Administration. All testing procedures and acceptance standards should be in accordance with Recognized Standards. The Administration may accept an approved ultrasonic testing procedure in lieu of
45
Bilaga
radiographic testing, but may in addition require supplementary testing by radiography at selected locations. Further, the Administration may require ultrasonic testing in addition to normal radiographic testing. (b) Inspection of independent tanks type C and process pressure vessels should be carried out in accordance with Chapter IV. (c) For integral and membrane tanks, special weld inspection procedures and acceptance criteria should be in accordance with Recognized Standards. (d) Inspection of piping should be carried out in accordance with the requirements of Chapter V. (e) The secondary barrier should be radiographed as considered necessary by the Administration. Where the outer shell of the hull is part of the secondary barrier, all sheer strake butts and the intersections of all butts and seams in the side shell should be tested by radiography.
Figure 6.1 - Orientation and location of Charpy V-notch specimen CHAPTER VII - CARGO PRESSURE / TEMPERATURE CONTROL 7.1 General 7 1.1 Unless the entire cargo system is designed to withstand the full gauge vapour pressure of the cargo under conditions of the upper ambient design temperatures, maintenance of the cargo tank pressure below the MARVS should be provided by one or more of the following means, except as otherwise provided in this section. (a) A system which regulates the pressure in the cargo tanks by the use of mechanical refrigeration. (b) A system whereby the boil-off vapours are utilized as fuel for shipboard use and/or waste heat system subject to the provisions of Chapter XVI. This system may be used at all times, including while in port and while manoeuvring, provided that a means of disposing of excess energy is provided, such as a steam dump system, that is satisfactory to the Administration. (c) A system allowing the product to warm up and increase in pressure. The insulation and/or cargo tank design pressure should be adequate to provide for a suitable margin for the operating time and temperatures involved. The system should be acceptable to the Administration in each case. (d) Other systems acceptable to the Administration. (e) In addition to the above means, the Administration may permit certain cargoes to be controlled by venting cargo vapours to the atmosphere at sea. This may also be permitted in port with the permission of the receiving Administration.
46
Bilaga
7.1 2 The systems required by 7.1.1 should be constructed, fitted and tested to the satisfaction of the Administration. Materials used in their construction should be suitable for use with the cargoes to be carried. For normal service, the upper ambient design temperatures should be:
Sea 32°C
Air 45°C.
For service in especially hot or cold zones these temperatures should be increased or reduced as appropriate by the Administration.
7.1 3 For certain highly dangerous cargoes specified in Chapter XVII, the cargo containment system should be capable of withstanding the full vapour pressure of the cargo under conditions of the upper ambient design temperatures irrespective of any system provided for dealing with boil-off gas.
7.2 Refrigeration systems
7.2.1 A refrigeration system should consist of one or more units capable of maintaining the required cargo pressure/temperature under conditions of the upper ambient design temperatures. Unless an alternative means of controlling the cargo pressure/temperature is provided to the satisfaction of the Administration, a stand-by unit (or units) affording spare capacity at least equal to the largest required single unit should be provided. A "stand-by unit" should consist of a compressor with its driving motor, control system and any necessary fittings to permit operation independently of the normal service units. A stand-by heat exchanger should be provided unless the normal heat exchanger for the unit has an excess capacity of at least 25 percent of the largest required capacity. Separate piping systems are not required.
7.2.2
(a) Where two or more refrigerated cargoes which may react chemically in a dangerous manner are carried simultaneously, special consideration should be given to the refrigeration systems to avoid the possibility of mixing cargoes. For the carriage of such cargoes, separate refrigeration systems, each complete with a standby unit as specified in 7.2.1, should be provided for each cargo. However, where cooling is provided by an indirect or combined system and leakage in the heat exchangers cannot cause mixing of the cargoes under any envisaged condition, separate refrigeration units need not be fitted.
(b) Where two or more refrigerated cargoes are not mutually soluble under the conditions of carriage, so that their vapour pressures would be additive on mixing, special consideration should be given to the refrigeration systems to avoid the possibility of mixing cargoes.
7.2.3 Where cooling water is required in refrigeration systems, an adequate supply should be provided by a pump or pumps used exclusively for this purpose. This pump(s) should have at least two sea suction lines, where practicable leading from sea-chests one port and one starboard. A spare pump of adequate capacity should be provided, which may be a pump used for other services so long as ifs use for cooling would not interfere with any other essential service.
7.2.4 The refrigeration system may be arranged in one of the following ways.
(a) a direct system where evaporated cargo is compressed, condensed and returned to cargo tanks. For certain cargoes specified in Chapter XVII this system should not be used;
(b) an indirect system where cargo or evaporated cargo is cooled or condensed by refrigerant without being compressed ;
(c) a combined system where evaporated cargo is compressed and condensed in a cargo/refrigerant heal exchanger and returned to the cargo tanks. For certain cargoes specified in Chapter XVII this system should not be used.
7.2.5 All primary and secondary refrigerants must be compatible with each other and with the cargo with which they may come into contact. The heat exchange may take place either remotely from the cargo tank or by cooling coils fitted inside or outside the cargo tank.
CHAPTER VIII - CARGO VENT SYSTEMS
8.1 General
All cargo tanks should be provided with a pressure relief system appropriate to the design of the cargo containment system and the cargo being carried. Hold spaces, interbarrier spaces and cargo piping which may be subject to pressures beyond their design capabilities should also be provided with a suitable safety relief system. The pressure safety relief system should be connected to a vent piping system designed so as to minimize the possibility of cargo vapour accumulating about the decks, or entering accommodation service and control station spaces, and machinery spaces, or other spaces where it may create a dangerous condition. Pressure control systems specified by Chapter VII should be independent of the safety relief valves.
47
Bilaga
8.2 Pressure relief systems
8.2.1 Each cargo tank with a volume exceeding 20 m³ should be fitted with at least two pressure relief valves of approximately equal capacity, suitably designed and constructed for the prescribed service. For cargo tanks with a volume not exceeding 20 m³, a single relief valve may be fitted.
8.2.2 Interbarrier spaces should be provided with pressure relief devices to the satisfaction of the Administration.
8.2.3 The setting of the pressure relief valves should not be higher than the maximum pressure for which the cargo tank is designed.
8.2.4 Pressure relief valves should be connected to the highest part of the cargo tank above deck level. Pressure relief valves on cargo tanks with a working temperature below 0°C should be arranged to prevent their becoming inoperative due to ice formation when they are closed. Due consideration should be given to the construction and arrangement of pressure relief valves on cargo tanks subject to low ambient temperatures.
8.2.5 Pressure relief valves should be prototype tested to ensure that the valves have the capacity required. Each valve should be tested to ensure that it opens at the prescribed pressure setting with an allowance not exceeding ± 10% for 0 to 1.5 kp/cm² , ± 6% for 1.5 to 3.0 kp/cm², ± 3% for 3.0 kp/cm² and above. Pressure relief valves should be set and sealed by a competent authority acceptable to the Administration and a record of this action, including the values of set pressure, should be retained aboard the ship.
8.2.6 In the case of cargo tanks permitted to have more than one relief valve setting, this may be accomplished by:
(a) installing two or more properly set and sealed valves and providing means as necessary for isolating the valves not on use from the cargo tank; or
(b) installing relief valves whose settings may be changed by the insertion of previously approved spacer pieces or alternate springs or by other similar means not requiring pressure testing to verify the new set pressure. All older valve adjustments should be sealed.
8.2.7 The changing of the set pressure under the provisions of 8.2.6 should be carried out under the supervision of the master in accordance with procedures approved by the Administration and specified in the ship's operating manual. Changes in set pressures should be recorded in the ship's log and a sign posted in the cargo control room, if provided, and at each relief valve, stating the set pressure.
8.2.8 Stop valves or other means of blanking off pipes between tanks and pressure relief valves to facilitate maintenance should not be fitted unless all the following arrangements are provided :
(a) suitable arrangements to prevent more than one pressure relief valve being out of service at the same time ;
(b) a device which automatically and in a clearly visible way indicates which one of the pressure relief valves is out of service; and
(c) pressure relief valve capacities are such that if one valve is out of service the remaining valves should have the combined relieving capacity required by 8.5. However, this capacity may be provided by all valves if a suitably maintained spare valve is carried on board.
8.2.9Each pressure relief valve installed on a cargo tank should be connected to a venting system, which should be so constructed that the discharge of gas will be directed upwards and arranged so as to minimize the possibility of water or snow entering the vent system. The height of vent exits should be not less than B/3--> or 6m whichever is greater, above the weather deck and 6 m above the working area and the fore and aft gangway.
8.2.10 Cargo tank pressure relief valve vent exits should be arranged at a distance at least equal to B or 25 m, whichever is less, from the nearest air intake or opening to accommodation, service and control station spaces, or other gas-safe spaces. For ships less than 90 m in length, smaller distances may be permitted by the Administration. All other vent exits connected to the cargo containment system should be arranged at a distance of at least 10 m from the nearest air intake or opening to accommodation, service and control station spaces, or other gas-safe spaces.
8.2.11 All other cargo vent exits not dealt with in other chapters should be arranged in accordance with 8.2.9 and 8.2.10.
8.2.12 If cargoes which react in a hazardous manner with each other are carried simultaneously, a separate pressure relief system should be filled for each cargo carried.
8.2.13 In the vent piping system, means for draining liquid from places where it may accumulate should be provided. The pressure relief valves and piping should be so arranged that liquid can under no circumstances accumulate in or near the pressure relief valves.
8.2.14 Suitable protection screens should be fitted on vent outlets to prevent the ingress of foreign objects.
48
Bilaga
8.2.15 All vent piping should be so designed and arranged that it will not be damaged by temperature variations to which it may be exposed, or by the ship's motions.
8.2.16 The back pressure in the vent lines from the pressure relief valves should be taken into account in determining the flow capacity required by 8.5.
8.2.17 Pressure relief valves should be positioned on the cargo tank so that they will remain in the vapour phase under conditions of 15° list and 0.015L trim, where L is as defined in 1.4.25.
8.3 Additional pressure relieving system
8.3.1 Where required by 15.1.4(b), an additional pressure relieving system of sufficient capacity to prevent the tank from becoming liquid full at any time during relief under the fire conditions referred to in 8.5 should be fitted to each tank. This pressure relieving system should consist of:
(a) a relief valve(s) set at a pressure corresponding to the gauge vapour pressure of the cargo at the reference temperature defined in 15.1.4(b); and
(b) an over-ride arrangement to prevent its normal operation. This arrangement should include fusible elements designed to melt at temperatures between 98°C and 104°C and to cause the relief valve specified in sub-paragraph (a) of this paragraph to become operable. Locations for the fusible elements should include the vicinity of the relief valve. The system should become operable upon loss of system power if provided. The over-ride arrangement should not be dependent on any source of ship's power.
8.3.2 The exhaust of such pressure relief valves may be led to the venting system referred to in 8.2.9. If separate venting arrangements are fitted these should be in accordance with the requirements of 8.2.9 to 8.2.15.
8.4 Vacuum protection systems
8.4.1 Cargo tanks designed to withstand a maximum external pressure differential exceeding 0.25 kp/cm² and capable of withstanding the maximum external pressure differential which can be attained at maximum discharge rates with no vapour return into the cargo tanks, or by operation of a cargo refrigeration system, need no vacuum relief protection.
8.4.2 Cargo tanks designed to withstand a maximum external pressure differential not exceeding 0.25 kp/cm², or tanks which cannot withstand the maximum external pressure differential that can be attained at maximum discharge rates with no vapour return into the cargo tanks, or by operation of a cargo refrigeration system, or by sending boil-off vapour to the machinery spaces, should be fitted with:
(a) two independent pressure switches to sequentially alarm and subsequently stop all suction of cargo liquid or vapour from the cargo tank, and refrigeration equipment if fitted, by suitable means at a pressure sufficiently below the maximum external designed pressure differential of the cargo tank; or
(b) vacuum relief valves with a gas flow capacity at least equal to the maximum cargo discharge rate per cargo tank, set to open at a pressure sufficiently below the external design differential pressure of the cargo tank; or
(c) other vacuum relief systems acceptable to the Administration.
8.4.3 Subject to the requirements of Chapter XVII, the vacuum relief valves should admit an inert gas, cargo vapour or air to the cargo tank and should be arranged to minimize the possibility of the entrance of water or snow. If cargo vapour is admitted, it should be from a source other than the cargo vapour lines.
8.4.4 The vacuum protection system should be capable of being tested to ensure that it operates at the prescribed pressure.
8.5 Size of valves
Pressure relief valves should have a combined relieving capacity for each cargo tank to discharge the greater of the following with not more than a 20 percent rise in cargo tank pressure above the MARVS:
(a) the maximum capacity of the cargo tank inerting system if the maximum attainable working pressure of the cargo tank inerting system exceeds the MARVS of the cargo tanks; or
(b) vapours generated under fire exposure computed using the following formula:
Q = FGA0.82
where :
Q = minimum required rate of discharge in cubic metres (cubic feet) per minute of air at standard conditions of 0°C and 1.03 kp/cm² (60°F and 14.7 psia)
F = fire exposure factor for different cargo tank types:
49
Bilaga
F =1.0 tanks without insulation located on deck; F = 0.5 tanks above the deck when insulation is approved by the Administration. (Approval will be based on the use of an approved fire-proofing material, the thermal conductance of insulation, and its stability under fire exposure. ); F = 0.5 uninsulated independent tanks installed in holds; F =0.2 insulated independent tanks in holds (or uninsulated independent lands in insulated holds) ; F =0.1 insulated independent tanks in inerted holds (or uninsulated independent tanks in inerted, insulated holds) , F =0.1 membrane and semi-membrane tanks. For independent tanks partly protruding through the open deck, the )ire exposure factor should be determined on the basis of the surface areas above and below deck. F = gas factor: (i) metric units (ii) British units
with : L=latent heat of the material being vapourized at relieving conditions, in Kcal/kg (Btu per pound): C=constant based on relation of specific heats k, shown in Table 8.1 ; if k is not known C = .606(315) should be used; Z=compressibility factor of the gas at relieving conditions; if not known, Z = 1.0 should be used; T=temperature in degrees K : (273 + degrees C) (R = (460+ degrees F)) at the relieving conditions, i.e. 120 per cent of the pressure at which the pressure relief valve is set; M=molecular weight of the product. Table 8.1 - CONSTANT C
C C
k k
metric British metric British
1.00 0.606 315 1.52 0.704 366
1.02 0.611 318 1.54 0.707 368
1.04 0.615 320 1.56 0.710 369
1.06 0.620 322 1.58 0.713 371
1.08 0.624 324 1.60 0.716 372
1.10 0.628 327 1.62 0.719 374
1.12 0.633 329 1.64 0.722 376
1.14 0.637 331 1.66 0.725 377
1.16 0.641 333 1.68 0.728 379
1.18 0.645 335 1.70 0.731 380
50
Bilaga
1.20 0.649 337 1.72 0.734 382 1.22 0.652 339 1.74 0.736 383 1.24 0.656 341 1.76 0.739 384 1.26 0.660 343 1.78 0.742 386 1.28 0.664 345 1.80 0.745 387 1.30 0.667 347 1.82 0.747 388 1.32 0.671 349 1.84 0.750 390 1.34 0.674 351 1.86 0.752 391 1.36 0.677 352 1.88 0.755 392 1.38 0.681 354 1.90 0.758 394 1.40 0.685 356 1.92 0.760 395 1.42 0.688 358 1.94 0.763 397 1.44 0.691 359 1.96 0.765 398 1.46 0.695 361 1.98 0.767 399 1.48 0.698 363 2.00 0.770 400 1.50 0.701 364 2.02 0.772 401 2.20 0.792 412 A = external surface area of the tank in m² (sq ft) for different tank types: for body of revolution type tanks A = external surface area; for other than bodies of revolution type tanks A = external surface area less the projected bottom surface area; for tanks consisting of an array of pressure vessel tanks: (i) insulation on the ship's structure: A = external surface area of the hold less its projected bottom area; (ii) insulation on the tank structure: A = external surface area of the array of pressure vessels excluding insulation, less the projected bottom area as shown in Figure 8.1.
51
Bilaga
Figure 8.1
CHAPTER IX - ENVIRONMENTAL CONTROL FOR CARGO CONTAINMENT SYSTEMS
9.1 Environmental control within cargo tanks and cargo piping systems
9.1.1 A piping system should be provided to enable each cargo tank to be safely gas-freed, and to be safely purged with cargo gas from a gas-free condition. The system should be arranged to minimize the possibility of pockets of gas or air remaining after gas-freeing or purging.
9.1.2 A sufficient number of gas sampling points should be provided for each cargo tank in order to adequately monitor the progress of purging and gas-freeing. Gas sampling connexions should be valved and capped above the main deck.
9.1.3 For flammable gases, the system should be arranged to minimize the possibility of a flammable mixture existing in the cargo tank during any part of the gas-freeing operation by utilizing an inerting medium as an intermediate step. In addition, the system should enable the cargo tank to be purged with an inerting medium prior to filling with cargo vapour or liquid, without permitting a flammable mixture to exist at any time within the cargo tank.
9.1.4 Piping systems which may contain cargo should be capable of being gas-freed and purged as provided in 9.1.1 and 9.1.3.
9.1.5 Inert gas utilized in these procedures may be furnished from ashore or from the ship.
9.2 Environmental control within the hold spaces (cargo containment systems other than independent tanks type C)
9.2.1 Interbarrier and bold spaces associated with cargo containment systems for flammable gases requiring full secondary barriers should be inerted with a suitable dry inert gas and maintained inerted with make-up gas provided by a shipboard inert gas generation system, or by shipboard storage which should be sufficient for normal consumption for at least thirty days.
9.2.2
(a) Interbarrier and hold spaces associated with cargo containment systems for flammable gases requiring partial secondary barriers should be inerted with suitable, dry inert gas and maintained inerted with make-up gas provided by a shipboard inert gas generation system or by shipboard storage which should be sufficient for normal consumption for at least thirty days; alternatively.
(b) Except as limited by Chapter XVII, the Administration may allow the spaces referred to in sub-paragraph (a) of this paragraph to be filled with dry air provided that the ship maintains a stored charge of inert gas or is fitted with an inert gas generation system sufficient to inert the largest of these spaces; and provided that the configuration of the spaces and the relevant vapour detection systems, together with the capability of the inerting arrangements, ensure that any leakage from the cargo tanks will be rapidly detected and inerting effected before a dangerous condition can develop. Equipment for the provision of sufficient dry air of suitable quality to satisfy the expected demand should be provided.
9.2.3 For non-flammable gases, The spaces referred to in 9.2.1 and 9.2.2 may be maintained with a suitable dry air or inert atmosphere.
9.3 Environmental control of spaces surrounding independent tanks type C
Spaces surrounding refrigerated cargo tanks not having secondary barriers should be filled with suitable dry inert gas or dry air and be maintained in this condition with make-up inert gas provided by a shipboard inert gas generation system, shipboard storage of inert gas, or dry air provided by suitable air drying equipment.
52
Bilaga
9.4 Inerting
9.4.1 Inerting refers to the process of providing a non-combustible environment by the addition of compatible gases, which may be carried in storage vessels or manufactured on board the ship or supplied from the shore. The inert gases should be compatible chemically and operationally, at all temperatures likely to occur within the spaces to be inerted, with the materials of construction of the spaces and the cargo. The dew points of the gases should be taken into consideration.
9.4.2 Where inert gas is also stored for fire-fighting purposes, it should be carried in separate containers and should not or used for cargo services.
9.4.3 Where inert gas is stored at temperatures below 0°C, either as a liquid or vapour, the storage and supply system should be so designed that the temperature of the ship's structure is not reduced below the limiting values imposed on it.
9.4.4 Arrangements suitable for the cargo carried should be provided to prevent the back flow of cargo vapour into the inert gas system.
9.4.5 The arrangements should be such that each space being inerted can be isolated and the necessary controls and relief valves etc. should be provided for controlling pressure in these Spaces.
9.5 Inert gas production on board
9.5.1 The equipment should be capable of producing inert gas with an oxygen content at no time greater than 5 percent by volume subject to the Special Requirements of Chapter XVII. A continuous reading oxygen content meter should be fitted to the inert gas supply from the equipment and should be fitted with an alarm at a maximum of 5 percent oxygen content by volume subject to the requirements of Chapter XVII. Additionally, where inert gas is made by an onboard process of fractional distillation of air which involves the storage of the cryogenic liquefied nitrogen for subsequent release, the liquefied gas entering the storage vessel should be monitored for traces of oxygen to avoid possible initial high oxygen enrichment of the gas when released for inerting purposes.
9.5.2 An inert gas system should have pressure controls and monitoring arrangements appropriate to the cargo containment system A means acceptable to the Administration, located in the cargo area, of preventing return of cargo gas should be provided.
9.5.3 Spaces containing inert gas generating plants should have no directs access to accommodation, service or control station spaces, but may be located in machinery spaces. If such plants are located in machinery spaces or other spaces outside she Cargo tank area, two non-return valves, or equivalent devices should be fitted in the inert gas main in the cargo area as required in 9.5.2. inert gas piping should not pass through accommodation, service or control station spaces.
9.5.4 Flame burning equipment for generating inert gas should not be located within the cargo area. Special consideration may be given to the location of inert gas generating equipment using the Catalytic Combustion Process.
CHAPTER X - ELECTRICAL ARRANGEMENTS
10.1 General
10.1.1 The provisions of this chapter are applicable to ships carrying flammable products and should be applied in conjunction with Part C of Chapter II of the 1974 Safety Convention.
10.1.2 Electrical installations should be such as to minimize the risk of fire and explosion from flammable products. Electrical installations complying with this chapter should not be considered as a source of ignition for the purposes of Chapter III.
10.1.3 Administrations should take appropriate steps to ensure uniformity in the implementation and application of the provisions of this chapter in respect of electrical installations.*
* Reference is made to the Recommendations published by the international Electrotechnical Commission and in particular to Publication 92-5, Chapter XX, Tankers.
10.1.4 Electrical equipment and/or wiring should not be installed in gas-dangerous spaces or zones unless essential for operational purposes, when the exceptions listed in 10.2 are permitted .
10.1.5 Where electrical equipment is installed in gas-dangerous spaces or zones as provided in 10.1.4, it should be to the satisfaction of the Administration and approved by the relevant authorities recognized by the Administration for operation in the flammable atmosphere concerned.
10.2 Types of equipment
Certified safe type equipment may be fitted in gas-dangerous spaces and zones in accordance with the following
53
Bilaga
paragraphs: 10.2.1 Intrinsically strafe electrical equipment and wiring may be fitted in all gas-dangerous spaces and zones as defined in 1.4.16. 10.2.2 Cargo containment systems: Submerged cargo pump motors and their supply cables. Arrangements should be made to automatically shut down the motors in the event of low liquid level. This may be accomplished by sensing low pump discharge pressure, low motor current, or low liquid level. This shutdown should be alarmed at the cargo control station. Cargo pump motors should be capable of being isolated from their electrical supply during gas-freeing operations. 10.2.3 Hold spaces where cargo is carried in a cargo containment system requiring a secondary barrier: Supply cables for submerged cargo pump motors. 10.2.4 Hold spaces where cargo is carried in a cargo containment system not requiring a secondary barrier; spaces separated from the hold spaces described in 1.4 16(d)(i) by a single gas-tight steel boundary : (a) Through runs of cables. (b) Lighting fittings with pressurized enclosures or of the flame-proof type. The lighting system should be divided between at least two branch circuits. All switches and protective devices should interrupt all poles or phases and be located in a gas-safe space. (c) Flame-proof motors for valve operation for cargo or ballast systems may be installed in spaces described in 1.4.16(e) (d) Electrical depth sounding or log devices and impressed current cathodic protection system anodes or electrodes, These devices should be housed in gas-tight enclosures. (e) Flame-proof general alarm audible indicators may be installed in spaces described in 1.4.16(e). 10.2.5 Cargo pump rooms and cargo compressor rooms: (a) Lighting fittings with pressurized enclosures or of the flame-proof type. The lighting system should be divided between at least two branch circuits. All switches and protective devices should interrupt all poles or phases and be located in a gas-safe space. (b) Electric motors for driving cargo pumps or cargo compressors should be separated from these spaces by a gas-tight bulkhead or deck. Flexible couplings or other means of maintaining alignment should be fitted to the shafts between the driven equipment and its motors and, in addition, suitable glands should be provided where the shafts pass through the gas-tight bulkhead or deck. Such electric motors and associated equipment should be located in a compartment complying with Chapter XII. (c) Where operational or structural requirements are such as to make it Impossible to comply with the method described in sub-paragraph (b) of this paragraph, motors of the following certified safe types may be installed in cargo pump rooms or cargo compressor rooms, provided they are of: (i) increased safety type with flame-proof enclosure, or (ii) pressurized type. (d) Flame-proof general alarm audible indicator. 10.2.6 Zones on open decks or non-enclosed spaces on open deck, within 3 m of any cargo tank outlet, gas or vapour outlet, cargo pipe flange, cargo valves or entrances and ventilation openings to cargo pump rooms and cargo compressor rooms, zones on the open deck over the cargo area and 3 m forward and aft of the cargo area on the open deck and up to a height of 2.4 m above the deck; zones within 2.4 m of the outer surface of a cargo containment system where such surface is exposed to the weather. (a) Certified safe type equipment. (b) Through runs of cables. 10.2.7 Enclosed or semi-enclosed spaces in which pipes containing cargo products are located and compartments for cargo hoses: (a) Lighting fittings with pressurized enclosures or of the flame-proof type. The lights system should be divided between at least two branch circuits. All switches and protective devices should interrupt all poles or phases and be located in a gas-safe space (b) Through runs of cables.
54
Bilaga
10.2.8 Enclosed or semi-enclosed spaces having a direct opening into any gas-dangerous space or zone should have electrical installations complying with the requirements for the space or zone to which the opening leads.
10.2.9 Electrical equipment within spaces protected by air-locks should be of the certified strafe type unless arranged to be de-energized by measures required by 3.6.4.
CHAPTER XI - FIRE PROTECTION AND FIRE EXTINGUISHING
11.1 Structural fire protection
11.1.1 The relevant structural fire protection provisions (i.e. Regulations 56, 57, 58 and 59) of Chapter II-2 of the 1974 Safety Convention should apply to all ships.
11.1.2 All sources of ignition should be excluded from spaces where flammable vapour may be present except as otherwise provided in Chapters X and XVI.
11.2 Fire water main equipment
11.2.1 All ships, irrespective of size, carrying products which are subject to this Code should comply with the requirements of Regulations 5 and 52 of Chapter II-2 of the 1974 Safety Convention, except that the required fire pump capacity and fire main and water service pipe diameter should not be limited by the provisions of paragraphs (a)(ii) and (c)(i) of Regulation 5 when the fire pump and fire main are used as part of the water spray system as permitted by 11.3.3. In addition, the requirements of Regulation 5(c)(ii) should be met at a pressure of at least 5.0 kp/cm².
11.2.2 The arrangements should be such that at least two jets of water can reach any part of the deck in the cargo area and those portions of the cargo containment system and tank covers above the deck. The necessary number of lire hydrants should be located to satisfy the above arrangements and to comply with the requirements of paragraphs (c) (ii) and (IV) of Regulation 52 of Chapter II-2 of the 1974 Safety Convention, with hose lengths not exceeding 33 m.
11.2.3 Stop valves should be fitted in any cross-over provided and in the fire main(s) at the poop front and at intervals of not more than 40 m between hydrants on the deck in the cargo area for the purpose of isolating damaged sections of the main.
11.2.4 All water nozzles provided for fire-fighting use should be of an approved dual-purpose type capable of producing either a spray or a jet. All pipes, valves, nozzles and other fittings in the fire-fighting systems should be resistant to corrosion by sea-water, for example by galvanized pipe, and to the effect of fire.
11.2.5 Where the ship's engine room is unattended, arrangements should be made to start and connect to the dire main at least one fire pump by remote control from the bridge or other control station outside the cargo area.
11.3 Water spray system
11.3.1 On ships carrying flammable or toxic products, a water spray system for cooling, there prevention and crew protection should be installed to cover:
(a) exposed cargo tank domes and any exposed parts of cargo tanks;
(b) exposed on-deck storage vessels for flammable or toxic products;
(c) cargo liquid and vapour discharge and loading manifolds and the area of their control valves and any other areas where essential control valves are situated and which should be at least equal to the area of the drip trays provided; and
(d) boundaries of superstructures, deckhouses and cargo control rooms facing the Cargo area.
11.3.2 The system should be capable of covering all areas mentioned in 11.3.1 with a uniformly distributed water spray of at least 10Ǻ/m² per minute for horizontal projected surfaces and 4Ǻ/m² per minute for vertical surfaces. On vertical surfaces, spacing of nozzles protecting lower areas may take account of anticipated rundown from higher areas. Stop valves should be fitted at intervals in the spray main for the purpose of isolating damaged sections. Alternatively, the system may be divided into two or more sections which may be operated independently provided the necessary controls are located together, out of the cargo area. A section protecting any area included in 11.3.1(a) and (b) should cover the whole of the athwartship tank grouping which includes that area.
11.3.3 The capacity of the water spray pumps should be sufficient to deliver the required amount of water to all areas simultaneously or, where the system is divided into sections, the arrangements and capacity should be such as to simultaneously supply water to any one section and the surfaces specified in 11.3.1(c) and (d). Alternatively, the main fire pumps may be used for this service provided that their total capacity is increased by the amount needed for the spray system. In either case, a connection, through a stop valve, should be made
55
Bilaga
between the fire main and water spray main outside the cargo area.
11.3.4 Subject to the approval of the Administration, water pumps normally used for other services may be arranged to supply the water spray main.
11.3.5 All pipes, valves, nozzles and other fittings in the water spray systems should be resistant to corrosion by sea-water, for example by galvanized pipe, and to the effect of fire.
11.4 Dry chemical powder fire extinguishing systems
11 4.1 Ships intending to carry flammable products should be fitted with a fixed dry chemical powder type extinguishing system(s) for the purpose of fighting fire on the dock in the cargo area and bow or stern cargo handling areas if applicable. The system and the dry chemical powder should be adequate for this purpose and satisfactory to the Administration.
11.4.2 The system should be capable of delivering powder from at least two hand hose line or a combination monitor/hand hose line(s) to any part of the above-deck exposed cargo area including above-deck product piping. The system should be activated by an inert gas, suck as nitrogen, used exclusively for this purpose and stored in pressure vessels adjacent to the powder containers.
11.4.3 The system for use in the cargo area should consist of at least two independent self-contained dry chemical powder units with associated controls, pressurizing medium fixed piping, monitors or hand hose lines. For ships with a cargo capacity of less than 1.000 m³ the Administration may permit only one such unit to be fitted. A monitor should be provided and so arranged as to protect the cargo loading and discharge manifold areas and be capable of actuation and discharge locally and remotely. All hand hose lines and monitor should be capable of actuation at the hose storage reel or monitor. At least one hand hose line or monitor should be situated at the after end of the cargo area.
11.4.4 A fire extinguishing unit having two or more monitors, hand hose lines, or combinations thereof, should have independent pipes with a manifold at the powder container, unless a suitable alternative means is provided to ensure proper performance as approved by the Administration. Where two or more pipes are attached to a unit the arrangement should be such that any or all of the monitors and hand hose lines should be capable of simultaneous or sequential operation at their rated capacities.
11.4.5 The capacity of a monitor should be not less than 10 kg/sec. Hand hose lines should be non-kinkable and be fitted with a nozzle capable of on/off operation and discharge at a rate not less than 3.5 kg/sec. The maximum discharge rate should be such as to allow operation by one man. The length of a hand hose line should not exceed 33 m. Where fixed piping is provided between the powder container and a hand hose line or monitor, the length of piping should not exceed that length which is capable of maintaining the powder in a fluidized state during sustained or intermittent use. and which can be purged of powder when the system is shut down. Hand hose lines and nozzles should be of weather resistant construction or stored in weather resistant housing or covers and be readily accessible.
11.4.6 A sufficient quantity of dry chemical powder should be stored in each container to provide a minimum 45 second discharge time for all attached monitors and hand hose lines. Coverage from fixed monitors should be in accordance with the tool lowing requirements:
Fixed monitors capacity (kg/sec. Each ) 10 25 45
maximum distance of coverage (m) 10 30 40
Hand hose lines should be considered to have a maximum effective distance of coverage equal to the length of hose. Special consideration should be given where areas to be protected are substantially elevated above the monitor or hand hose reel locations.
11.4.7 Ships lilted with bow or stern loading and discharge arrangements should be provided with an additional dry chemical powder unit complete with at least one monitor and one hand hose line complying with the requirements of 11.4.1 to 11.4.6. This additional unit should be located to protect the bow or stern loading and discharge arrangements. The area of the cargo line forward or aft of the cargo area should be protected by hand hose lines.
11.5 Gas-dangerous enclosed spaces
11.5.1 Enclosed spaces normally entered where flammable liquid or vapour leakage may occur, such as cargo compressor and pump rooms, should be provided with a fixed inerting/fire smothering installation. Carbon dioxide and steam smothering systems should be avoided unless due consideration is given to the danger of static electricity.
11.5.2 Provision should be made for closure of ventilation and any other openings into the space and, where necessary, for an audible warning signal to be sounded within the space for the emergency escape of personnel before admission of the inerting/extinguishing medium.
56
Bilaga
11.6 Firemen's outfits and protective clothing
11.6.1 All ships should comply with the requirements of Regulation 52(j) of Chapter II-2 of the 1974 Safety Convention. In addition, on all ships carrying flammable products there should be stowed with each fireman's outfit a set of fire protective clothing having a water-resistant outer surface and including a suitable helmet, gloves and boors, all of electrically non-conductive materials. Ships below 25,000 m³ capacity carrying flammable products should carry at least three firemen's outfits and sets of fire protective clothing to protect the skin from radiant heat; ships of 25,000 m³ capacity and over should carry at least five outfits and sets. All protective clothing should be satisfactory to the Administration.
11.6.2 Any breathing apparatus required as part of a fireman's outfit should be a self contained air-breathing apparatus having a capacity of at least 1,200Ǻ of free air.
CHAPTER XII - MECHANICAL VENTILATION IN CARGO AREA
12.1 Spaces required to be entered during normal cargo handling operations
12.1.1 Electric motor rooms, cargo compressor and pump rooms, other enclosed spaces which contain cargo handling equipment and similar spaces in which cargo handling operations are performed should be fitted with mechanical ventilation systems capable of being controlled from outside such spaces. Provision should be made to ventilate such spaces prior to entering the compartment and operating the equipment and a warning notice requiring the use of such ventilation should be placed outside the compartment.
12.1.2 Mechanical ventilation inlets and outlets should be arranged to ensure sufficient air movement through the space to avoid the accumulation of flammable or toxic vapours and to ensure a sale working environment, but in no case should the ventilation system have a capacity of less than 30 changes of air per hour based upon the total volume of the space. As an exception, gas-safe cargo control rooms may have 8 changes of air per hour.
12.1.3 Ventilation systems should be fixed, and if of the negative pressure type, permit extraction from either or both upper and lower parts of the spaces dependent on the density of the vapours of the products carried.
12.1.4 In rooms housing electric motors driving cargo compressors or pumps, spaces except machinery spaces containing inert gas generators, cargo control rooms if considered as gas-safe spaces and other gas-safe spaces within the cargo area, the ventilation should be of the positive pressure type.
12.1.5 In cargo compressor and pump rooms and in cargo control rooms if considered gas- dangerous, the ventilation should be of the negative pressure type.
12.1.6 Ventilation exhaust ducts from gas-dangerous spaces should discharge upwards in locations at least 10 m in the horizontal direction from ventilation intakes and openings to accommodation, service and control station spaces and other gas-safe spaces.
12.1.7 Ventilation intakes should be so arranged as to minimize the possibility of re-cycling hazardous vapours from any ventilation discharge opening.
12.1.8 Ventilation ducts from gas-dangerous spaces should not be led through engine rooms, accommodation, service or control station spaces, except as allowed in Chapter XVI.
12.1.9 Electric motors driving fans should be placed outside the ventilation ducts if the carriage of flammable products is intended. Ventilation fans should not produce a source of vapour ignition in either the ventilated space or the ventilation system associated with the space. Ventilation fans and fan ducts, in way of fans only, for gas-dangerous spaces should be of non-sparking construction defined as:
(a) impellers and/or housing of non-metallic construction, due regard being paid to the elimination of Static electricity;
(b) impellers and housing of non-errors materials;
(c) impellers and housing of austenitic (stainless) steel;
(d) ferrous impellers and housing with not less than 13 mm design tip clearance.
Any combination of an aluminium or magnesium alloy fixed or rotating component and a ferrous fixed or rotating component, regardless of tip clearance, is considered a sparking hazard and should not be used in these places.
12.1.10 Spare parts should be carried for each type of fan on board referred to in this chapter.
12.1.11 Protection screens of not more than 13 mm square mesh should be fitted in outside openings of ventilation ducts.
12.2 Spaces not normally entered
Hold spaces, interbarrier spaces, void spaces, cofferdams, spaces containing cargo piping and other spaces where
57
Bilaga
cargo vapours may accumulate, should be capable of being ventilated to ensure a safe environment when entry into the spaces is necessary. Where a permanent ventilation system is not provided for such spaces, approved means of portable mechanical ventilation should be provided. Where necessary owing to the arrangement of spaces, such as hold spaces and interbarrier spaces, essential ducting for such ventilation should be permanently installed. Fans or blowers should be clear of personnel access openings, and should comply with 12.1.9.
CHAPTER XIII - INSTRUMENTATION (GAUGING, GAS DETECTION)
13.1 General
13.1.1 Each cargo tank should be provided with means for indicating level, pressure and temperature of the cargo. Pressure gauges and temperature indicating devices should be installed in the liquid and vapour piping systems, in cargo refrigerating installations and in the inert gas system as detailed in this chapter.
13.1.2 If the loading and unloading of the ship is performed by means of remotely controlled valves and pumps, all controls and indicators associated with a given cargo tank should be concentrated in one control position.
13.1.3 Instruments should be tested to ensure reliability in the working conditions and recalibrated at regular intervals. Testing procedures for instruments and the intervals between recalibration should be approved by the Administration.
13.2 Level indicators for cargo tanks
13.2.1 Each cargo tank should be fitted with at least one liquid level gauging device, designed to operate at pressures not less than the MARVS of the cargo tank and at temperatures within the cargo operating temperature range. Where only one liquid level gauge is fitted it should be arranged so that any necessary maintenance can be carried out while the cargo tank is in service.
13.2.2 Cargo tank liquid level gauges may be of the following types subject to any special requirement for particular cargoes shown in column "g" of Chapter XIX:
(a) indirect devices, which determine the amount of cargo by means such as weighing or pipe flow meters;
(b) closed devices, which do not penetrate the cargo tank, such as devices using radioisotopes or ultrasonic devices;
(c) closed devices, which penetrate the cargo tank, but which form part of a closed system and keep the cargo from being released, such as float type systems, electronic probes, magnetic probes and bubble tube indicators. If a closed gauging device is not mounted directly on the tank it should be provided with a shut-off valve located as close as possible to the tank;
(d) restricted devices, which penetrate the tank and when in use permit a small quantity of cargo vapour or liquid to escape to the atmosphere, such as fixed tube and slip tube gauges. When nor in use, the devices should be kept completely closed. The design and installation should ensure that no dangerous escape of cargo can take place when opening the device. Such gauging devices should be so designed that the maximum opening does not exceed 1.5 mm diameter or equivalent area, unless the device is provided with an excess flow valve.
13.2.3 Sighting ports with a suitable protective cover and situated above the liquid level with an internal scale may be allowed by the Administration as a secondary means of gauging for cargo tanks which are designed for a pressure not higher than 0.7 kp/cm².
13.2.4 Tubular gauge glasses should not be fitted. Gauge glasses of the robust type as fitted on high pressure boilers and fitted with excess flow valves may be allowed by the Administration for deck tanks, subject to any provisions of Chapter XVII.
13.3 Liquid level alarms
13.3.1 Except as provided in 13.3.2, each cargo tank should be fitted with a high liquid level alarm operating independently of other liquid level indicators and giving an audible and visual warning when activated. This liquid level alarm or another independent sensor should also automatically actuate the shut-off of the flow of cargo to the tank in a manner which will both avoid excessive liquid pressure in the loading line and prevent the tank from becoming liquid full.
13.3.2 Unless required otherwise in Chapter XVII, a high liquid level alarm and automatic shut-off of cargo tank filling need not be required when the cargo tank is either:
(a) a pressure tank with a volume of not more than 200 m³ ; or
(b) designed to withstand the maximum possible pressure during the loading operation and such pressure is below that of the start to discharge pressure of the cargo tank relief valve.
58
Bilaga
13.4 Pressure gauges 13.4.1 The vapour space of each cargo tank should be provided with a pressure gauge which should incorporate an indicator in the cargo control position. In addition, a high pressure alarm and, if vacuum protection is required, a low pressure alarm, should be provided on the bridge. Maximum and minimum allowable pressures should be marked on the indicators. 13.4.2 Each cargo pump discharge line and each liquid and vapour cargo manifold should be provided with at least one pressure gauge. 13.4.3 Local reading manifold pressure gauges should be provided to indicate the pressure between stop valves and hose connexions to the shore. 13.4.4 Hold spaces and interbarrier spaces without open connexion to the atmosphere should be provided with pressure gauges. 13.5 Temperature indicating devices 13.5.1 Each cargo tank should be provided with at least two devices for indicating cargo temperatures, one placed at the bottom of the cargo tank and the second near the top of the tank, below the highest allowable liquid level. The temperature indicating devices should be marked to show the lowest temperature for which the cargo tank has been approved by the Administration. 13.5.2 When cargo is carried in a cargo containment system with a secondary barrier at a temperature lower than -55°C, temperature indicating devices should be provided within the insulation or on the hull structure adjacent to cargo containment systems. The devices should give readings at regular intervals and, where applicable, audible warning of temperatures approaching the lowest for which the hull steel is suitable. 13.5.3 If cargo is to be carried at temperatures lower than -55°C, the cargo tank boundaries, if appropriate for the design of the cargo containment system, should be fitted with temperature indicating devices as follows: (a) A sufficient number of devices to establish that an unsatisfactory temperature gradient does not occur. (b) On one tank a number of devices in excess of those required in sub-paragraph (a) of this paragraph in order to verify that the initial cool down procedure is satisfactory. These devices may be either temporary or permanent. When a series of similar ships is built, the second and successive ships need not comply with the requirements of this sub-paragraph. 13.5.4 The number and position of temperature indicating devices should be to the satisfaction of the Administration. 13.6 Gas detection requirements 13.6.1 Gas detection equipment acceptable to the Administration and suitable for the gases to be carried should be provided in accordance with column "f" of Chapter XIX. 13.6.2 In every installation, the positions of fixed sampling heads should be determined with due regard to the density of the vapours of the products intended to be carried and the dilution resulting from compartment purging or ventilation. 13.6.3 Pipe runs from sampling heads should not be led through gas-safe spaces except as permitted by 13.6.5. 13.6.4 Audible and visual alarms from the gas detection equipment, if required by this section should be located on the bridge, in the cargo control position, and at the gas detector readout location. 13.6.5 Gas detection equipment may be located in the cargo control station, on the bridge or at other suitable locations. When located in a gas-safe space the following conditions should be met: (a) gas-sampling lines should have shut-off valves or an equivalent arrangement to prevent crosscommunication with gas-dangerous spaces; and (b) exhaust gas from the detector should be discharged to the atmosphere in a safe location. 13.6.6 Gas detection equipment should be so designed that it may readily be tested. Testing and calibration should be carried out at regular intervals. Suitable equipment and span gas for this purpose should be carried on board. Where practicable, permanent connexions for such equipment should be fitted. 13.6.7 A permanently installed system of gas detection and audible and visual alarms should be provided for: (a) cargo pump rooms; (b) cargo compressor rooms; (c) motor rooms for cargo handling machinery;
59
Bilaga
(d) cargo control rooms unless designated as gas-safe;
(e) other enclosed spaces in the cargo area where vapour may accumulate including hold spaces and interbarrier spaces for independent tanks other than type C;
(f) ventilation hoods and gas ducts where required by Chapter XVI , and
(g) air-locks.
13.6.8 The gas detection equipment should be capable of sampling and analysing from each sampling head location sequentially at intervals not exceeding 30 minutes, except that in the case of gas detection for the ventilation hoods and gas ducts referred to in 13.6.7(f) sampling should be continuous. Common sampling lines to the detection equipment should not be fitted.
13.6.9 In the case of products which are toxic or toxic and flammable, the Administration may authorize the use of portable equipment, except when column "h" of Chapter XIX refers to 17.11, for toxic detection as an alternative to a permanently installed system, if used before entry of the spaces listed in 13.6.7 by personnel and thereafter at 30 minute intervals whilst occupied by them.
13.6.10 For the spaces listed in 13.6.7, alarms should be activated for flammable products when the vapour concentration reaches 30 percent of the lower flammable limit.
13.6.11 In the case of flammable products, where cargo containment systems other than independent tanks are used, hold spaces and/or interbarrier spaces should be provided with a permanently installed system of gas detection capable of measuring gas concentrations of 0 to 100 percent by volume. The detection equipment, equipped with audible and visual alarms, should be capable of sampling and detecting from each sampling head sequentially at intervals not exceeding 30 minutes. Alarms should be activated when the vapour concentration reaches the equivalent of 30 percent of the lower flammable limit in air or such other limits as may be approved by the Administration in the light of particular cargo containment arrangements. Common sampling lines to the detection equipment should not be fitted.
13.6.12 In the case of toxic gases, hold spaces and/or interbarrier spaces should be provided with a permanently installed piping system for obtaining gas samples from the spaces. Gas from these spaces should be sampled and analysed from each sampling head location by means of fixed or portable equipment at intervals not exceeding 4 hours and in any event before personnel enter the space and at 30 minute intervals whilst they remain therein.
13.6.13 Every ship should be provided with at least two sets of portable gas detection equipment acceptable to the Administration and suitable for the products to be carried.
13.6.14 A suitable instrument for the measurement of oxygen levels in inert atmospheres should be provided.
CHAPTER XIV - PERSONNEL PROTECTION
14.1 For protection of crew members engaged in loading and discharging operations, suitable protective equipment including eye protection should be provided taking into account the character of the products.
14.2 Protective equipment should be kept in easily accessible places and in special lockers.
14.3 Sufficient, but not less than 3 complete sets of safety equipment, in addition to the equipment required by Chapter II-2 of the 1974 Safety Convention, should be provided, each permitting personnel to enter and work in a gas filled space.
14.4 One complete set of safety equipment should consist of:
(a) one self-contained air-breathing apparatus not using stored oxygen, having a capacity of at least 1200 l of free air;
(b) protective clothing, boots, gloves and tight-fitting goggles;
(c) steel cored rescue line with belt; and
(d) explosion-proof lamp.
14.5 An adequate supply of compressed air should be provided by a special compressor and at least 3 spare bottles per set. For small ships, the Administration may accept additional bottles of compressed air in lieu of the compressor.
14.6 Safety equipment as required in 14.3 should be kept in a suitable, clearly marked locker in a readily accessible place.
14.7 The compressed air equipment should be inspected at least once a month by a responsible officer and the inspection recorded in the ship's log book, and inspected and tested by an expert at least once a year.
14.8 A stretcher which is suitable for hoisting an injured person from spaces below deck, should be kept in a readily
60
Bilaga
accessible location.
14.9 Medical first aid equipment including oxygen resuscitation equipment and antidotes, if available, for products carried should be provided on board.
CHAPTER XV - FILLING LIMITS FOR CARGO TANKS
15.1 General
15.1.1 No cargo tanks should be more than 98 percent liquid full at the reference temperature, except as permitted by 15.1.3.
15.1.2 The maximum volume to which a cargo tank should be loaded is:
where :
VL=maximum volume to which the tank may be loaded
V=volume of the tank
dR=relative density of cargo at the reference temperature
dL=relative density of cargo at the loading temperature and pressure.
15.1.3 The Administration may allow a greater filling limit than 98 percent in 15.1.1 and 15.1.2 at the reference temperature, taking into account the shape of the tank, arrangements of pressure relief valves, accuracy of level and temperature gauging and the difference between the loading temperature and the temperature corresponding to the vapour pressure of the cargo at the set pressure of the pressure relief valves, provided the conditions of 8.2.17 are maintained.
15.1.4 For the purpose of this chapter only, "reference temperature" means:
(a) The temperature corresponding to the vapour pressure of the cargo at the set pressure of the pressure relief valves when no cargo vapour pressure/temperature control as referred to in Chapter VII is provided.
(b) The temperature of the cargo upon termination of loading, during transport, or at unloading, whichever is the greater, when a cargo vapour pressure/temperature control as referred to in Chapter VII is provided. If this reference temperature would result in the cargo tank becoming liquid full before the cargo reaches a temperature corresponding to the vapour pressure of the cargo at the set pressure of the relief valves required in 8.2, an additional pressure relief system complying with 8.3 should be fitted.
15.2 Information to be provided to the master
The maximum allowable tank filling limits for each cargo tank should be indicated for each product which may be carried, for each loading temperature which may be applied and for the applicable maximum reference temperature, on a list to be approved by the Administration. Pressures at which the pressure belief valves, including those valves required by 8.3, have been set should also be stated on the list A copy of the list should be permanently kept on board by the master.
CHAPTER XVI - USE OF CARGO AS FUEL
16.1 Methane (LNG) is the only cargo whose vapour or boil-off gas may be utilized in main propelling machinery rooms and boiler rooms and in such rooms may be utilized only in boilers, inert gas generators, and combustion engines.
16.2 Gas fuel lines should not pass through accommodation, service or control station spaces. Gas lines maw pass through or extend into other spaces provided they fulfil one of the following:
(a) The gas fuel line should be a double wall piping system with the gas fuel contained in the inner pipe. The space between the concentric pipes should be pressurized with inert gas at a pressure greater than the fuel pressure. Suitable alarms mould be provided to indicate a loss of pressure between the pipes.
(b) The gas fuel lines should be installed in a mechanically exhaust ventilated pipe or duct. The air space between the outer and inner walls of piping or ducts should be equipped with mechanical ventilation having a capacity of at least 30 air changes per hour. The ventilation system should be arranged to maintain a pressure less than the atmospheric pressure. The fan motors should be placed outside the ventilation pipe or duct. The ventilation outlet should be placed in a position where no flammable gas-air mixture may be ignited. The ventilation inlet should be so arranged that gas or gas-air mixture will not be drawn into system. The ventilation should always be in operation when there is gas in the supply pipeline. Continuous gas detection should be provided to indicate leaks
61
Bilaga
and to shut down the gas fuel supply to the machinery space in accordance with 16.10. The exhaust fan for this ducts should be arranged so that the gas fuel supply to the machinery space will be cut off if the required air flow is not established and maintained.
16.3 If a gas leak occurs, the gas fuel supply should not be operated until the leak has been found and repaired. Instructions to this effect should be placed in a prominent position in the machinery space.
16.4 The double wall piping system or the ventilation duct provided for the gas fuel lines should terminate at the ventilation hood or casing required by 16.5.
16.5 A ventilation hood or casing should be provided for the areas occupied by flanges, valves, etc., and for the gas fuel piping at the gas utilization unit, such as boiler, diesel engine, gas turbine, which is not enclosed in the double wall piping system or ventilated duct. If this ventilation hood or casing is not served by the exhaust ventilation fan serving a duct as specified in 16.2(b), then it should be equipped with an exhaust ventilation system and continuous gas detection should be provided to indicate leaks and to shut down the gas fuel supply to the machinery space in accordance with 16.10. The exhaust fan should be arranged so that the gas fuel supply to the machinery space will be cut off if the exhaust ventilation is not functioning so as to produce the required air flow. The hood or easing should be installed or mounted to permit the ventilating air to sweep across the gas utilization unit and be exhausted at the top of the hood or casing.
16.6 Each gas utilization unit should be provided with a set of three automatic valves. Two of these valves should be in series in the gas fuel pipe to the consuming equipment. The other valve should be in a pipe that vents, to a safe location in the open air, that portion of the gas fuel piping that is between the two series valves. These valves should be arranged so that failure of necessary forced draft, loss of flame on boiler burners, abnormal pressure in the gas fuel supply line, or failure of the valve control actuating medium will cause the two gas fuel valves which are in series to close automatically and cause the vent valve to open automatically. Alternatively, the function of one of the series valves and the valve in the vent line can be incorporated into one valve body so arranged that when one of the above conditions occurs, flow to the gas utilization unit will be blocked and the vent opened.
16.7 A master gas fuel valve that can be closed from within the machinery space should be provided outside the machinery space. The valve should be arranged so as to close automatically if leakage of gas is detected, or loss of ventilation for the duct or casing or loss of pressurization of the double wall gas fuel piping occurs.
16.8 Provision should be made for inerting and gas-freeing that portion of the gas fuel piping system located in the machinery space.
16.9 Make-up air for the required ventilation air system and discharge of the air from the ventilation system should be respectively from and to a safe location.
16.10 Gas detection systems provided in accordance with the requirements of 16.2 and 16.5 should alarm at 30 percent of the lower flammable limit and shut down the gas fuel supply to the machinery space before the gas concentration reaches 60 percent of the lower flammable limit.
16.11 All details of the gas fuel system should be submitted to the Administration for approval.
16.12 The provisions of this chapter do not preclude the use of gas fuel for other services in other locations, such as cargo reliquefaction and inert gas generation, provided that such other services and locations should be subject to special consideration by the Administration.
CHAPTER XVII - SPECIAL REQUIREMENTS
17.1 General
Many of the products covered by the Code have individual characteristics which necessitate special requirements for their safe carriage. These are requirements additional to the general requirements of the Code.
The provisions of this chapter are applicable where reference is made in column "h" of Chapter XIX.
17.2 Personnel protection
17.2.1 Respiratory protection suitable for the products carried should be available for every person on board. Two additional sets should be permanently located in the wheelhouse.
17.2.2 Suitably marked decontamination showers and an eye wash should be available on deck in convenient locations.
17.2.3 Three complete sets of safety equipment should be provided in addition to those required in 14.3
17.2.4 Personnel should be protected against the effects of a major cargo release by the provision of a space within the accommodation area designed and equipped to the satisfaction of the Administration.
17.2.5 For certain highly dangerous products, cargo control rooms should be the gas-safe type only.
62
Bilaga
17.3 Materials of construction Materials which may be exposed to cargo during normal operations should be resistant to the corrosive action of the gases. In addition, the following materials of construction for cargo tanks, and associated pipelines, valves, fittings and other items of equipment should not be used for certain products as specified in column "h" of Chapter XIX: 17.3.1 Mercury, copper and copper bearing alloys, and zinc. 17.3.2 Copper, silver, mercury, magnesium and other acetylide-forming metals. 17.3.3 Aluminium and aluminium bearing alloys. 17.4 Independent tank type C The provisions of 7.1.3 apply. The design pressure of the cargo tank should take into account any padding pressure and/or vapour discharge unloading pressure. 17.5 Refrigeration systems 17.5.1 Only the indirect system described in 7.2.4(b) should be used. 17.5.2 For ships in service in products which readily form dangerous peroxides, recondensed cargo should not be allowed to form stagnant pockets of uninhibited liquid. This may be achieved either by: (a) using the indirect system described in 7.2.4(b) with the condenser inside the cargo tank, or (b) using the direct system or combined system described in 7.2.4(a) and (c) respectively or the indirect system described in 7.2.4(b) with the condenser outside the cargo tank, and designing the condensate system to avoid any places in which liquid could collect and be retained. Where this is impossible inhibited liquid should be added upstream of such a place. If the ship is to carry consecutive cargoes of such products with a ballast passage between, all uninhibited liquid should be removed prior to the ballast voyage. If a second cargo is to be carried between such consecutive cargoes the reliquefaction system should be thoroughly drained and purged before loading the second cargo. Purging should be carried out using either inert gas or vapour from the second cargo, if compatible. Practical steps should be taken to ensure that polymers or peroxides do not accumulate in the ship's system. 17.6 Deck cargo piping One hundred percent radiography of all butt welded joints in cargo piping exceeding 75 mm in diameter is required. 17.7 Bow or stern loading and discharge lines Bow or stern loading and discharging lines should not be led past accommodation, service or control station spaces on Type IG ships. Bow and stern loading and discharging lines installed on Type IIG/IIPG ships should not be used for tile transfer of logic cargoes, unless specifically approved by the Administration. 17.8 Exclusion of air from vapour spaces Air should be removed from the cargo tanks and associated piping before loading and then subsequently excluded by: (a) introducing inert gas to maintain a positive pressure. Storage or production capacity of the inert gas should be sufficient to meet normal operating requirements and relief valve leakage. The oxygen content of inert gas should at no time be greater than 0.2 percent by volume; or (b) control of cargo temperature such that a positive pressure is maintained at all times. 17.9 Moisture control For gases which are non-flammable and may become corrosive or react dangerously with water, moisture control is required to ensure that cargo tanks are dry before loading and that during discharge, dry air or cargo vapour is introduced to prevent negative pressures. For the purposes of this paragraph, dry air is air which has a dewpoint of -45°C or below at atmospheric pressure. 17.10 Inhibition Care should be taken to ensure that the cargo is sufficiently inhibited to prevent polymerization at all limes during the voyage. Ships should be provided with a certificate from the manufacturer slating: (a) name and amount of inhibitor added; (b) date inhibitor was added and the normally expected duration of its effectiveness;
63
Bilaga
(c) any temperature limitations affecting the inhibitor; (d) the action to be taken should the length of the voyage exceed the effective life-time of the inhibitors. .11 Permanently installed toxic gas detectors 17.11.1 Gas sampling lines should not be led into or through gas-safe spaces. Alarms referred to in 13.6.7 should be activated when the vapour concentration reaches the threshold limiting value. 17.11.2 The alternative of using portable equipment in accordance with 13.6.9 should not be permitted. .12 Special requirements for individual gases 17.12.1 Ethylene oxide (a) The cargo piping and vent piping should be completely separate from all other systems. (b) Cargo tank vapour spaces and holed spaces should be inerted with an inert gas meeting the requirements of 17.8(a). (c) The cargo may be discharged only by deepwell pump or inert gas displacement. (d) The cargo should be refrigerated and maintained at less than 30°C. (e) The cargo tank pressure relief valve setting should not be less than 5.5 kp/cm² gauge. (f) A safe jettisoning arrangement should be provided to allow the emergency discharge of the cargo in the event of uncontrollable self-reaction. (g) The following materials of construction should not be used with ethylene oxide: aluminium alloys copper and copper alloys silver and silver alloys magnesium and magnesium alloys types 416 and 442 stainless steel cast iron mercury asbestos. (h) Before ethylene oxide is loaded, tanks should be thoroughly clean, dry, and free of rust. The tank should be purged with inert gas to displace air prior to pumping in the ethylene oxide. 17.12.2 Methyl acetylene-propadiene mixture Only stabilized mixtures containing not more than 50 percent methyl acetylene and not more than percent methyl acetylene and propadiene should be accepted as cargo. Special consideration should be given to the vapour temperature and pressure if direct refrigeration systems are used. 17.12.3 Nitrogen Materials of construction and ancillary equipment such as insulation should be resistant to the effects of high oxygen concentrations caused by condensation and enrichment at the low temperatures attained in parts of the cargo system. Due consideration should be given to ventilation in such areas where condensation might occur to avoid the stratification of oxygen enriched atmosphere. 17.12.4 Ammonia Because high concentrations of ammonia in confined spaces can be flammable, the provisions of Chapter X for flammable products should be applied except in zones on the open deck. Liquid ammonia should never be sprayed into a tank containing air as there is a risk of creating a static electrical charge which could cause ignition. 17.12.5 Chlorine (to be developed) 17.12.6 Vinyl chloride In case polymerization of vinyl chloride is prevented by addition of an inhibitor,17.10 is applicable. In case no
64
Bilaga
or insufficient inhibitor has been added, any inert gas used for the purposes of 17.8 should contain not more oxygen than 0.1 percent. Before loading is started, inert gas samples from the tanks and piping should be analysed. When vinyl chloride is carried, a positive pressure should always be maintained in the tanks, also during ballast voyages between successive carriages. CHAPTER XVIII - OPERATING REQUIREMENTS 18.1 Information required to be carried 18.1.1 Information should be on board and available to all concerned, giving the necessary data for the safe carriage of the cargo. Such information should include for each product carried: (a) a full description of the physical and chemical properties necessary for the safe containment of the cargo; (b) action to be taken in the event of spills or leaks; (c) counter measures against accidental personal contact; (d) fire-fighting procedures and fire-fighting media; (e) procedures for cargo transfer, gas-freeing, ballasting, tank cleaning and changing cargoes; (f) special equipment needed for the safe handling of the particular cargo; (g) minimum inner hull steel temperatures, and (h) emergency procedures. 18.1.2 Products required to be inhibited should be refused if the certificate required by 17.1 is not supplied. 18.2 Compatibility 18.2.1 The master should ascertain that the product to be loaded and its characteristics are included upon and are within the limits indicated on the Certificate of Fitness provided for in 1.6 and the loading and stability booklet provided for in 2.2.3. 18.2.2 Care should be taken to avoid dangerous chemical reactions if cargoes are mixed. This is of particular significance in respect of: (a) tank cleaning procedures required between successive cargoes in the same tank; and (b) simultaneous carriage of cargoes which react when mixed. This should be permitted only if the complete cargo systems including, but not limited to, cargo pipework, tanks, vent systems and refrigeration systems are physically separate. 18.3 Personnel training 18.3.1 Personnel involved in cargo operations should be adequately trained in handling procedures. 18.3.2 All personnel should be adequately trained in the use of protective equipment provided on board and have basic training in the procedures, appropriate to their duties, necessary under emergency conditions. 18.3.3 Officers should be trained in emergency procedures to deal with conditions of leakage, spillage or fire involving the cargo and a sufficient number of them should be instructed and trained in essential first aid for the cargoes carried. 18.4 Entry into spaces 18.4.1 Personnel should not enter cargo tanks, hold spaces, void spaces, cargo handling spaces or other enclosed spaces where gas may accumulate unless: (a) the gas content of the atmosphere in that space is determined by means of fixed or portable equipment to ensure oxygen sufficiency and the absence of toxic atmosphere; or (b) personnel wear breathing apparatus and other necessary protective equipment and the entire operation is under the close supervision of a responsible officer. 18.4.2 Personnel entering any space designated as gas-dangerous on a ship carrying flammable products should not introduce any potential source of ignition into the space unless it has been certified gas-free and is maintained in that condition. 18.5 Carriage of cargo at low temperature 18.5.1 When carrying cargoes at low temperatures:
65
Bilaga
(a) if provided, the heating arrangements associated with cargo containment systems should be operated in such a manner as to avoid the temperature falling below that for which the material of the hull structure is designed;
(b) loading should be carried out in such a manner as to ensure that unsatisfactory temperature gradients do not occur in any cargo tank, piping, or other ancillary equipment; and
(c) when cooling down tanks from temperatures at or near ambient, the cool down procedure laid down for that particular tank, piping and ancillary equipment should be followed closely.
18.6 Protective clothing
Personnel should be made aware of the hazards associated with the cargo being handled and should be instructed to act with care and wear the appropriate protective clothing as mentioned in 14.1 during cargo handling.
18.7 Systems and controls
Cargo emergency shutdown and alarm systems involved in cargo transfer should be tested and/or checked before cargo handling operations begin. Essential cargo handling controls should also be tested and/or checked prior to transfer operations.
18.8 Cargo transfer operations
Transfer operations including emergency procedures should be discussed between ship personnel and the persons responsible at the shore facility prior to commencement and communications maintained throughout the transfer operations.
18.9 Additional operating requirements
Additional operating requirements will be found in the following paragraphs of the Code:
3.8.4, 7.1.1(e), 8.3.5, 8.2.7, 9.4.2, 12.1.1, 12.1.10, 13.1.3, 14.2, 14.6, 14.7, 14.8, 15.1, 15.2, 16.3, 17.7, 17.8, 17.9, 17.12.1(h), 17.12.4.
CHAPTER XIX - SUMMARY OF MINIMUM REQUIREMENTS
e b d c Control of f a United Independent g h Ship vapour space Vapour Product name Nations tank type C Gauging special requirements type within cargo detection number required tanks IIG/ 17.2.2, 17.2.3, 17.5.1, Acetaldehyde 1089 - Inert I + T C IIPG 17.7, 17.8 Ammonia, IIG/ 17.2.1, 17.2.2, 17.2.3, 1005 - - T C anhydrous IIPG 17.3.1, 17.7, 17.12.4 IIG/ 17.3.2, 17.5.2, 17.8, Butadiene 1010 - Inert I + T R IIPG 17.10 IIG/ Butane 1011 - - I R IIPG Butane/propane 1011/ IIG/ - - I R
| mixtures Butylenes Chlorine Dimethylamine | 1978 IIPG IIG/ 1012 - - I R IIPG 17.2, 17.4.2, 17.5.1, 17.6, 17.7, 17.9, 17.11, 1017 IG/ Yes Dry T I (17.12.5 to be developed) IIG/ 17.2.1, 17.2.2, 17.2.3, 1032 - - I + T C IIPG 17.3.1, 17.7 |
| Ethane Ethylamine Ethyl chloride | 1961 IIG - - I R IIG/ 17.2.1, 17.2.2, 17.2.3, 1036 I + T C IIPG 17.3.1, 17.7 IIG/ 1037 - - I + T R 17.7 IIPG |
| Ethylene 66 | 1038 IIG - - I R 17.2.1, 17.2.2, 17.2.3, |
Bilaga
17.2.5, 17.3.2, 17.4., Ethylene oxide 1040 IG Yes Inert I + T C 17.5.1, 17.6, 17.7, 17.8, 17.12.1 methane (LNG) 2043 IIG - - I C Methyl Acetylene- IIG/ propadience 1060 - - I R 17.12.2 IIPG mixture 17.2, 17.3.3, 17.4., Methyl Bromide 1062 IG Yes - I + T C 17.5.1, 17.6, 17.7, 17.11 IIG/ Methyl Choride 1063 - - I + T C 17.3.3, 17.7 IIPG 17.2.1, 17.2.2, 17.2.3, IIG/ 17.3.1, 17.4.1, 17.7, Monoethylamine 1036 - - I + T C IIPG 17.13, 17.14, 17.15, 17.16, 17.17 Nitrogen 2040 IIIG - - O C 17.12.3 IIG/ Propane 1978 - - I R IIPG IIG/ Propylene 1077 - - I R IIPG Refrigerant Gases - IIIG - - - R (see notes) 17.2, 17.4, 17.5.1, 17.6, Sulphur Dioxide 1079 IG Yes Dry T C 17.7, 17.9, 17.11 17.2.1, 17.2.2, 17.3.2, IIG/ Vinyl Chloride 1086 - - I + T C 7.3.3, 17.7, 17.8, IIPG 17.12.6
Explanatory Notes to the Summary of Minimum Requirements Vapour detection required (column f) I - Flammable vapour detection T - Toxic vapour detection O - Oxygen analyser I+T - Flammable and toxic vapour detection Gauging - types permitted (column g) I - Indirect or closed, as described in 13.2.2(a) and (b) C - Indirect or closed, as described in 13.2.2(a), (b) and (c) R - Indirect, closed or restricted, as described in 13.2.2(a), (b), (c) and (d) Refrigerant gases Non-toxic and non-flammable gases such as: dichlorodifluoromethane (1028) dichloromonofluoromethane (1029) dichlorothtrafluoroethane (1958) monochlorodifluoromethane (1018) monochlorotetrafluoroethane (1021) monochlorotrifluoromethane (1022)
APPENDIX
Model Form of Certificate of Fitness for the
Carriage of Liquefied Gases in Bulk
67
Bilaga
CERTIFICATE OF FITNESS FOR THE CARRIAGE OF LIQUEFIED GASES IN BULK
(official Seal)
Issued under the provisions of the
IMCO CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK
Under the authority of the Government of
Bilaga
number** A B C D
Cargo piping ** Tank numbers referred to in this list are identified on the annexed, signed and dated tank plan no moored 2A.
4. That the ship is suitable for the carriage in bulk of the following products, provided that all relevant operational provisions of the Code are observed: 5/ Products Conditions of Carriage (tank numbers, minimum temperature, maximum pressure, maximum density, tank loading conditions)
* Continued on the annexed, signed and dated sheet(s) No. 1A. * Tank numbers referred to in this list are identified on the annexed, signed and dated tank plan numbered 2A. 5. That in accordance with sections 1.5/2.7* the provisions of the Code are modified in respect of the ship in the following manner : * Delete as appropriate.
(place of issue of certificate) The undersigned declared that he is duly authorized by the said Government to issue this certificate.
(signature of official issuing the certificate and/or seal of issuing authority) (seal or stamp of the issuing authority, as appropriate) Notes on completion of certificate: 1/ "Ship Type": Any entry under this column must relate to all relevant recommendations, e.g. an entry "Type IIG" should mean Type IIG in all respects prescribed by the Code. 2/ Paragraph 3(a) and 3(b): The ambient temperatures accepted or required by the Administration for the purposes of 4.8.1 of the Code to be inserted. 3/ Paragraph 3(c): Stress factors and materials as accepted or required by the Administration for the purposes of 4.5.1(d)(i) and 4.5.1(e) of the Code to be inserted. 4/ Paragraph 3(d): Room temperature or other temperature accepted by the Administration for the purposes of 4.5.1 (f) to be inserted. 5/ Paragraph 4: Only products listed in Chapter XIX of the Code, or which have been evaluated by the Administration in accordance with paragraph 1.7.2 of the Code, should be listed. In respect of the latter "new" products, any Special Requirements provisionally prescribed should be noted. Surveys This is to certify that at a survey required by section 1.6 of the Code, this ship was found to comply with the relevant provisions of the Code. Intermediate survey
69
Bilaga
Signature and Seal of issuing authority Signature and Seal of issuing authority Signature and Seal of issuing authority Signature and Seal of issuing authority
_________
70
Bilaga
71
Bilaga
72
Bilaga
73
Bilaga
74
Bilaga
75
Bilaga
76
Bilaga
77
Bilaga
78
Bilaga
79
Bilaga
80
Bilaga
81
Bilaga
82
Bilaga
83
Bilaga
84
Bilaga
85
Bilaga
86
Bilaga
87
Bilaga
88
Bilaga
89
Bilaga
90
Bilaga
91
92
Bilaga
93
Bilaga
94
Bilaga
95
Bilaga
96
Bilaga
97
Bilaga
98
Bilaga
99
Bilaga
100
Bilaga
101
Bilaga
102
Bilaga
103
Bilaga
104
Bilaga
105
Bilaga
106
Bilaga
107
Bilaga
108
Bilaga
109
Bilaga
110
111
112
Bilaga
113
Bilaga
114
Bilaga
115
116
Bilaga
117
118
Bilaga
119
Bilaga
120
Bilaga
121
Bilaga
122
Bilaga
123
Bilaga
124
Bilaga
125
Bilaga
126
Bilaga
127
Bilaga
128
Bilaga
129
Bilaga
130
Bilaga
131
Bilaga
132
Bilaga
133
Bilaga
134
Bilaga
135
Bilaga
136
Bilaga
137
Bilaga
138
Bilaga
139
Bilaga
140
Bilaga
141
142
Bilaga
Title RESOLUTIONs / MSC Resolutions / Res.MSC.25(60) Note Amends Res.A.328(9)
RESOLUTION MSC.25(60)
adopted on 10 April 1992
ADOPTION OF AMENDMENTS TO THE CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK (Harmonized System of Survey and Certification)
THE MARITIME SAFETY COMMITTEE, RECALLING Article 28(b) of the Convention on the International Maritime Organization concerning the functions of the Committee, RECALLING ALSO resolution A.328(9) by which the Committee adopted the Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk (the Gas Carrier Code), NOTING that resolution A.328(9) authorizes the Maritime Safety Committee to amend the Code as may be necessary, NOTING FURTHER that at the International Conference on the Harmonized System of Survey and Certification,, 1988, a Protocol was adopted to amend the International Convention for the Safety of Life at Sea, 1974 for the purpose of introducing the harmonized system of survey and certification into the Convention, ALSO NOTING that by resolution MSC.17(58) the Committee adopted amendments to the International Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk (the IGC Code) to also introduce the harmonized system of survey and certification into the IGC Code, HAVING CONSIDERED at its sixtieth session amendments to the Gas Carrier Code, ADOPTS amendments to the Gas Carrier Code, the text of which is set out in the Annex to the Present resolution, DETERMINES that the amendments shall become effective on the same day as the amendments to the IGC Coe adopted by the Maritime Safety Committee by resolution MSC.17(58), AGREES that surveys in accordance with the Gas Carrier Code should follow such surveys under the IGC code in the HSSC Survey Guidelines to be adopted in due course, AGREES FURTHER that Governments that implement the harmonized system of survey and certification in accordance with the provisions of resolution A.718(17) should also implement the harmonized system of survey and certification in respect of the Gas Carrier Code. In such cases, on the "IMO CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK" delete "as amended by resolution MSC.25(60)" and add "and resolution A.718(17) relating to the early implementation of the harmonized system of survey and certification", REQUESTS that the Secretary-General inform all Members of the Organization of the resolution and its annex and to inform them when the amendments will become effective.
ANNEX
AMENDMENTS TO THE CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK
1.4 Definitions New definition should be added as follows:
143
Bilaga
"1.4.38 "Anniversary date" means the day and the month of each year which will correspond to the date of expiry of the International Certificate of Fitness for the Carriage of Liquefied Gases in Bulk".
.6 Surveys and certification
The existing text of section 1.6 should be replaced by the following:
"1.6.1 Survey procedure
1.6.1.1 The survey of ships, so far as regards the enforcement of the provisions of the regulations and granting of exemptions therefrom, should be carried out by officers of the Administration. The Administration may, however, entrust the surveys either to surveyors nominated for the purpose or to organizations recognized by it.
1.6.1.2 The Administration nominating surveyors or recognizing organizations to conduct survey should, as a minimum , empower any nominated surveyor or recognized organization to:
.1 require repairs to a ship; and
.2 carry out surveys if requested by the appropriate authorities of a port State.
The Administration should notify the Organization of the specific responsibilities and conditions of the authority delegated to nominated surveyors or recognized organizations for circulation to the Contracting Governments.
1.6.1.3 When a nominated surveyor or recognized organization determines that the condition of the ship or its equipment does not correspond substantially with the particulars of the Certificate of Fitness for the Carriage of Liquefied Gases in Bulk or is such that the ship is not fit to proceed to sea without danger to the ship, or persons on board, or without presenting unreasonable threat of harm to the marine environment, such surveyor or organization should immediately ensure that corrective action is taken and should in due course, notify the Administration. If such corrective action is not taken, the Certificate should be withdrawn and the Administration should be notified immediately; and, if the ship is in a port of another Contracting Government, the appropriate authorities of the port State should also be notified immediately. When an officer of the Administration, a nominated surveyor or a recognized organization has notified the appropriate authorities of the port State, the Government of the port State concerned should give such obligations under this paragraph. When applicable, the Government of the port State concerned should take such steps as will ensure that the ship does not sail until it can proceed to sea or leave the port for the purpose of proceeding to the nearest appropriate repair yard available without danger to the ship or persons on board or without presenting an unreasonable threat of harm to the marine environment.
1.6.1.4 In every case, the Administration should guarantee the completeness and efficiency of the survey, and should undertake to ensure the necessary arrangements to satisfy this obligation.
1.6.2 Survey requirements
1.6.2.1 The structure, equipment, fittings, arrangements and material (other than items in respect of which a Cargo Ship Safety Construction Certificate, Cargo Ship Safety Equipment Certificate and Cargo Ship Safety Radio Certificate of Cargo Ship Safety Certificate are issued) of a gas carrier should be subjected to the following surveys:
.1 an initial survey before the ship is put in service or before the Certificate of Fitness for the Carriage of Liquefied Gases in Bulk is issued for the first time, which should include a complete examination of its structure, equipment, fittings, arrangements and material in so far as the ship is covered by the Code. This survey should be such as to ensure that the structure, equipment, fittings, arrangements and material fully comply with the applicable provisions of the Code;
.2 a renewal survey at intervals specified by the Administration, but not exceeding 5 years, except where regulation 1.6.6.2.2, 1.6.6.5, 1.6.6.6 or 1.6.6.7 is applicable. The renewal survey should be such as to ensure that the structure, equipment, fittings, arrangements and material fully comply with the applicable provisions of the Code;
144
Bilaga
.3 an intermediate survey within 3 months before or after the second anniversary date or within 3 months before or after the third anniversary date of the Certificate which should take the place of one of the annual surveys specified in 1.6.2.1.4. The intermediate survey should be such as to ensure that the safety equipment, and other equipment, and associated pump and piping systems fully comply with the applicable provisions of the Code and are in good working Certificate issued under 1.6.4 or 1.6.5;
.4 an annual survey within 3 months before or after each anniversary date of the Certificate, including a general inspection of the structure, equipment, fittings, arrangements and material referred accordance with 1.6.3 and that they remain satisfactory for the service for which the ship is intended. Such annual surveys should be endorsed on the Certificate issued under 1.6.4 or 1.6.5;
.5 an additional survey, either general or partial according to the circumstances, should be made when required after an investigation prescribed in 1.6.3.3, or whenever any important repairs or renewals are made. Such a survey should ensure that the necessary repairs or renewals have been effectively made, that the material and workmanship of such repairs of renewals are satisfactory, and that the ship is fit to proceed to sea without danger to the ship or persons on board or without presenting unreasonable threat of harm to the marine environment.
1.6.3 Maintenance of conditions after survey
1.6.3.1 The condition of the ship and its equipment should be maintained to conform with the provisions of the Code to ensure that the ship will remain fit to proceed to sea without danger to the ship or persons on board or without presenting unreasonable threat of harm to the marine environment.
1.6.3.2 After any survey of the ship under 1.6.2 has been completed, no change should be made in the structure, equipment, fittings, arrangements and material covered by the survey, without the sanction of the Administration, except by direct replacement.
1.6.3.3 Whenever an accident occurs to a ship or a defect is discovered, either of which affects the safety of the ship or the efficiency or completeness of its life-saving appliances or other equipment covered by the Code, the master or owner of the ship should report at the earliest opportunity to the Administration, the nominated surveyor or recognized organization responsible for issuing the Certificate, who should cause investigations to be initiated to determine whether a survey, as required by 1.6.2.1.5, is necessary. If the ship is in a port of another Contracting Government, the master or owner should also report immediately to the appropriate authorities of the port State and the nominated surveyor or recognized organization should ascertain that such a report has been made.
1.6.4 Issue and endorsement of Certificate of Fitness
1.6.4.1 A Certificate called a Certificate of Fitness for the Carriage of Liquefied Gases in Bulk, should be issued after an initial or renewal survey to a gas carrier engaged in international voyages which complies with the relevant provisions of the Code.
1.6.4.2 A Certificate of Fitness for the Carriage of Liquefied Gases in Bulk should be drawn up in the form corresponding to the model given in the Appendix. If the language used is neither English nor French, the text should include the translation into one of these languages.
1.6.4.3 The Certificate issued under provisions of this section should be available on board for examination at all times.
1.6.4.4 Notwithstanding any other provisions of the amendments to this Code, adopted by the Maritime Safety Committee (MSC) by resolution MSC.25(60), any Certificate of Fitness for the Carriage of Liquefied Gases in Bulk, which is current when these amendments enter into force, should remain valid until it expires under the terms of this Code prior to the amendments entering into force.
1.6.5 Issue or endorsement of Certificate of Fitness by another Government
1.6.5.1 A Contracting Government to the 1974 SOLAS Convention may, at the request of another
145
Bilaga
Contracting Government, cause a ship entitled to fly the flag of the other State to be surveyed and, if satisfied that the requirements of the code are complied with, issue or authorize the issue of the Certificate of Fitness for the Carriage of Liquefied Gases in Bulk to the ship, and where appropriate, endorse or authorize the endorsement of the Certificate on board the ship in accordance to the effect that it has been issued at the request of the Government of the State whose flag the ship is entitles to fly.
1.6.6 Duration and validity of Certificate of Fitness
1.6.6.1 A Certificate of Fitness for the Carriage of Liquefied Gases in Bulk should be issued for a period specified by the Administration which should not exceed 5 years.
1.6.6.2.1 Notwithstanding the provisions of 1.6.6.1 of this regulation, when the renewal survey is completed within 3 months before the expiry date of the existing Certificate, the new Certificate should be valid from the date of completion of the renewal survey to a date not exceeding 5 years from the date of expiry of the existing Certificate.
1.6.6.2.2 When the renewal survey is completed more than 3 months before the expiry date of the existing Certificate, the new Certificate should be valid from the date of completion of the renewal survey to a date not exceeding 5 years from the date of expiry of the existing Certificate.
1.6.6.2.3 When the renewal survey is completed after the expiry date of the existing Certificate, the new Certificate should be valid from the date of completion of the renewal survey to a date not exceeding 5 years from the date of completion of the renewal survey.
1.6.6.3 If a Certificate is issued for a period of less than 5 years, the Administration may extend the validity of the Certificate beyond the expiry date to the maximum period specified in 1.6.6.1, provided that the surveys referred to in regulation 1.6.2.1.3 and 1.6.2.1.4, applicable when a Certificate is issued for a period of 5 years, are carried out as appropriate.
1.6.6.4 If a renewal survey has been completed and a new Certificate cannot be issued or placed on board the ship before the expiry date of the existing Certificate, the person or organization authorized by the Administration may endorse the existing Certificate and such a Certificate should be accepted as valid for a further period which should not exceed 5 months from the expiry date.
1.6.6.5 If a ship, at the time when a Certificate expires, is not in a port in which it is to be surveyed, the Administration may extend the period of validity of the Certificate but this extension should be granted only for the purpose of allowing the ship to complete its voyage to the port in which it is to be surveyed, and then only in cases where it appears proper and reasonable to do so. No Certificate should be extended for period longer than 3 months, and a ship to which an extension is granted should not, on its arrival in the port in which it is to be surveyed, be entitled by virtue of such extension to leave that port without having a new Certificate. When the renewal survey is completed, the new Certificate should be valid to a date not exceeding 5 year from the date of expiry of the existing Certificate before the extension was granted.
1.6.6.6 A Certificate issued to a ship engaged on short on voyages, which has not been extended under the foregoing provisions of this section, may be extended by the Administration for a period of grace of up to one month from the date of expiry stated on it. When the renewal survey is completed, the new Certificate should be valid to a date not exceeding 5 years from the date of expiry of the existing Certificate before the extension was granted.
1.6.6.7 In special circumstances, as determined by the Administration, a new Certificate need not be dated from the date of expiry of the existing Certificate as required by 1.6.6.2.2, 1.6.6.5 or 1.6.6.6. In these special circumstances, the new Certificate should be valid to a date not exceeding 5 years from the date of completions of the renewal survey.
1.6.6.8 If an annual or intermediate survey is completed before the period specified in 1.6.2, then:
.1 the anniversary date shown on the Certificate should be amended by endorsement to a date which should not be more than 3 months later than the date on which the survey was completed;
.2 the subsequent annual or intermediate survey required by 1.6.2 should be completed at the
146
Bilaga
intervals prescribed by that section using the new anniversary date; .3 the expiry date may remain unchanged provided one or more annual or intermediate surveys, as appropriate, are carried out so that the maximum intervals between the surveys prescribed by 1.6.2 are not exceeded. 1.6.6.9 A Certificate issued under 1.6.4 or 1.6.5 should cease to be valid in any of the following cases: .1 if the relevant surveys are not completed within the periods specified under 1.6.2; .2 if the Certificate is not endorsed in accordance with 1.6.2.1.3 or 1.6.2.1.4; .3 upon transfer of the ship to the flag of another State. A new Certificate should only be issued when the Government issuing the new Certificate is fully satisfied that the ship is in compliance with the provisions of 1.6.3.1 and 1.6.3.2. In the case of a transfer between Contracting Governments, if requested within 3 months after the transfer has taken place, the Government of the State whose flag the ship was formerly entitled to fly should, as soon as possible, transmit to the Administration copies of the Certificate carried by the ship before the transfer and, if available, copies of the relevant survey reports."
APPENDIX
MODEL FORM OF CERTIFICATE OF FITNESS FOR
THE CARRIAGE OF LIQUEFIED GASES IN BULK
The existing Model Form of Certificate should be replaced by the following : &(57,),&$7(2)),71(66)257+( &$55,$*(2)/,48(),('*$6(6,1%8/. 2IILFLDOVHDO ,VVXHGXQGHUWKHSURYLVLRQVRIWKH ,02&2'()257+(&216758&7,21$1'(48,30(17 2)6+,36&$55<,1*/,48(),('*$6(6,1%8/. UHVROXWLRQ$,;DVDPHQGHGE\UHVROXWLRQ06& XQGHUWKHDXWKRULW\RIWKH*RYHUQPHQWRI IXOOGHVLJQDWLRQRIFRXQWU\ E\ IXOOGHVLJQDWLRQRIWKHFRPSHWHQWSHUVRQRURUJDQL]DWLRQ DXWKRUL]HGXQGHUWKHSURYLVLRQVRIWKH&RGH 3DUWLFXODUVRIVKLS 1DPHRIVKLS 'LVWLQFWLYHQXPEHURUOHWWHUV 3RUWRIUHJLVWU\ &DUJRFDSDFLW\P 6KLSW\SH&RGHSDUDJUDSK
147
Bilaga
,021XPEHU 'DWHRQZKLFKNHHOZDVODLGRUVKLSZDVDWD VLPLODUVWDJHRIFRQVWUXFWLRQRULQWKHFDVHRID FRQYHUWHGVKLSGDWHRQZKLFKFRQYHUVLRQWRDJDV FDUULHUZDVFRPPHQFHG
7KHVKLSDOVRFRPSOLHVIXOO\ZLWKWKHIROORZLQJDPHQGPHQWVWRWKH&RGH
7KHVKLSLVH[HPSWHGIURPFRPSOLDQFHVZLWKWKHIROORZLQJSURYLVLRQVRIWKH&RGH
7+,6,672&(5,7)< 7KDWWKHDERYHPHQWLRQHGVKLSLV DVKLSDVGHILQHGLQRIWKH&RGH DVKLSDVGHILQHGLQRIWKH&RGH 7KDWWKHVKLSKDVEHHQVXUYH\HGLQDFFRUGDQFHZLWKWKHSURYLVLRQVRIVHFWLRQRIWKH&RGH WKDWWKHVXUYH\VKRZHGWKDWWKHVWUXFWXUHHTXLSPHQWILWWLQJVDUUDQJHPHQWVDQGPDWHULDOVRIWKHVKLSDQGWKH
FRQGLWLRQVWKHUHRIDUHLQDOOUHVSHFWVVDWLVIDFWRU\DQGWKDWWKHVKLSFRPSOLHVZLWKWKHUHOHYDQWSURYLVLRQVRIWKH FRGH
7KDWWKHIROORZLQJGHVLQJFULWHULDKDYHEHHQXVHG DPELHQWDLUWHPSHUDWXUHႏ DPELHQWZDWHUWHPSHUDWXUHႏ
7DQNW\SH 6WUHVVIDFWRUV 0DWHULDOV 0$596 DQGQXPEHU $ % & ' &DUJRSLSLQJ 1%7DQNQXPEHUVUHIHUUHGWRLQWKLVOLVWDUHLGHQWLILHGRQDWWDFKPHQWVLJQHGDQGGDWHGWDQNSODQ 0HFKDQLFDOSURSHUWLHVRIWKHFDUJRWDQNPDWHULDOZHUHGHWHUPLQHGDWႏ
7KDWWKHVKLSLVVXLWDEOHIRUWKHFDUULDJHLQEXONRIWKHIROORZLQJSURGXFWVSURYLGHGWKDWDOOUHOHYDQWRSHUDWLRQDO SURYLVLRQVRIWKH&RGHDUHREVHUYHG &RQGLWLRQVRIFDUULDJH
148
Bilaga
3URGXFWV WDQNQXPEHUVHWF
&RQWLQXHGRQDWWDFKPHQWDGGLWLRQDOVLJQHGDQGGDWHGVKHHWV 7DQNQXPEHUVUHIHUUHGWRLQWKLVOLVWDUHLGHQWLILHGRQDWWDFKPHQWVLJQHG DQGGDWHGWDQNSODQ 7KDWLQDFFRUGDQFHZLWK WKHSURYLVLRQVRIWKH&RGHDUHPRGLILHGLQUHVSHFWRIWKHVKLSLQWKHIROORZLQJ PDQQHU 7KDWWKHVKLSPXVWEHORDGHG LQDFFRUGDQFHZLWKWKHORDGLQJFRQGLWLRQVSURYLGHGLQWKHDSSURYHGORDGLQJPDQXDOVWDPSHGDQG GDWHGDQGVLJQHGE\DUHVSRQVLEOHRIILFHURIWKH$GPLQLVWUDWLRQRURIDQRUJDQL]DWLRQUHFRJQL]HGE\ WKH$GPLQLVWUDWLRQ LQDFFRUGDQFHZLWKWKHORDGLQJOLPLWDWLRQVDSSHQGHGWRWKLV&HUWLILFDWH :KHUHWLLVUHTXLUHGWRORDGWKHVKLSRWKHUWKDQLQDFFRUGDQFHZLWKWKHDERYHLQVWUXFWLRQWKHQWKHQHFHVVDU\FDOFXODWLRQV WRMXVWL\WKHSURSRVHGORDGLQJFRQGLWLRQVVKRXOGEHFRPPXQLFDWHGWRWKHFHUWLI\LQJ$GPLQLVWUDWLRQZKRPD\DXWKRUL]HLQ ZULWLQJWKHDGRSWLRQRIWKHSURSRVHGORDGLQJFRQGLWLRQV
7KLVFHUWLILFDWHLVYDOLGXQWLO 6XEMHFWWRVXUYH\VLQDFFRUGDQFHZLWKRIWKH&RGH ,VVXHGDW SODFHRILVVXHRI&HUWLILFDWH
6LJQDWXUHRIGXO\DXWKRUL]HGRIILFLDO 'DWHRILVVXH LVVXLQJWKH&HUWLILFDWH 6HDORUVWDPSRIWKHDXWKRULW\DVDSSURSULDWH BBBBBBBBBB 1RWHVRQFRPSOHWLRQRI&HUWLILFDWH
6KLSW\SHDQ\HQWU\XQGHUWKLVOLQHPXVWEHUHODWHGWRDOOUHOHYDQWUHFRPPHQGDWLRQVHJDQHQWU\7\SH,,*VKRXOG PHDQW\SH,,*LQDOOUHVSHFWVSUHVFULEHGE\WKH&RGH 3DUDJUDSKVDQGWKHDPELHQWWHPSHUDWXUHVDFFHSWHGRUUHTXLUHGE\WKH$GPLQLVWUDWLRQIRUWKHSXUSRVHVRI RIWKH&RGHWREHLQVHUWHG 3DUDJUDSKVWUHVVIDFWRUVDQGPDWHULDOVDVDFFHSWHGRUUHTXLUHGE\WKH$GPLQLVWUDWLRQIRUWKHSXUSRVHVRIG
149
Bilaga
LDQGHRIWKH&RGHWREHLQVHUWHG
3DUDJUDSKWHPSHUDWXUHDFFHSWHGE\WKH$GPLQLVWUDWLRQIRUWKHSXUSRVHVRIIWREHLQVHUWHG
3DUDJUDSKRQO\SURGXFWVOLVWHGLQFKDSWHU;,;RIWKH&RGHRUZKLFKKDYHEHHQHYDOXDWHGE\WKH$GPLQLVWUDWLRQLQ DFFRUGDQFHZLWKSDUDJUDSKRIWKH&RGHRUWKHLUFRPSDWLEOHPL[WXUHVKDYLQJSK\VLFDOSURSHUWLHVZLWKLQWKH OLPLWDWLRQVRIWDQNGHVLJQVKRXOGEHOLVWHG,QUHVSHFWRIWKHODWWHUQHZSURGXFWVRQO\VSHFLDOUHTXLUHPHQWVSURYLVLRQDOO\ SUHVFULEHGVKRXOGEHQRWHG
(1'2560(17)25$118$/$1',17(50',$7(6859(<6
7+,6,672&(57,)<WKDWDWDVXUYH\UHTXLUHGE\RIWKH&RGHWKHVKLSZDVIRXQGWRFRPSO\ZLWKWKHUHOHYDQW SURYLVLRQVRIWKH&RGH
6LJQHG $QQXDOVXUYH\ 6LJQDWXUHRIDXWKRUL]HGRIILFLDO 3ODFH 'DWH
6HDORUVWDPSRIWKHDXWKRULW\DVDSSURSULDWH
6LJQHG $QQXDO,QWHUPHGLDWH VXUYH\ 6LJQDWXUHRIDXWKRUL]HGRIILFLDO 3ODFH 'DWH
6HDORUVWDPSRIWKHDXWKRULW\DVDSSURSULDWH
6LJQHG $QQXDO,QWHUPHGLDWH VXUYH\ 6LJQDWXUHRIDXWKRUL]HGRIILFLDO 3ODFH 'DWH
6LJQHG $QQXDOVXUYH\ 6LJQDWXUHRIDXWKRUL]HGRIILFLDO 3ODFH 'DWH
6HDORUVWDPSRIWKHDXWKRULW\DVDSSURSULDWH
$QQXDOLQWHUPHGLDWHVXUYH\LQDFFRUGDQFHZLWK
7+,6,672&(57,)<WKDWDWDQDQQXDOLQWHUPHGLDWH VXUYH\LQDFFRUGDQFHZLWKRIWKH&RGHWKHVKLS ZDVIRXQGWRFRPSO\ZLWKWKHUHOHYDQWSURYLVLRQVRIWKH&RGH
6LJQHG 6LJQDWXUHRIDXWKRUL]HGRIILFLDO 3ODFH 'DWH
150
Bilaga
6HDORUVWDPSRIWKHDXWKRULW\DVDSSURSULDWH
(QGRUVHPHQWWRH[WHQGWKH&HUWLILFDWHLIYDOLGIRUOHVVWKDQ\HDUVZKHUHDSSOLHV
7KHVKLSFRPSOLHVZLWKWKHUHOHYDQWSURYLVLRQVRIWKH&RGHDQGWKLV&HUWLILFDWHVKRXOGLQDFFRUGDQFHZLWK RIWKH&RGHEHDFFHSWHGDVYDOLGXQWLO
6LJQHG 6LJQDWXUHRIDXWKRUL]HGRIILFLDO 3ODFH 'DWH
6HDORUVWDPSRIWKHDXWKRULW\DVDSSURSULDWH
(QGRUVHPHQWZKHUHWKHUHQHZDOVXUYH\KDVEHHQFRPSOHWHGDQGDSSOLHV
7KHVKLSFRPSOLHVZLWKWKHUHOHYDQWSURYLVLRQVRIWKH&RGHDQGWKLV&HUWLILFDWHVKRXOGLQDFFRUGDQFHZLWK RIWKH&RGHEHDFFHSWHGDVYDOLGXQWLO
6LJQHG 6LJQDWXUHRIDXWKRUL]HGRIILFLDO 3ODFH 'DWH
6HDORUVWDPSRIWKHDXWKRULW\DVDSSURSULDWH
(QGRUVHPHQWWRH[WHQGWKHYDOLGLW\RIWKH&HUWLILFDWHXQWLOUHDFKLQJWKHSRUWRIVXUYH\RUIRUDSHULRGRIJUDFH ZKHUHRUDSSOLHV
7KLV&HUWLILFDWHVKRXOGLQDFFRUGDQFHZLWKRU RIWKH&RGHEHDFFHSWHGDVYDOLG XQWLO
6LJQHG 6LJQDWXUHRIDXWKRUL]HGRIILFLDO 3ODFH 'DWH
6HDORUVWDPSRIWKHDXWKRULW\DVDSSURSULDWH
(QGRUVHPHQWIRUDGYDQFHPHQWRIDQQLYHUVDU\GDWHZKHUHDSSOLHV
,QDFFRUGDQFHZLWKRIWKH&RGHWKHQHZDQQLYHUVDU\GDWHLV
6LJQHG 6LJQDWXUHRIDXWKRUL]HGRIILFLDO 3ODFH 'DWH
6HDORUVWDPSRIWKHDXWKRULW\DVDSSURSULDWH
,QDFFRUGDQFHZLWKRIWKH&RGHWKHQHZDQQLYHUVDU\GDWHLV
6LJQHG 6LJQDWXUHRIDXWKRUL]HGRIILFLDO 3ODFH
151
Bilaga
'DWH 6HDORUVWDPSRIWKHDXWKRULW\DVDSSURSULDWH BBBBBBBBBB $OWHUQDWLYHO\WKHSDUWLFXODUVRIWKHVKLSPD\EHSODFHGKRUL]RQWDOO\LQER[HV ,QDFFRUGDQFHZLWKUHVROXWLRQ$ ,026KLS,GHQWLILFDWLRQ1XPEHU6FKHPHWKLVLQIRUPDWLRQPD\EHLQFOXGHG YROXQWDULO\ 'HOHWHDVDSSURSULDWH ,QVWHDGRIEHLQJLQFRUSRUDWHGLQWKH&HUWLILFDWHWKLVWH[WPD\EHDSSHQGHGWRWKH&HUWLILFDWHLIGXO\VLJQHGDQG VWDPSHG 7KHGDWHRIH[SLU\DVVSHFLILHGE\WKH$GPLQLVWUDWLRQLQDFFRUGDQFHZLWKRIWKH&RGH7KHGD\DQGWKHPRQWK RIWKLVGDWHFRUUHVSRQGWRWKHDQQLYHUVDU\GDWHDVGHILQHGLQRIWKH&RGHXQOHVVDPHQGHGLQDFFRUGDQFHZLWK RIWKH&RGH
ATTACHMENT 1 TO THE CERTIFICATE OF FITNESS FOR THE CARRIAGE OF LIQUEFIED GASES IN BULK
&RQWLQXHGOLVWRISURGXFWVWRWKRVHVSHFLILHGLQVHFWLRQDQGWKHFRQGLWLRQVRIWKHLUFDUULDJH &RQGLWLRQVRIFDUULDJH 3URGXFWV WDQNQXPEHUVHWF
'DWH DVIRU&HUWLILFDWH 6LJQDWXUHRIRIILFLDOLVVXLQJWKH&HUWLILFDWHDQGRUVHDORUVWDPSRILVVXLQJDXWKRULW\
ATTACHMENT 2 TO THE CERTIFICATE OF FITNESS FOR THE CARRIAGE OF LIQUEFIED GASES IN BULK
7$1.3/$16SHFLPHQ 1DPHRIVKLS 'LVWLQFWLYHQXPEHURUOHWWHUV
152
Bilaga
'DWH DVIRU&HUWLILFDWH 6LJQDWXUHRIRIILFLDOLVVXLQJWKH&HUWLILFDWHDQGRUVHDORILVVXLQJDXWKRULW\
***
__________
153
154
Bilaga
Title RESOLUTIONs / MSC Resolutions / Res.MSC.34(63) Note Amends Res.A.328(9)
RESOLUTION MSC.34 (63)
adopted on 23 May 1994
ADOPTION OF AMENDMENTS TO THE CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK
THE MARITIME SAFETY COMMITTEE, RECALLING Article 28(b) of the Convention on the International Maritime Organization concerning the functions of the Committee, RECALLING ALSO resolution A.328(9), by which the Assembly, at its ninth session, adopted the Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk (Gas Carrier Code) and authorized the Committee to amend the Code as may be necessary, NOTING resolution MSC.32(63), by which the Committee adopted amendments to the International Code for the Construction and equipment of Ships Carrying Liquefied Gases in Bulk (IGC Code), RECOGNIZING the need to bring the corresponding amendments to the Gas Carrier Code into force on the date on which the amendments to the IGC Code enter into force, HAVING CONSIDERED at its sixty-third session amendments to the Gas Carrier Code proposed by the Sub-Committee on Bulk Chemicals, 1. ADOPTS amendments to the Gas Carrier Code, the text of which is given in the Annex to the present resolution; 2. DETERMINES that the amendments should become effective on 1 July 1998 upon acceptance and entry into force of the corresponding amendments to the IGC Code adopted by resolution MSC.32(63).
ANNEX
AMENDMENTS TO THE CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK
1 Existing chapter XV is replaced by the following:
"CHAPTER XV FILLING LIMITS FOR CARGO TANKS
15.1 General 15.1.1 No cargo tanks should have a higher filling limit (FL) than 98% at the reference temperature, except as permitted by 15.1.3. 15.1.2 The maximum loading limit (LL) to which a cargo tank may be loaded should be determined by the following formula :
155
Bilaga
LL = FL where : LL = loading limit expressed in percent which means the maximum allowable liquid volume relative to the tank volume to which the tank may be loaded; FL = filling limit as specified in 15.1.1 or 15.1.3; = relative density of cargo at the reference temperature; and = relative density of cargo at the loading temperature and pressure. 15.1 3 The Administration may allow a greater filling limit (FL) than 98% specified in 15.1.1at the reference temperature, taking into account the shape of the tank, arrangements of pressure relief valves, accuracy of level and temperature gauging and the difference between the loading temperature and the temperature corresponding to the vapour pressure of the cargo at the set pressure of the pressure relief valves, provided the conditions of 8.2.17 are maintained. 15.1.4 For the purpose of this chapter only, "reference temperature" means : (a) The temperature corresponding to the vapour pressure of the cargo at the set pressure of the pressure relief valves when no cargo vapour pressure/temperature control as referred to in Chapter VII is provided. (b) The temperature of the cargo upon termination of loading, during transport, or at unloading, whichever is the greater, when a cargo vapour pressure/temperature control as referred to in Chapter VII is provided. If this reference temperature would result in the cargo tank becoming liquid full before the cargo reaches a temperature corresponding to the vapour pressure of the cargo at the set pressure of the relief valves required in 8.2, an additional pressure relief system complying wilts 8.3 should be fitted. 15.1.5 The Administration may allow type C tanks to be loaded according to the following formula provided that the tank vent system has been approved in accordance with 8.2.18: LL = where : LL = loading limit as specified in 15.1.2; FL = filling limit as specified in 15.1.1 or 15.1.3; = relative density of cargo at the reference temperature which the cargo may reach upon termination of loading, during transport, or at unloading, under the ambient design temperature conditions described in 7.1.2; and = as specified in 15.1.2. his paragraph does not apply to products requiring a type 1G ship. 5.2 Information to be provided to the master The maximum allowable tank filling limits for each cargo tank should be indicated for each product which may be carried, for each loading temperature which may be applied and for
156
Bilaga
the applicable maximum reference temperature, on a list to be approved by the Administration. Pressures at which the pressure relief valves, including those valves required by 8.3, have been set should also be stated on the list. A copy of the list should be permanently kept on board by the master . 15.3 Chapter XV applies to all ships regardless of the date of construction." 2 The following words are added at the end of existing paragraph 8.2.17: "at the maximum allowable filling limit (FL)". 3 The following new paragraphs 8.2.18 and 8.2.19 are added after existing paragraph 8.2.17: "8.2.18 The adequacy of the vent system fitted on tanks loaded in accordance with 15.1.5 is to be demonstrated using the guidelines developed by the Organization*. A relevant certificate should be permanently kept on board the ship. For the purposes of this paragraph, vent system means : (a) the tank outlet and the piping to the pressure relief valve; (b) the pressure relief valve; (c) the piping from the pressure relief valve to the location of discharge to the atmosphere and including any interconnections and piping which joins other tanks. 8.2.19 Paragraph 8.2.17 and 8.2.18 apply, where applicable, to all ships regardless of the date of construction. * Refer to the guidelines to be developed by the Organization.
***
__________
157
158
Bilaga
Title RESOLUTIONs / MSC Resolutions / Res.MSC.60(67) Note Amends Res.A.328(9)
RESOLUTION MSC.60(67)
(adopted on 5 December 1996)
ADOPTION OF AMENDMENTS TO THE CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK (GC CODE)
THE MARITIME SAFETY COMMITTEE, RECALLING Article 28(b) of the Convention on the International Maritime Organization concerning the functions of the Committee, RECALLING ALSO resolution A.328(9), by which the Assembly, at its ninth session, adopted the Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk (Gas Carrier Code) and authorized the Committee to amend the Code as may be necessary, NOTING resolution MSC.59(67), by which the Committee adopted amendments to the International Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk (IGC Code), RECOGNIZING the need to bring the corresponding amendments to the Gas Carrier Code into force on the date on which the amendments to the IGC Code enter into force, HAVING CONSIDERED, at its sixty-seventh session, amendments to the Gas Carrier Code proposed by the Sub-Committee on Bulk Liquids and Gases and approved by the Committee at its sixty-sixth session, 1. ADOPTS amendments to the Gas Carrier Code the text of which is set out in the Annex to the present resolution; 2. DETERMINES that the amendments should become effective on 1 July 1998 upon acceptance and entry into force of the corresponding amendments to the IGC Code adopted by resolution MSC.59(67).
ANNEX
AMENDMENTS TO THE CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK (GC CODE)
CHAPTER XIX - SUMMARY OF MINIMUM REQUIREMENTS
In column "f" of the table, the entry "I" for the product "Butadiene", is replaced by "I+T".
***
__________
159
160
Bilaga
Title RESOLUTIONs / MSC Resolutions / Res.MSC.107(73) Note Amends Res.A.328(9)
RESOLUTION MSC.107(73)
(adopted on 5 December 2000)
ADOPTION OF AMENDMENTS TO THE CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK (GC CODE)
THE MARITIME SAFETY COMMITTEE, RECALLING Article 28(b) of the Convention on the International Maritime Organization concerning the functions of the Committee, RECALLING ALSO resolution A.328(9), by which the Assembly, at its ninth session, adopted the Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk (GC Code) and authorized the Committee to amend the GC Code as may be necessary, NOTING resolution MSC.103(73), by which it adopted amendments to the International Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk (IGC Code), HAVING CONSIDERED, at its seventy-third session, amendments to the GC Code proposed by the Sub-Committee on Bulk Liquids and Gases at its fourth session and approved by the Committee at its seventy-second session, RECOGNIZING the need to bring the approved amendments to the GC Code into force on the date on which the corresponding amendments to the IGC Code enter into force, 1. ADOPTS amendments to the GC Code, the text of which is set out in the Annex to the present resolution; 2. DETERMINES that the said amendments should become effective on 1 July 2002 upon acceptance and entry into force of the corresponding amendments to the IGC Code adopted by resolution MSC.103(73).
ANNEX
AMENDMENTS TO THE CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK (GC CODE)
CHAPTER V
PROCESS PRESSURE VESSELS AND LIQUID, VAPOUR AND PRESSURE PIPING SYSTEMS
5.4 Ship's cargo hoses 1 The existing paragraph 5.4.3 is replaced by the following: "5.4.3 For cargo hoses installed on board ships on or after 1 July 2002, each new type of cargo hose, complete with end-fittings, should be prototype-tested at a normal ambient
161
Bilaga
temperature with 200 pressure cycles from zero to at least twice the specified maximum working pressure. After this cycle pressure test has been carried out, the prototype test should demonstrate a bursting pressure of at least 5 times its specified maximum working pressure at the extreme service temperature. Hoses used for prototype testing should not be used for cargo service. Thereafter, before being placed in service, each new length of cargo hose produced should be hydrostatically tested at ambient temperature to a pressure not less than 1.5 times its specified maximum working pressure, but not more than two-fifths of its bursting pressure. The hose should be stencilled or otherwise marked with the date of testing, its specified maximum working pressure and, if used in services other than the ambient temperature services, its maximum and minimum service temperature, as applicable. The specified maximum working pressure should not be less than 10 bar gauge."
CHAPTER XIV
PERSONNEL PROTECTION
2 The existing paragraph 14.9 is replaced by the following:
"14.9 The ship should have on board medical first-aid equipment, including oxygen resuscitation equipment and antidotes for cargoes to be carried, based on the guidelines developed by the Organization*.
* Reference is made to the Medical First Aid Guide for Use in Accidents Involving Dangerous Goods (MFAG), which provides advice on the treatment of casualties in accordance with the symptoms exhibited as well as equipment and antidotes that may be appropriate for treating the casualty."
Chapter XVIII
Operating requirements
3 The existing paragraph 18.3.3 is replaced by the following:
"18.3.3 Officers should be trained in emergency procedures to deal with conditions of leakage, spillage or fire involving the cargo, based on the guidelines developed by the Organization*, and a sufficient number of them should be instructed and trained in essential first aid for cargoes carried.
* Refer to the Medical First Aid Guide for Use in Accidents Involving Dangerous Goods (MFAG), which provides advice on the treatment of casualties in accordance with the symptoms exhibited as well as equipment and antidotes that may be appropriate for treating the casualty, and to the relevant provisions of the STCW Code, parts A and B."
***
__________
162
Bilaga
Title RESOLUTIONs / MSC Resolutions / Res.MSC.182(79) Note Amends Res.A.328(9)
RESOLUTION MSC.182(79)
(adopted on 9 December 2004)
ADOPTION OF AMENDMENTS TO THE CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK (GC CODE)
THE MARITIME SAFETY COMMITTEE,
RECALLING Article 28(b) of the Convention on the International Maritime Organization concerning the functions of the Committee,
RECALLING ALSO resolution A.328(9), by which the Assembly, at its ninth session, adopted the Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk (Gas Carrier (GC) Code), RECOGNIZING the need for the amendments to the GC Code to become effective on the date on which the corresponding amendments to the IGC Code enter into force, HAVING CONSIDERED, at its seventy-ninth session, amendments to the Gas Carrier Code proposed by the Sub-Committee on Flag State Implementation, at its eleventh session, which were approved by the Committee at its seventy-eighth session, NOTING resolution MSC.177(79), by which it adopted amendments to the International Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk (IGC Code), 1. ADOPTS amendments to the Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk, as amended, the text of which is set out in the Annex to the present resolution; 2. DETERMINES that the said amendments should become effective on 1 July 2006 upon acceptance and entry into force of the corresponding amendments to the IGC Code adopted by resolution MSC.177(79).
ANNEX
AMENDMENTS TO THE CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK, AS AMENDED
APPENDIX
MODEL FORM OF CERTIFICATE OF FITNESS FOR THE CARRIAGE OF LIQUEFIED GASES IN BULK
1 In the form of the Certificate of Fitness for the Carriage of Liquefied Gases in Bulk, the following new section is inserted between the section commencing with the words "This
163
Bilaga
certificate is valid until" and the section commencing with the words "Issued at": "Completion date of the survey on which this certificate is based: __________ (dd/mm/yyyy)"
***
__________
164
Bilaga
Title RESOLUTIONs / MSC Resolutions / Res.MSC.225(82)
RESOLUTION MSC.225(82)
(adopted on 8 December 2006)
ADOPTION OF AMENDMENTS TO THE CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK, AS AMENDED
THE MARITIME SAFETY COMMITTEE, RECALLING Article 28(b) of the Convention on the International Maritime Organization concerning the functions of the Committee, RECALLING ALSOresolution A.328(9), by which the Assembly, at its ninth session, adopted the Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk (Gas Carrier Code) and authorized the Committee to amend the Code as may be necessary, NOTING resolution MSC.220(82), by which it adopted pertinent amendments to the International Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk (IGC Code), RECOGNIZING the need for the amendments to the Gas Carrier Code to become effective on the date, on which the corresponding amendments to the IGC Code enter into force, HAVING CONSIDERED, at its eighty-second session, amendments to the Gas Carrier Code prepared by the Sub-Committee on Bulk Liquids and Gases, at its ninth session, 1. ADOPTS amendments to the Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk, as amended, the text of which is set out in the Annex to the present resolution; 2. DETERMINES that the above-said amendments should become effective on 1 July 2008.
ANNEX
AMENDMENTS TO THE CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK, AS AMENDED
CHAPTER XI
FIRE PROTECTION AND FIRE EXTINGUISHING
11.1 Fire safety requirements 1 In section 11.1, the following new paragraph 11.1.5 is added: “11.1.5 The following requirements in SOLAS chapter II-2, as adopted by MSC.99(73), should apply: (a) regulations 13.3.4.2 to 13.3.4.5 and 13.4.3 to ships of 500 gross tonnage and over; (b) regulations in Part E, except regulations 16.3.2.2 and 16.3.2.3; and (c) regulations replaced by MSC 82/24/Add.1/Corr.3) and 10.6.4 for new installations.
CHAPTER XIX
SUMMARY OF MINIMUM REQUIREMENTS
2 The following new products are added to the table: a b c d e f g h Control of Independent vapour Product UN Ship Vapour Special tank type C space Gauging name number type detection requirements required within cargo tanks Dimethyl IIG / - - - I+T C ether IIPG Carbon dioxide - IIIG Yes - - C
***
165
166
Bilaga
RESOLUTIONs / MSC Resolutions / 93rd Session / Res.MSC.377
Title
(93)
RESOLUTION MSC.377(93)
(adopted on 22 May 2014)
AMENDMENTS TO THE CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK (GC CODE)
THE MARITIME SAFETY COMMITTEE, RECALLING Article 28(b) of the Convention on the International Maritime Organization concerning the functions of the Committee, RECALLING ALSO resolution A.328(9) by which the Assembly, at its ninth session, adopted the Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk (GC Code), NOTING resolution MSC.370(93), by which it adopted amendments to the International Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk (IGC Code), HAVING CONSIDERED, at its ninety-third session, amendments to the GC Code proposed by the Sub-Committee on Stability and Load Lines and Fishing Vessels Safety, at its fifty-fifth session, which were approved by the Committee at its ninety-second session, RECOGNIZING the need for the amendments to the GC Code to become effective on the date on which the corresponding amendments to the IGC Code enter into force, 1 ADOPTS amendments to the Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk (GC Code), as amended, the text of which is set out in the annex to the present resolution; 2 DETERMINES that the said amendments shall become effective on 1 January 2016 upon acceptance and entry into force of the corresponding amendments to the IGC Code adopted by resolution MSC.370(93). * Date of entry into force of the aforementioned amendments to the IGC Code.
ANNEX
AMENDMENTS TO THE CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK (GC CODE)
CHAPTER II
SHIP SURVIVAL CAPABILITY AND CARGO TANK LOCATION
Paragraph 2.2 – Freeboard and stability
1 A new subparagraph 2.2.4 is added as follows:
167
Bilaga
"2.2.4 All ships, subject to the Code, should be fitted with a stability instrument, capable of verifying compliance with intact and damage stability requirements, approved by the Administration, at the first scheduled periodical survey of the ship on or after 1 January 2016, but not later than 1 January 2021, having regard to the performance standards recommended by the Organization*:
.1 notwithstanding the requirements above, a stability instrument fitted on a ship before 1 January 2016 need not be replaced provided it is capable of verifying compliance with intact and damage stability, to the satisfaction of the Administration; and
.2 the Administration should issue a document of approval for the stability instrument.
________________
* Refer to part B, chapter 4, of the International Code on Intact Stability, 2008 (2008 IS Code), as amended; the Guidelines for the Approval of Stability Instruments (MSC.1/Circ.1229), annex, section 4, as amended; and the technical standards defined in part 1 of the Guidelines for verification of damage stability requirements for tankers (MSC.1/Circ.1461)."
2 A new subparagraph 2.2.5 is added as follows:
"2.2.5 The Administration may waive the requirements of paragraph 2.2.4 for the following ships, provided the procedures employed for intact and damage stability verification maintain the same degree of safety as being loaded in accordance with the approved conditions*. Any such waiver should be duly noted on the Certificate of Fitness referred to in paragraph 1.6.4:
.1 ships which are on a dedicated service, with a limited number of permutations of loading such that all anticipated conditions have been approved in the stability information provided to the master in accordance with the requirements of paragraph 2.2.3;
.2 ships where stability verification is made remotely by a means approved by the Administration;
.3 ships which are loaded within an approved range of loading conditions; or
.4 ships provided with approved limiting KG/GM curves covering all applicable intact and damage stability requirements.
________________
* Refer to operational guidance provided in part 2 of the Guidelines for verification of damage stability requirements for tankers (MSC.1/Circ.1461)."
Certificate of Fitness
3 The existing paragraph 6 is replaced by the following:
"6 That the ship must be loaded:
.1* only in accordance with loading conditions verified compliant with intact and damage stability requirements using the approved stability instrument fitted in accordance with paragraph 2.2.4 of the Code;
.2* where a waiver permitted by paragraph 2.2.5 of the Code is granted and the approved stability instrument required by paragraph 2.2.4 of the Code is not fitted, loading shall be made in accordance with one or more of the following approved methods:
168
Bilaga
(i) * in accordance with the loading conditions provided in the approved loading Administration, or of an organization recognized by the Administration; or (ii) * in accordance with loading conditions verified remotely using an approved means…………………; or (iii) * in accordance with a loading condition which lies within an approved range of conditions defined in the approved loading manual referred to in (i) above; or (iv) * in accordance with a loading condition verified using approved critical KG/GM data defined in the approved loading manual referred to in (i) above; .3* in accordance with the loading limitations appended to this Certificate. Where it is required to load the ship other than in accordance with the above instruction, then the necessary calculations to justify the proposed loading conditions should be communicated to the certifying Administration who may authorize in writing the adoption of the proposed loading condition. ________________ * Delete as appropriate."
***
__________
169
170
Bilaga
RESOLUTIONs / MSC Resolutions / 99th Session / Res.MSC.447
Title
(99)
RESOLUTION MSC.447(99)
(adopted on 24 May 2018)
AMENDMENTS TO THE CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK (GC CODE)
THE MARITIME SAFETY COMMITTEE,
RECALLING Article 28(b) of the Convention on the International Maritime Organization concerning the functions of the Committee,
RECALLING ALSO resolution A.328(IX) by which the Assembly, at its ninth session, adopted the Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk (GC Code),
NOTING resolution MSC.441(99), by which it adopted the corresponding amendments to the Certificate of Fitness under the International Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk (IGC Code),
HAVING CONSIDERED, at its ninety-ninth session, amendments to the Certificate of Fitness under the GC Code prepared by the Secretariat and, subsequently, approved by the Committee at its ninety-eighth session,
RECOGNIZING the need for the amendments to the GC Code to become effective on the date on which the corresponding amendments to the IGC Code enter into force,
1 ADOPTS amendments to the Certificate of Fitness under the Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk, as amended, the text of which is set out in the annex to the present resolution;
2 DETERMINES that the said amendments shall become effective on 1 January 2020 upon acceptance and entry into force of the corresponding amendments to the IGC Code adopted by resolution MSC.441(99).
ANNEX
AMENDMENTS TO THE CODE FOR THE CONSTRUCTION AND EQUIPMENT OF SHIPS CARRYING LIQUEFIED GASES IN BULK (GC CODE)
1 In the appendix, the existing paragraph 6 of the model form of Certificate of Fitness for the Carriage of Liquefied Gases in Bulk is replaced with the following:
"6 That the loading and stability information booklet required by paragraph 2.2.3 of the Code has been supplied to the ships in an approved form.
7 That the ship must be loaded:
* .1 only in accordance with loading conditions verified compliant with intact and damage stability requirements using the approved stability instrument fitted in accordance with
171
Bilaga
paragraph 2.2.4 of the Code;
* Delete as appropriate. * .2 where a waiver permitted by paragraph 2.2.5 of the Code is granted and the approved stability instrument required by paragraph 2.2.4 of the Code is not fitted, loading should be made in accordance with one or more of the following approved methods:
(i)* in accordance with the loading conditions provided in the approved loading and stability information booklet referred to in 6 above; or
* (ii) in accordance with loading conditions verified remotely using an approved means…………………; or
* (iii) in accordance with a loading condition which lies within an approved range of conditions defined in the approved loading and stability information booklet referred to in 6 above; or
* (iv) in accordance with a loading condition verified using approved critical KG/GM data defined in the approved loading and stability information booklet referred to in 6 above;
* .3 in accordance with the loading limitations appended to this Certificate.
Where it is required to load the ship other than in accordance with the above instruction, then the necessary calculations to justify the proposed loading conditions should be communicated to the certifying Administration who may authorize in writing the adoption ** of the proposed loading condition. ** Instead of being incorporated in the Certificate, this text may be appended to the Certificate, if duly signed and stamped."
***
172