SOU 1954:12

Elkraftförsörjningen : huvudbetänkande

Herr Statsrådet och Chefen för Kungl. Kommunikationsdepartementet

Genom beslut den 18 december 1942 bemyndigade Kungl. Maj:t Stats- rådet och Chefen för Kungl. Handelsdepartementet att tillkalla högst åtta utredningsmän för att utreda och framlägga förslag rörande möjligheterna att genom statens medverkan mera planmässigt än hittills trygga landets och särskilt den svenska landsbygdens försörjning med elektrisk kraft. I enlighet med Kungl. brev till statskontoret den 10 januari 1947 beslutades sedermera att ärenden, som sammanhänga med ifrågavarande utredning, fr. o. m. den 1 januari 1947 skola handläggas av kommunikationsdeparte- mentet.

Med stöd av ovannämnda bemyndigande tillkallades den 23 januari 1943 såsom utredningsmän f. d. landshövdingen S. A. E. Hagströmer, tillika ord— förande (avliden i maj 1943), agronomen G. G. Brandin, Sanda, Österha- ninge (avliden i november 1945), dåvarande chefen för kommerskollegii elektriska byrå, kommerserådet N. P. Malm (t.o.m. den 31 maj 1952), chefen för Örebro stads elverk, direktören P. H. Y. Persson, lantbrukaren J. F. D. Svensson, Björnås, Långås, numera f.d. överdirektören och sous- chefen i vattenfallsstyrelsen N. E. Sylwan, sekreteraren i Svenska vatten- kraftföreningen, numera generaldirektören E. G. J. Upmark samt vatten- rättsingenjören vid Norrbygdens vattendomstol, numera vid rikets samtliga vattendomstolar, S. 0. G. Zickerman. Efter landshövding Hagströmer till— kallades den 8 juli 1943 numera f. d. landshövdingen E. F. L. Lindeberg att deltaga i och såsom ordförande leda utredningsarbetet.

För att såsom experter biträda utredningsmännen tillkallades sedermera kraftverksdirektören vid statens vattenfallsverk Th. Strand för vissa orga- nisationsspörsmål (fr. o. m. den 15 december 1949), direktören för statens maskin- och redskapsprovningsanstalter H. A:son Moberg (fr. o. m. den 15 december 1949), chefen för kommerskollegii elektriska byrå, kommerse- rådet B. Berggren (fr.o.m. den 30 oktober 1952) samt länsassessorn vid länsstyrelsen i Älvsborgs län B. Carle (fr.o.m. den 1 januari 1953 t. o. m.

den 10 februari 1954). Moberg, Berggren och Carle ha härvid i regel när- varit vid utredningsmännens sammanträden ävensom i övrigt kontinuerligt deltagit i arbetet.

Som kanslichefer ha tjänstgjort driftdirektören i vattenfallsstyrelsen, numera generaldirektören Åke Rusck (fr.o.m. den 1 mars 1943 t.o.m. den 31 december 1947), dåvarande överdirektören och souschefen i vatten- fallsstyrelsen G. H. Nilsson (fr.o.m. den 1 januari 1948 t.o.m. den 31 december 1952; biträdde dåvarande kanslichefen fr.o.m. den 30 augusti 1943 t. 0. m. den 31 december 1947) samt förste driftsingenjören vid statens vattenfallsverk N. H. 'E. Wannheden (fr.o.m. den 1 januari 1953; biträdde dåvarande kanslichefen fr.o.m. den 15 februari 1950 t.o.m. den 31 de- cember 1952).

Som sekreterare ha tjänstgjort numera generaldirektören Åke Rusck (fr. o. m. den 1 mars 1943 t.o.m. den 30 maj 1945), länsnotarien, numera länsassessorn B. Carle (fr.o.m. den 1 juni 1945 t.o.m. den 31 december 1952) samt hovrättsfiskalen N. Vasseur (fr. o. m. den 1 februari 1953 t. o. m. den 31 december 1953).

Utöver i det föregående nämnda ha under olika tidsperioder som särskilda biträden tjänstgjort en eller under särskilt arbetskrävande perioder flera ingenjörer samt två eller tre kvinnliga biträden. Av denna personal ha driftsingenjören vid statens vattefallsverk N. O. Joachimsson, som tjänst- gjort hos utredningen fr. o. rn. den 1 september 1948 t. o. m. den 30 no- vember 1951, och ingenjören vid statens vattenfallsverk B. H. Hedefalk, som tjänstgjort hos utredningen sedan den 4 mars 1944, tagit del i utarbetan- det av föreliggande betänkande eller underlaget till detta

Utredningsmännen höllo sitt första sammanträde den 17 mars 1943 och antogo då namnet elkraftutredningen av år 1943.

Elkraftutredningens direktiv återges i det följande oavkortade, enär de ge en överskådlig bild av läget inom elkraftförsörjningen vid tiden för ut- redningens tillkomst. Utöver nämnda direktiv fick elkraftutredningen se- dermera i uppdrag att vid utredningsuppdragets fullgörande taga olika frågor under övervägande. Nämnda frågor äro återgivna efter direktiven.

Elkraftutredningen får härmed överlämna sitt huvudbetänkande med redogörelse för samt bedömning av nuvarande förhållanden inom Sveriges elkraftförsörjning ävensom förslag till åtgärder för dess erforderliga ratio- nalisering.

Ifråga om huvudbetänkandets uppbyggnad, som närmare klarlägges ge- nom en förhållandevis omfattande innehållsförteckning, må endast fram- hållas, att de båda viktigare avdelningarna (II och 111) på grund av sin omfattning ges var sin sammanfattning (kap. 16 respektive kap. 20). Före själva betänkandet lämnas därjämte en mera koncentrerad sammanfattning av elkraftutredningens förslag, åtföljd av författningsutkast jämte special-

motiveringar. Betänkandetsavdelning I medtages närmast för att, ge en allmän bakgrund i fråga om elkraftförsörjningens uppbyggnad, den hittills- varande utvecklingen samt elkraftförsörjningen i andra länder. Genom den behandling av elkraftförsörjningens teknik m. ni., som ges i kap. 1, anses icke någon mera omfattande sammanställning över definitioner av använda facktermer etc. erforderlig. En förteckning med hänvisningar till förkla- ringar av mera allmänt förekommande fackuttryck och förkortningar läm- nas emellertid på s. 20.

Huvudbetänkandets uppdelning på tre avdelningar och inom dessa på ett flertal kapitel betingas av en strävan att nå största möjliga överskådlighet i behandlingen i dess helhet. Detta nödvändiggör emellertid att en del frågor upptagas på mer än ett ställe i betänkandet, sedda ur olika synvinklar, vilket har till följd å ena sidan en del upprepningar och å andra sidan en viss splittring av dessa frågor. Med hjälp av befintliga hänvisningar samt inne- liållsförteckningen torde det dock vara möjligt att utan större svårighet studera även betänkandets behandling av enskilda delfrågor.

Det kan synas anmärkningsvärt att elkraftutredningen i huvudbetän- kandet ägnar så stor del av utrymmet åt frågor, enbart eller nära samman- hängande med elkraftens detaljdistribution på landsbygden, medan andra betydelsefulla delar av den totala elkraftförsörjningen till synes lämnas utan större beaktande. Detta sammanhänger emellertid med att de allvar- liga brister, SOITll f.n. råda inom Sveriges elkraftförsörjning, föreligga till största delen just inom landsbygdsdistributionen, vilket förutsetts redan vid utfärdandet av utredningens direktiv och som även bekräftats genom elkraftutredningens undersökningar. Det bör framhållas att väsentliga de- lar av det stora frågekomplex, som skulle kunna anses höra till en all- omfattande utredning om Sveriges elkraftförsörjning, har måst lämnas utanför elkraftutredningens diskussioner och utredningsarbete. Huvud- betänkandet är sålunda, av naturliga skäl, till väsentlig del ett betänkande rörande landsbygdens elkraftförsörjning. Det må i detta sammanhang även framhållas, att de förslag till åtgärder för en teknisk upprustning av lands— bygdsdistributionen, som utredningen framlagt i underdånig skrivelse den 26 januari 1953 och som i fråga om huvudsyftet kraftigt understöttsav remissinstanserna, äro inarbetade i de mera vittgående förslagen enligt huvudbetänkandet.

Såsom närmare klarlägges i huvudbetänkandet, s. 363, har elkraftutred- ningen icke funnit det nödvändigt eller ens ändamålsenligt att i utarbe- tandet av de här framlagda huvudförslagen rörande elkraftförsörjningens rationalisering och den statliga verksamhetens organisation gå alltför långt i detalj. Dessa förslag äro därför i viss män att betrakta som principförslag. Behandlingen torde emellertid vara tillräckligt ingående för att möjliggöra ett ställningstagande i princip, varefter detaljarbetet utan svårighet bör kunna slutföras.

Under sitt arbete har elkraftutredningen haft förbindelse och samverkat med ett flertal statliga, kommunala och enskilda organisationer och per- soner. Som exempel på dylikt samarbete må nämnas en överläggning i Umeå i augusti 1951 med landshövdingarna och andra representanter för de fyra nordligaste länen, varvid diskuterades olika elkraftfrågor av sär- skild betydelse för Norrland. 1 nämnda överläggning deltogo även sak— kunniga för utredning rörande vissa ändringar i vattenlagen. Samman— träden för information och diskussion rörande olika elkraftproblem höllos i Stockholm under hösten 1950 med representanter för statens vattenfalls- verk, de kommunala och enskilda kraftföretagen, landsbygdens smärre distributionsföretag, jordbruksnäringen, småindustrin och hantverket även- som andra konsumentgrupper, stads- och landskommunerna, de konsulte- rande företagen samt de elektriska installatörcrna.

Vissa separata utrednings- och standardiseringsarbeten ha på elkraft- utredningens initiativ påbörjats och delvis även genomförts av med elkraft- utredningen samarbetande kommittéer. En samlad, kortfattad redogörelse för dessa arbeten återfinnes som bilaga 1 till huvudbetänkandet.

Till elkraftutredningen har under utredningsarbetets gång remitterats ett flertal ärenden, i vilka utredningen sålunda avgivit utlåtanden. En för— teckning över dessa utlåtanden och andra elkraftutredningens uttalanden eller förslag i olika, mera betydelsefulla frågor, jämte en förteckning över elkraftutredningens hittills tryckta betänkanden och redogörelser, bifogas huvudbetänkandet som bilaga 2. Flertalet av elkraftutredningens tidigare gjorda uttalanden ingå även i sina särskilda sammanhang i huvudbetän- kandet.

De enligt bilagorna 1 och 2 redan publicerade utredningarna och för- slagen ha i olika avseenden varit av grundläggande betydelse för elkraft- utredningens slutliga ställningstagande och sålunda för i detta huvud- betänkande framlagda synpunkter och förslag. Utredningen tror sig också ha gjort den erfarenheten, att mycket av vad som tidigare framlagts redan har varit av betydelse för den utveckling av elkraftförsörjningen under ett viktigt skede, vilken ägt rum sedan elkraftutredningens tillkomst. Härtill har icke minst bidragit värdefulla insatser från och samverkan med andra organisationer, kommittéer eller utredningar. Det finnes anledning påpeka detta om försörjningsutvecklingen, enär härmed också i mycket skapats en god grundval för att de slutliga, mera mångsidigt och längre syftande för- slagen i huvudbetänkandet må på bästa sätt kunna förverkligas. Elkraft- utredningen har också med publicerandet av nyssnämnda utredningar en- ligt bilagorna 1 och 2 följt anvisningarna i direktiven, att vissa viktiga de— taljspörsmål skulle framläggas för sig i den mån något eller några av dessa finnes kunna lösas snabbare än och oberoende av utredningsuppdraget i dess helhet.

Efter huvudbetänkandets framläggande återstår för elkraftutredningen att slutföra arbetet med de 5. k. länsredogörelserna (se bilaga 2, s. 435) samt att framlägga eventuella ändrings- och kompletteringsförslag till standardtarifferna för detaljdistribution av elektrisk kraft ävensom att medverka till slutförandet av arbetet med de elektriska system- och mate- rielstandardiseringsfrågorna (se bilaga 1, s. 433), vilka jämväl ingå i de till elkraftutredningen enligt direktiven lämnade uppdragen. Den ytterligare behandlingen av dessa frågor kommer icke att få betydelse för huvudbetän- kandets slutsatser.

Särskilt yttrande av ledamoten Persson bifogas. Stockholm den 21 april 1954.

Erik Lindeberg P. H. Yngve Persson ' J. F. Daniel Svensson Einar Sylwan Erik Upmark Gustaf Zickerman

/Harald Wannheden

Elkraftutredningens direktiv

I sitt anförande till statsrådsprotokollet den 18 december 1942 i samband med utverkande av Kungl. Maj:ts bemyndigande för chefen för handels-. departementet att tillkalla sakkunniga för utredning av frågor, samman- hängande med Sveriges elkraftförsörjning, yttrade departementschefen, statsrådet Eriksson, efter gemensam beredning med cheferna för justitie-, kommunikations- och jordbruksdepartementen, följande.

I anledning av de vid 1942 års riksdag väckta, likalydande motionerna nr 5 i första och nr 13 i andra kammaren, över vilka motioner yttranden i vederbörlig ordning införskaffats från kommerskollegium och vattenfallsstyrelsen, har riks- dagen i skrivelse den 12 maj 1942, nr 199, hos Kungl. Maj:t hemställt om utredning rörande möjligheterna att genom statens medverkan mera planmässigt än hittills trygga landets och särskilt den svenska landsbygdens försörjning med elektrisk kraft. Till motivering av sin framställning samt såsom riktlinjer för den förordade utredningens bedrivande har riksdagen anfört följande.

Om utvecklingen på kraftförsörjningens område i rätt stor utsträckning fått ske fritt och utan starkare ingrepp från statens sida, kunde detta anses ha varit be- tingat av den tekniska och ekonomiska nödvändigheten. Städerna med sina gynn- samma disttributionsförhållanden och bruken med sina stora kontinuerliga kraft- behov, som lämpligast borde tillgodoses från det vattenfall, som ofta var be- stämmande för vederbörande industriföretags belägenhet, voro föregångarna. Ut- vecklingen hade sedermera fortgått raskt och under lång tid på det hela taget tillfredsställande. Denna genom enskilda företag och kommuner bedrivna elektri- fiering hade kompletterats av statlig företagarverksamhet på området, vilken nu- mera fått en sådan omfattning, att Sveriges kraftförsörjning handhades till om- kring en tredjedel av statens vattenfallsverk. Vid utnyttjande av vattenkraften hade det varit naturligt inom varje särskilt. företag att anlägga rent affärsmässiga principer vid såväl produktion som distribution. Ett vattenfalls krafttillgång hade i enlighet härmed fått tillgodose behovet av elektrisk energi hos de högstbjudande och hos de stora konsumenterna, även om dessa befunnit sig på långt avstånd från kraftkällan, medan den närliggande bygdens kraftbehov icke alltid blivit nöjaktigt tillgodosett, särskilt i sådana fall då förbrukningen varit ringa och ledningskostnaderna höga. På grund härav hade elektrifieringen i vissa lands- delar fått i stor omfattning ombesörjas genom utbyggnad till oproportionerligt stora kostnader av vattenfall med alltför ringa kraftmängd. En del bygder hade icke kunnat erhålla någon elektrisk energi. Trots att kraftföretagen redovisat stora nettovinster funnes därför alltjämt i vårt land bygder med otillräcklig kraft— försörjning eller sådan till alltför höga priser. Den starka uppdelningen på olika företagare av den elektriska kraftproduktionen uteslöte för närvarande en mera rättvis prissättning av den elektriska energien och verkade hinderlig för en ra- tionell utveckling av det elektriska distributionsnätet. Motionärerna hade ifråga— satt, att ett förstatligande av produktionen och distributionen av elektrisk energi borde äga rum i den mån så visade sig nödvändigt för uppnående av större plan- mässighet. Utan att underskatta de erinringar, som av vattenfallsstyrelsen och

kommerskollegium riktats mot motionärernas framställning, ville riksdagen uttala sin anslutning till det med motionerna angivna syftet, nämligen att uppnå en mera enhetlig ledning av landets kraftförsörjning samt därvid också i den mån så visade sig nödvändigt ett förstatligande av hithörande produktion och distri— bution.

Riksdagen funne vidare, oberoende av denna mera principbetonade utrednings- uppgift och ståndpunktstagandet till densamma, skäl föreligga att beakta en del viktiga detaljspörsmål berörande elektrifieringen». Ett missförhållande, som krävde uppmärksamhet, vore den alltjämt ohämmat pågående spekulationen i out- byggda vattenfall, varigenom råkraften dreves upp i ett prisläge, som vid ett fram- tida utbyggande av dylika vattenfall komme att medföra avsevärt högre kraft- priser än som varit nödvändigt, om spekulation icke förekommit. I Norrland hade på allra senaste tid dylika spekulationsköp ägt rum. 1 den mån den elektriska kraftens utbredning vidgades, ökades behovet av större enhetlighet och plan— mässighet i fråga om kraftdistributionen. Fog kunde också finnas för en växande samhällelig kontroll exempelvis över tillämpade krafttaxor. En särskild anledning att nu uppmärksamma och närmare överväga dessa spörsmål hade riksdagen funnit i det av kommerskollegium påpekade förhållandet, att de koncessioner, som beviljats enligt 1902 års lag, innefattande vissa bestämmelser om elektriska an- läggningar, inom den närmaste tiden efter hand skulle börja förfalla. Elektrifie- ringens allmänna betydelse för landsbygden och för därvarande befolknings för- sörjningsmöjligheter, trivsel och kvarhållande vid sin gamla bygd hade redan tidigare av riksdagen uppmärksammats. Det torde vara förtjänt av utredning i vad mån staten kunde ytterligare medverka för den elektriska kraftens utbredning till de även i övrigt i allmänhet rätt vanlottade landsdelar, som ännu saknade dylik kraft. I samband med dessa överväganden borde också vissa i motionerna berörda spörsmål om exempelvis större enhetlighet vid utförandet av ledningsnät och.»ökad standardisering vid tillverkningen av elektriska apparater och utrust- ning» komma under bedömande.

Riksdagen har slutligen erinrat, att behovet av klarare riktlinjer för och bättre kontroll över den allmänna kraftförsörjningen redan tidigare vitsordats av den år 1917 tillsatta elektrifieringskommittén. I sitt den 31 maj 1923 avgivna slut- betänkande hade kommittén föreslagit tillsättning av ett permanent råd samman- satt —— förutom av en av Kungl. Maj:t utsedd ordförande och ombud för de statliga verken —— av tre representanter" för kraftproducenterna, däribland en för syd- svenska kraftaktiebolaget och en för svenska elektricitetsverksföreningen, samt tre representanter för konsumenterna, vilka representanter skulle utses främst av hushållningssällskapen och Sveriges industriförbund. Utan att taga ställning till frågan, huruvida tillsättningen av ett sådant av elektrifieringskommittén angivet råd kunde vara motiverad eller överhuvud taget under vilka former statens inflytande över den elektriska produktionen kunde bättre organisatoriskt säkras, måste riksdagen finna behov föreligga av en större klarhet om de riktlinjer, efter vilka landets framtida försörjning med elektrisk kraft borde ordnas.

En utredning med det av riksdagen sålunda angivna syftet synes nu böra verk- ställas. Utredningen bör i första hand avse att klargöra, i vilka hänseenden miss— förhållanden råda beträffande produktionen och distributionen av elektrisk kraft, samt vilka orsakerna till dessa missförhållanden äro.

En av utredningens första uppgifter blir alltså att vinna överblick över de redan i anspråk tagna eller för utbyggnad lämpade kraftkällorna, de redan ut- förda stamlinjerna för överföring av kraft från Norrland till konsumtionscentra i

mellersta och södra Sverige, de elektriska kraftledningsnäten inom skilda delar av landet och deras utnyttjande för olika ändamål samt föreliggande utbyggnads- program. I den mån det därvid visar sig, att kraftförsörjningen inom vissa lands- delar blivit i anmärkningsvärd grad eftersatt, böra orsakerna härtill utrönas.

De villkor, på vilka kraften tillhandahålles konsumenterna, böra även göras till föremål för studium. Härutinnan synes lämpligt, att utredningen fullföljer den inom kommerskollegium pågående sammanställningen av uppgifter rörande pri- serna på elektrisk kraft inom landets olika delar. Då sammanställningen skall grundas på uppgifter, som innehavare av elektriska starkströmsanläggningar jäm- likt 4 % stadgan om dylika anläggningar den 5 maj 1939 äro skyldiga att på an- fordran ingiva till kollegium, bör dock kollegium biträda med taxeuppgifternas insamlande. Sammanställningen kommer säkerligen att bestyrka det ofta och i skilda sammanhang omvittnade förhållandet, att krafttaxorna trots redan vid— tagna standardiseringsåtgärder samt de år 1938 i 1902 års lag införda bestäm- melserna om reglering av priset för elektrisk ström -— äro mycket växlande i fråga 0111 såväl utformning som höjd inom skilda taxeområden. Där av samman- ställningen synes framgå, att energipriset är anmärkningsvärt högt, bör under- sökning göras rörande anledningen till en sådan prissättning och till att den icke genom reglering enligt nyssnämnda lagbestämmelser blivit jämkad. Särskilt bör uppmärksamheten därvid riktas på den kedjehandel, vilken på sina håll före- kommer och som är ägnad att menligt påverka såväl tillgången som priset på den elektriska energien. Likaledes bör utredas, i vad mån en ytterligare standardi— sering av krafttaxornas utformning lämpligen är genomförbar. Då vidare värdet av den elektriska kraften i väsentlig grad beror på den tillförlitlighet, varmed densamma tillhandahålles, samt på spänningsregleringen, bör det undersökas i vad mån påtagliga brister förekomma i dessa hänseenden.

Frågan om åtgärder mot spekulation i outbyggda vattenfall, vilken fråga av riks- dagen även uppmärksammats, är föremål för undersökning genom särskilda inom justitiedepartementet tillkallade sakkunniga. Vid den nu förordade utredningen bör kontakt sökas med nämnda sakkunniga, i syfte att utredningsarbetet i den mån det berör närliggande spörsmål blir planmässigt uppdelat. Utredningen bör givetvis omfatta frågan, huruvida icke jämväl andra affärstransaktioner före- komma, vilka kunna vara ägnade att onödigtvis driva upp kraftpriset.

Under ärendets riksdagsbehandling ha de olägenheter framhållits, vilka för- anledas därav att utbyggandet av distributionsnäten ute i bygderna mången gång saknat den planmässighet, som skulle vara en förutsättning för en väl genomförd standardisering av den elektriska materielen. Den bristande enhetligheten här- utinnan är otvivelaktigt delvis beroende på teknikens snabba utveckling men del- vis också på det stora antalet företag i branschen. Om och i vad mån även andra omständigheter medverkat till att standardiseringssträvandena på detta område hittills mött svårigheter bör närmare utredas.

Då det gäller att överväga åtgärder för att avhjälpa förekommande missförhål- landen i nu berörda och andra hänseenden torde det vara lämpligt att i första hand inrikta uppmärksamheten på åtgärder av mera begränsad räckvidd för att få utrönt, om man enbart genom dylika åtgärder kan tillgodose de önskemål, som ligga till grund för riksdagens skrivelse. Sålunda bör prövas, huruvida det bör givas fastare former än hittills åt den samverkan vid kraftproduktionen, som redan nu upprätthålles mellan statliga och enskilda kraftintressenter, samt om staten bör genom en vidgad egen insats eller särskilda kontrollåtgärder förskaffa sig ökat inflytande över de viktiga stamlinjerna från Norrland till mellersta och södra Sverige.

Måhända kan det komma att visa sig, att kraftförsörjningeu inom vissa delar av landet skulle kunna avsevärt förbättras genom en skärpning eller utvidgad till- lämpning av vattenlagens bestämmelser angående skyldighet för kraftverksägare att tillhandahålla s.k. bygdekraft. Därcst det av utredningen framgår, att vissa kraftleverantörer —— trots 1902 års lags bestämmelser om prisreglering —— med utnyttjande av sin faktiska monopolställning hålla ett alltför högt pris, bör det övervägas huruvida en mera tillfredsställande ordning härutinnan står att vinna genom en effektivisering av berörda prisregleringsbestämmelser eller på annat sätt. .

För trakter med gles bebyggelse, och särskilt för sådana utan tillgång till när- belägna vattenfall, måste under alla förhållanden en elektrifiering ställa sig dyr. På grund härav ha åtgärder redan vidtagits i syfte att bereda befolkningen å så- dana orter lättnader med avseende å elektrifieringskostnaderna. Det torde nu böra undersökas, huruvida det hittills tillämpade systemet härutinnan bör ändras eller utbyggas i en eller annan form.

I anslutning till den nyss av mig förordade undersökningen rörande bristfällig— heter med avseende å standardiseringen av elektrisk materiel och apparatur bör jämväl utredas, huruvida en tillfredsställande ordning härutinnan kan åväga- bringas genom härför särskilt avsedda åtgärder.

Riksdagen har uttalat sin anslutning till det i motionerna angivna syftet att uppnå en mera enhetlig ledning av kraftförsörjningen i landet och därvid även godtagit tanken att i den mån så visade sig nödvändigt till förverkligande av detta syfte gripa till ett förstatligande av produktion och distribution på detta område. Hithörande spörsmål höra i enlighet med riksdagens önskan upptagas till behandling och därvid underkastas en ingående och sorgfällig utredning och prövning. Därvid böra icke minst kostnadsfrågorna beaktas. Om utredningen leder till att inlösen av enskilda anläggningar förordas, bör förslag till inlösen- bestämmelser upprättas och beräkning verkställas rörande kostnaderna för inlös- ningen och för de nya anläggningar, som kunna behöva utföras av statens vatten- t'allsverk för att inlösta anläggningar skola kunna på lämpligt sätt utnyttjas i samarbete med de statliga kraftverken.

Ifrågavarande utredning skulle, såsom framgår av vad här anförts, komma att avse dels vissa säkerligen svårbedömbara frågor av stor principiell vikt och om- fattning, dels ock åtskilliga likaledes viktiga detaljspörsmål. I den mån något eller några av de senare finnas kunna lösas snabbare än och oberoende av utrednings- uppdraget i dess helhet, synas förslag däri böra framläggas för sig.

Enligt särskilda beslut har elkraftutredningen sedermera fått i uppdrag att vid utredningsuppdragets fullgörande taga under övervägande frågor enligt följande.

Genom handelsdepartementets skrivelse den 30 september 1944 frågan att vid- taga sådan ändring i lagen den 27 juni 1902, innefattande vissa bestämmelser om elektriska anläggningar, att statens prisregleringsnämnd för elektrisk ström vid äsättande av strömpris jämväl skulle ha att på bindande sätt avgöra fråga om inlösen av ledning.

Genom kommunikationsdepartemeutets hänvändelse den 20 januari 1950 frågor angående jämkningar i de av elkraftutredningen år 1947 föreslagna standard- tarifferna för detaljdistribution av elektrisk kraft.

Genom kommunikationsdepartementets skrivelse den 13 januari 1950 frågan angående kostnadsfördelning mellan strömleverantör och abonnent vid ändring av spänning på lågspänningsnät.

Genom kommunikationsdepartementets skrivelse den 3 november 1950 frågan angående skyldighet för statens verk och institutioner att i frågor rörande sättet för tillgodoseende av mera omfattande behov av elektrisk kraft samråda med vattenfallsstyrelsen.

Genom kommunikationsdepartementets skrivelse den 1 december 1950 frågan om särskild utredning rörande kraftförsörjningen i övre Norrland.

Förklaringar och hänvisningar beträffande några allmänt förekommande

förkortningar och begrepp

I fråga om begrepp, sammanhängande med prissättning och försäljning av elektrisk kraft, hänvisas även till elkraftutredningens redogörelse nr 1, »Inledande översikt» (SOU 1947:3), i vilken på s. 74 finnes en sammanställning med för- klaringar och hänvisningar.

Sifferhänvisningarna i det följande avse sidor i huvudbetänkandet.

A ampere . . . . . . . . . . . 64 bution av elektrisk kraft (SOU belastning . . . . . . . . 60,63 194714) detaljdistribution . . . . . . . . 58 näldistributionsnät . . . . . . . 377 distributionsnät, —s_vstem . . . . . 58 ”.it av olika slag . . . 58 effekt . . . . . . . . . . . 59,64 pls perioder per sekund, pe1iodtal. . 64 energi . . . . . . . . 59,64 rationalisering. Med elkraftförsörj- engrosdistribution . . . . . . . 58 ningens rationalisering åsyftas i förluster, överförings- . . . . . 64, 65 första hand kraftföretagens ombild- generator . . . . . . . . . . 59,63 ning till ekonomiskt bärkraftiga hk hästkraft. . . . . . . . 59 och sakkunnigt ledda driftenheter,

kV kilovolt (: 1000 volt). . . _ . 63 som ha förutsättningar att i huvud-

kXV kilowatt (= 1000 natt) _ _ _ _ 04 sak på egen hand ino_m_sina respek— kWh kilowattimme . . . . . . . e. 235335;ng enbesorgatg;”Uli—Toe kondenskraft (SO .1a so jmng mer 1 ampmng

av moderna, utvecklingsfrämjande tariffer och med, så långt det är möjligt och skäligt, enhetliga pri- ser. Såsom ett led i eller vid sidan om rationaliseringen kunna åtgär- der för de elektriska anläggningar-

__ nas tekniska upprustning, inklu— utgora landsbygden. Med den »re— sive erforderlig förstärkning. vara

på» eller »egentliga» landsbygden nödvändiga avses i detta betänkande de delar äkraft. _ _ _ _ _ _ _ _ _ _ _ 58 av landskommunerna, som icke nt—

landsbygd. I kommunalstatisliken in— delas riket i tva huv udgrupper, stä— der och landsbygd, medan primär- kommunerna indelas i tre grupper. städer, köpingar och egentliga lands- kommuner, av vilka de båda senare

.. . . .. samkörning . . . . . . . . . . 56 gora munie1palsamhallen eller an— spänning. hög—, låg-, huvud-, fas— _ _ 64 nan tätbebyggelse med mera än 200 spänningsfall _ *_ _ _ _ _ _ _ _ 64 mvanare strömstyrka . . . . . . . . . . (34

ledningar (linjer) av olika slag ' ' 58 transformator . . . . . . . . . 60 mottryckskraft . . . . . . . . . (il turbin . _ _ _ , _ _ _ . . _ _ 59 Nte normaltariffenhet: Tariffenhet, V volt . . . . . . . . . . . . 63 som infördes i samband med den WV watt . . . . . . . . . . (it av elkraftutredningen förordade öv erföringsförmågd . . . . . . til

»normaltariffen» för detaljdistri- överföri11gsn.it, -s_1stem . . . . 513,57

Sammanfattning av elkraftutredningens förslag

Sveriges elkraftförsörjning får anses vara välordnad till sina mera vä- sentliga delar. Brister i olika avseenden och av mer eller mindre allvarlig karaktär finnas emellertid och dessa brister ha orsakat, att elkraftutred- ningen i föreliggande betänkande framlägger förslag till olika åtgärder. Redogörelsen för och bedömningen av nuvarande förhållanden, som genom- föras i betänkandets avdelning 11, kap. 4—45, sammanfattas i kap. 16, s. 316 —326. Behandlingen av olika alternativ för elkraftförsörjningens rationali- sering, som verkställes i avdelning III, kap. 17—19, och de definitiva för— slagen i huvudfrågorna, som framläggas 1 kap. 19, sammanfattas i kap. 20, s. J116—425.

Bristerna inom elkraftförsörjningen sammanhänga främst med distribu- tion av elkraft på landsbygden och det är därför i främsta rummet för att uppnå förbättrade förutsättningar för en fullgod landsbygdsdistribution, som förslag framläggas eller önskemål uttalas. Därjämte framföras emel- lertid även en del förslag eller göras uttalanden i syfte att garantera en fortsatt gynnsam utveckling i fråga om andra delar av elkraftförsörjningen.

Distribntionsverksamhefen är i behov av en omfattande rationalisering med huvudsakligt syfte att skapa distributionsföretag, som ha möjligheter att i huvudsak på egen hand ombesörja, vart och ett inom sitt område, för- sörjning med elektrisk kraft av fullgod kvalitet i erforderlig mängd och på skäliga, inom områdena utjämnade villkor.

Rationaliseringen nödvändiggör bl.a. en vittgående omorganisation av distributionsverksamheten. Denna omorganisation kommer mer eller mindre direkt att beröra flertalet av landsbygdens distributionsföretag och i viss utsträckning även städernas. Omorganisationen, som bör syfta till att skapa företag av för varje särskilt fall lämplig typ och med en minimistorlek av i runda tal 15 000 normaltariffenheter eller 2 000 förbrukare, motsvarande ett geografiskt område med omkring 7 000 invånare, bör i princip genom— föras på frivillighetens väg. Att helt lita till frivilligheten går emellertid icke, varför även möjligheter till en tvångsvis genomförd omorganisation måste finnas. ;

I samband med rationaliseringen komma väsentligt ökade anspråk i olika avseenden att ställas på kraftföretagen. För rationaliseringens genomfö- rande förutsättes en på olika sätt utökad och intensifierad men i en del avseenden även förenklad statlig verksamhet av huvudsakligen kontrolle- rande, reglerande, rådgivande och stödjande karaktär, bortsett från statens egen direkta, affärsdrivande kraftförsörjningsverksamhet. Rationaliseringen antages kunna bli genomförd under en period av femton å tjugo år.

Ovannämnda statliga verksamhet bör omhänderhas av ett nybildat cen- tralorgan, statens elnämnd, med en underorganisation för tillsynsverksam- heten, nuvarande statens elektriska inspektion, samt en nybildad under- organisation för det lokala rationaliserings— och rådgivningsarbetet m. m., statens elingenjörsorganisation. Elnämnden bör övertaga verksamheten från kommerskollegii elektriska byrå, elektrifieringsberedningen och prisregle- ringsnämnden för elektrisk ström med de ändringar i dessa organs nuvaran- de arbetsuppgifter samt de tillkommande arbetsuppgifter, som betingas bl.a. av rationaliseringsarbetet. Elnämndsorganisationen bör erhålla en storlek och sammansättning, som successivt anpassas till arbetet under ra- tionaliseringsperioden och sedermera, efter rationaliseringens genomförande, till den kvarvarande, kontinuerliga verksamheten.

Koncessionsbestämmelserna för elektriska ledningar enligt lagen den 27 juni 1902 föreslås bli ändrade så att bl. a. områdeskoncession kan meddelas i väsentligt större utsträckning än för närvarande. Områdeskoncession bör sålunda i princip meddelas för byggande och drivande av närdistribu- tionsnät (s. 377) medan för ledningar tillhörande nät av högre ordning bör meddelas linjekon'cession. För behandlingen av koncessionsärenden föreslås en del förenklingar, vilka leda till i olika avseenden ökad frihet men sam- tidigt ökat ansvar för kraftföretagen samt ökade möjligheter för staten att övervaka kraftförsörjningens ändamålsenliga ordnande. Vid koncessions- prövningen bör även den koncessionssökandes lämplighet att bedriva distri- bution av elkraft prövas.

Koncessionsmyndighet skall vara Kungl. Maj:t och, enligt Kungl. Maj:ts bemyndigande, elnämnden.

För att ernå en planmässig och på rimlig tid genomförd omorganisation av distributionen föreslås bestämmelser, som medge hävande av koncession när synnerlig anledning härtill föreligger, inskränkning av den »kommu- nala vetorätten» enligt 1902 års lag samt bestämmelser om hinder för överlåtelse utan särskilt tillstånd av distributionsnät.

Kraftföretag, som erhåller koncession för ledningar avsedda för distribu- tion till allmänheten eller eljest för allmännyttiga ändamål, bör ha skyl- dighet att på skäliga villkor tillhandahålla elkraft för normala sådana ända— mål (distributionsskyldighel), exempelvis inom det område för vilket om- rådeskoncession erhålles. Distributionsskyldigheten innefattar bl. a. en all- män förpliktelse att upprätthålla en säväl områdes— som i varje punkt be- hovsmässigt tillfredsställande elektrifiering och att underkasta sig en pris— reglering, som avser alla avgifter och villkor som sammanhänga med leve- ransen. Det förutsättes att distributionsföretagen tillämpa moderna, utveck- lingsfrämjande tariffer med, så långt det är möjligt och skäligt, enhetliga priser.

Prisregleringen bör utsträckas till att omfatta även taxor, som fastställas av kommunal myndighet, liksom den även avser statens taxor.

För den statliga tillsynsverksamheten föreslås en del ändringar, grun- dade på att efter omorganisationen företagen skola ledas av kvalificerad personal, på vilken ett ökat ansvar även beträffande nätens tillsyn kan läggas. Behovet av statlig tillsyn, som under nuvarande förhållanden icke kan anses vara tillgodosett, kan därigenom successivt minska.

Ekonomiskt stöd till distributionsföretagen för dyrbara nyelektrifieringar bör kunna utgå liksom hittills men det framhålles, att en omprövning av bidragsgrunderna bör verkställas. Sålunda bör övervägas en utvidgning av behovsprövningen till att avse företagens behov av stöd med hänsyn till sin totala distributionsverksamhet. Det bör också övervägas huruvida stödet i första hand bör lämnas i form av lån, som till erforderlig del lämnas ränte— fritt.

För upprustning av distributionsnät bör efter behovsprövning ekonomiskt stöd kunna utgå, i första hand i form av lån, som till erforderlig del lämnas räntefritt, men där så är erforderligt även i form av bidrag.

Bestämmelserna för kraftledningslånefonden föreslås bli ändrade i vissa avseenden, så att möjligheterna att lämna distributionsföretagen statliga räntebärande lån skola förbättras. En översyn av lagen den 22 juni 1920 om registrering av elektriska anläggningar m. m. erfordras.

Elkraftutredningen föreslår att för finansiering av det erforderliga stödet för nätupprustningar samt elkraftförsörjningens rationalisering i övrigt skall uttagas en accis på producerad och importerad elkraft av högst 0,1 öre per kilowattimme. Nyelektrifieringsstödet förutsättes utgå av statsmedel liksom hittills. Av elnämndsorganisationen föreslås att den del, som i huvud- sak erfordras för rationaliseringsverksamheten, skall finansieras med accis- medel medan organisationen i övrigt finansieras med statsmedel liksom statens nuvarande, övervakande organ på kraftförsörjningens område. Det förutsättes att den nuvarande, tillfälliga elskatten icke vidare skall utgå.

De förslag som i övrigt framläggas i betänkandet äro i korthet följande. De hinder mot att skyndsamt kunna genomföra önskvärda vattenkraft— utbyggnader, som kunna bero av ett alltför omständligt och tidsödande domstolsförfarande eller otillräcklig domstolsorganisation, böra i största möjliga mån undanröjas.

Ensamrätten för staten att bygga stamlinjer bör ej innebära hinder för annan att själv bygga och driva ledning för 200 kV eller högre spänning, när ledningen erfordras för överföring enbart av hans eget kraftbehov och ledningen ej kan tänkas komma att ingå som del i det samkörande stam- linjenätet. Kungörelsen av den 2 juni 1939 angående installatörsbehörighet bör överses, bl. a. i avseende på kompetensbestämmelserna.

De av Svenska elverksföreningen år 1948 framlagda normalhestämmel- serna i fråga om kostnadsfördelningen vid ändring av strömart och spänning i distributionsnät ha utredningen funnit skäliga och i allt väsentligt lämp-

liga. De böra tillämpas i normala fall vid omläggning av distributions— system icke blott i städer och andra tätorter utan även på landsbygden.

Frågan om ersättning till markägare för intrång genom elektrisk led- ningsdragning och därmed sammanhängande problem böra undersökas sär- skilt.

Vissa elkraftfrågor av särskild betydelse för Norrland synas motiverade att närmare behandla, nämligen frågan om företrädesrätt för Norrland till den där producerade vattenkraften vilken närmast får anses vara en prisfråga samt frågan om skadeverkningarna vid vattenkraftens tillgodo- görande. Behandlingen av den sistnämnda frågan bör utföras skyndsamt.

Författningsutkast

Utkast, till lag om ändring i lagen den 27 juni 1902 innefattande vissa be- stämmelser om elektriska anläggningar

Härigenom förordnas att 1——3 åå lagen den 27 juni 1902 innefattande vissa bestämmelser om elektriska anläggningar skola erhålla ändrad lydelse på sätt nedan angives.

1 5.

Har, för —— _ ej erforderligt.

Menighet vare ej pliktig att inom område, för vilket finnes stadsplan eller byggnadsplan, eller inom fastställt hamnområde avstå eller upplåta gata, torg, allmän plats eller vattendrag, därest icke detta erfordras för el— ! kraftförsörjningens ändamålsenliga ordnande eller eljest synnerliga skäl

föreligga. Ej heller _ den föreslagna. Skall enligt _ —— — för starkströmsledning.

2 5.

1. mom. För framdragande och nyttjande av elektrisk starkströmsled- ning, som ej till hela sin sträckning faller inom byggnad eller inhägnad gård, skall ledningens innehavare söka tillstånd (koncession) av Kungl. Maj:t eller den Kungl. Maj:t bemyndigar (koncessionsmyndighet). Konces— sion medför rätt att framdraga och nyttja antingen ledning med i huvudsak bestämd sträckning (linjekoncession) eller ledningar av bestämda slag inom fastställt område (områdeskoncession).

Vid prövning av ansökan om linjekoncession skall hänsyn tagas till huru- vida behov av anläggningen förefinnes samt huruvida denna kan anses för- enlig med en planmässig elektrifiering. Linjekoncession må ej meddelas för ledning, som bör innefattas i områdeskoncession.

Vid prövning av ansökan om områdeskoncession skall hänsyn tagas till områdets lämplighet såsom enhet för verksamhet avseende direkt distribu- tion av elektrisk kraft till allmänheten.

Områdeskoncession ävensom linjekoncession avseende ledningar för all- män distribution må meddelas allenast anläggningsinnehavare, vilken prövas lämplig bedriva verksamhet för allmän distribution av elektrisk kraft.

Områdeskoncession medför rätt för koncessionshavaren att, utan sådan prövning som i andra stycket sägs, inom det fastställda området framdraga och nyttja lågspänningsledningar och ortsledningar på landsbygden samt motsvarande lokala ledningar i städer och samhällen.

Koncession meddelas att gälla under viss tid, ej överstigande fyrtio eller, om särskilda skäl därtill föranleda, sextio år.

I koncessionen skall föreskrivas, under förbehåll av allmän och enskild rätt, på vilket sätt och under vilka villkor den tillåtna ledningen eller, vid områdeskoncession, medgivna slag av ledningar inom det fastställda områ- det må framdragas och nyttjas.

2. mom. Den som erhållit områdeskoncession är, därest icke särskilda skäl till undantag prövas föreligga, skyldig att inom det fastställda området på skäliga villkor tillhandahålla elektrisk kraft för normala förbruknings- ändamål åt envar, som erhållit anslutning eller därom gör skriftlig fram— ställning. Den som erhållit linjekoncession må efter särskild prövning åläggas skyldighet att på skäliga villkor tillhandahålla elektrisk kraft eller upplåta sin anläggning för kraftöverföring till annan, i den mån detta finnes erforderligt för fullgörande av områdeskoncessionshavares distributions- skyldighet eller för leverans till sådan industri eller annan förbrukare, vilkens verksamhet finnes vara av större betydelse för det allmänna.

Den som erhållit områdeskoncession eller linjekoncession med skyldighet som i första stycket sägs är pliktig att hålla distributionsanläggningen i sådant skick, att den fyller skäliga krav på driftsäkerhet och belastnings— barhet, ävensom att i förekommande fall underkasta sig reglering av pris och villkor i övrigt för tillhandahållande av elektrisk kraft.

Innehar koncessionshavare starkströmsanläggning allenast med nyttjan- derätt, skall anläggningens ägare för de förpliktelser, som jämlikt detta moment åligga innehavaren, vara ansvarig lika med innehavaren, dock ej lned annan egendom än anläggningen och vad därtill hör samt under nytt- janderätten inbegripes.

Prövning av fråga om fullgörande av i detta moment stadgade skyldighe— ter verkställes av koncessionsmyndigheten. Avtal, stridande mot myndighe— tens beslut, vare utan verkan.

3. mom. Koncession kan av koncessionsmyndigheten helt eller delvis upp- hävas a) vid svåra eller upprepade överträdelser av bestämmelserna i denna lag eller med stöd av densamma givna föreskrifter,

b) vid underlåtenhet att begagna meddelad koncession,

c) när synnerlig anledning därtill förekommer med hänsyn till kraftförsörj- ningens ändamålsenliga ordnande.

4 mom. Den som utan vederbörligt tillstånd eller i strid mot de vid med- delande av tillstånd givna föreskrifterna nyttjar anläggning som i denna paragraf avses, straffes med dagsböter, där ej förseelsen är belagd med straff enligt allmän strafflag.

3 å. Ansökan om rätt att för elektrisk starkströmsanläggning påfordra av- stående eller upplåtande av fastighet skall vara åtföljd av fullständig be-

skrivning över det tillämnade företaget med kostnadsförslag, avfattning på karta av föreslagen lednings sträckning och av den jord, som för anlägg- ningen erfordras, bestyrkta förteckningar på dels ägare och innehavare av de fastigheter, över vilka ledningen skall framdragas eller i vilkas mark den skall nedläggas eller som eljest äro för anläggningen behövliga, dels ock, såvitt ledningen skall framgå ovan jordytan, ägare och innehavare * av de fastigheter, som, utan att ledningen skall över dem framdragas, äro ' belägna på mindre avstånd än tjugo meter från densamma, uppgift på de överenskommelser, som blivit träffade, eller de hinder, vilka däremot mött, med flera handlingar, som sökanden vill åberopa; dock att där fråga är om ledning, som skall framdragas inom område, för vilket finnes stads- plan eller byggnadsplan, förteckning, som nyss sagts, erfordras allenast såvitt angår fastigheter, över vilka ledningen skall framgå eller i vilkas mark den skall nedläggas.

Ansökan om linjekoncession skall vara åtföljd av a) beskrivning över det tillämnade företaget med kostnadsförslag och av- fattning å karta över föreslagen lednings sträckning,

b) uppgift om de i första stycket angivna rättsägare, med vilka överens- kommelse icke kunnat träffas, om de hinder som därför mött, om de led- ningssträckor som därav beröras samt om vidtagna åtgärder för att undan- röja nämnda hinder, c) de uppgifter i övrigt rörande anläggningen och dess ändamål, som sö— kanden vill åberopa.

Ansökan om områdeskoncession skall vara åtföljd av a) karta över ett till gränserna utmärkt område, inom vilket sökanden inne- har och avser att vidare utbygga lågspänningsledningar eller ortsledningar på landsbygden eller motsvarande lokala ledningar i stad eller samhälle för verksamhet avseende direkt distribution av elektrisk kraft till allmän- heten,

b) plan för områdets framtida försörjning med elektrisk kraft, 0) uppgift om spänning och strömart beträffande befintliga och tillämnade ledningar.

Å kartan skall tillika särskilt utmärkas dels inom området befintliga lokala ledningar, som under a) sägs, jämte dem matande ledningar och stationer, dels huvudsaklig sträckning av högspänningsledningar, som er- fordras enligt den under b) angivna planen.

Finnes ej ansökan genast böra avslås, lämnas åt de kommuner eller muni— cipalsamhällen, inom vilkas områden ledning skall framdragas eller anlägg- ning eljest utföras, så ock åt de ägare och innehavare av fastigheter, som enligt vad ovan nämnts skola uppgivas, tillfälle att yttra sig över ansök— ningen och infordras i övrigt de ytterligare upplysningar, som för ärendets bedömande må erfordras.

Vad ovan stadgats om skyldighet att förete karta över jord, som för elekt-

risk anläggning erfordras, samt vissa förteckningar och uppgifter, så ock där— om att tillfälle att yttra sig över gjord ansökan skall lämnas vissa menig- heter samt ägare och innehavare av fastigheter, gälle ej beträffande an— sökan om tillstånd att utföra anläggning inom järnvägsområde.

Övergångsbestämmelser

1 mom. Denna lag träder i kraft den 1 januari 1956. Förekommer i lag eller författning hänvisning till lagrum, som ersatts genom bestämmelse i nya lagen, skall den bestämmelsen i stället tillämpas.

2 mom. Den som vid lagens ikraftträdande är innehavare av sådana lokala starkströmsledningar för allmän distribution, som avses i 2 5 1 mom. femte stycket nya lagen, vare icke skyldig söka områdeskoncession enligt nya lagen förrän detta av koncessionsmyndigheten påkallas.

3. mom. Intill dess områdeskoncession meddelats enligt nya lagen skall tillstånd att framdraga och nyttja starkströmsledning, som bort innefattas i områdeskoncessionen, meddelas i den för linjekoncession stadgade ord— ningen.

För bibehållande och nyttjande av vid lagens ikraftträdande i bruk va- rande starkströmsledning som nu sagts, beträffande vilken tillstånd icke er- fordrats enligt förut gällande lag, må med tillstånd anstå intill dess områ- deskoncession meddelas.

4 mom. För innehavare av starkströmsledningar, vilka enligt nya lagen borde innefattas i områdeskoncession, skola, intill dess områdeskoncession meddelats, i 2 5 2 mom. nya lagen stadgade förpliktelser gälla det område, som skäligen hör försörjas med elektrisk kraft från sagda ledningar.

5 mom. Innehavare av ledningar, som i 3 och 4 inom. sägs, må efter kon- cessionsmyndighetens bedömande i stället för förut gällande tillstånd med- delas områdeskoncession enligt nya lagen.

6 mom. För innehavare av vid lagens ikraftträdande i bruk varande stark— strömsledning, beträffande vilken tillstånd icke erfordrats enligt förut gäl- lande lag men linjekoncession erfordras enligt nya lagen, skall, efter an- mälan som i 9 mom. sägs, linjekoncession meddelas utan sådan prövning, som i 2 5 1 mom. andra och fjärde styckena nya lagen sägs.

7 mom. Innehavare av enligt nya lagen linjekoncessionspliktig, vid lagens ikraftträdande i bruk varande starkströmsledning skall, ändå att tillstånd för ledningen icke erfordrats enligt äldre lag, vara underkastad i 2 5 2 mom. nya lagen stadgade förpliktelser, såvida ej koncessionsmyndigheten på ansökan finner skäl medgiva undantag.

8 mom. För de förpliktelser, som enligt 4 och 7 inom. åligga innehavare av starkströmsanläggning, vare, där anläggningen ägs av annan än inne- havaren, ägaren ansvarig lika med innehavaren, dock ej med annan egen— dom än anläggningen och vad därtill hör samt under nyttjanderätten in- begripes.

9 mom. Den som vid lagens ikraftträdande är innehavare av enligt nya lagen koncessionspliktig högspänningsledning utan att äga för honom själv utfärdat tillstånd till ledningens framdragande skall inom ett år efter lagens ikraftträdande till koncessionsmyndigheten härom ingiva anmälan. Närmare bestämmelser om anmälningsskyldighet utfärdas av Kungl. Maj:t.

Utkast till kungörelse om ändring i stadgan den 5 maj 1939 om elektriska starkströmsanläggningar

1

stadgan den 5 maj 1939 om elektriska starkströmsanläggningar skola er- hålla följande ändrade lydelse, att 3 och 11 55 skola upphävas samt att i samma stadga två nya paragrafer skola införas, betecknade 9a % och 9b 5, av nedan angivna innehåll.

Härigenom förordnas att 1, 2, 4 5, 6—9, 14—18, 21, 22, 24, 25, 27 och 28 55

Inledande bestämmelser

1 5. Med starkströmsanläggningar —— — _ 250 volt. Det ankommer på statens elnämnd att utfärda närmare föreskrifter rö— rande starkströmsanläggningars utförande och skötsel. Angående utförande _ _ —— varder föreskrivet.

Om anmälningsskyldighet

2 5.

Vill någon med stöd av områdeskoncession framdraga starkströmsledning för högspänning, skall han göra anmälan därom till eln-ämnden. Vid anmä- lan skall fogas karta utvisande ledningens sträckning och läget av till led- ningen hörande transformatorstationer samt teknisk beskrivning över an- läggningen.

Närmare föreskrifter om anmälningsskyldighetens fullgörande må med- delas au elnämnden.

3 %.

Upphäves.

4 %.

Innehavare av koncessionspliktig starkströmsanläggning är pliktig att till elnämnden utan dröjsmål anmäla vid anläggningen inträffat olycksfall på grund av elektrisk ström ävensom sådan driftstörning, som kan hava väsentlig betydelse för den allmänna säkerheten.

Innehavare av starkströmsanläggning för direkt distribution av elektrisk ström till allmänheten är tillika pliktig att till elnämnden utan dröjsmål anmäla sådant till hans kännedom kommet olycksfall på grund av elektrisk ström, vilket inträffat år till anläggningen ansluten ahonnentanläggning.

Innehavare av koncessionspliktig starkströmsanläggning är pliktig att till elnämnden på anfordran ingiva uppgifter av teknisk och ekonomisk art, som elnämnden kan finna erforderliga för avgörande av frågor angående distributionsskyldighet.

Om starkströmsledning inom område för allmän väg 5 5.

Framdrages starkströmsledning ——- _ till efterrättelse.

1. Förlägges ledningen i luften skall den uppläggas å stolpar eller annat stöd av nödig hållfasthet. Stöden jämte tillhörande stag eller strävor få icke anbringas på körbana, cykel- eller gångbana eller på till vägen hörande vägren eller skyddsbankett samt ej heller så, att avrinning i vägdike eller snöröjning försvåras. I övrigt skall härom gälla vad elnämnden efter hö- rande av väg- och vattenbyggnadsstyrelsen bestämmer.

Ledningen skall — — — vägbanan erhålles.

Till förekommande av fara i följd av ledningsbrott, isolatorskada m. m. skola särskilda skyddsåtgärder i form av fångarmar, förstärkt utförande eller dylikt vidtagas på sätt av elnämnden bestämmes.

2. Förlägges ledningen — — — upprensat skick. Är ledningens — angivande läget.

3. Vid ledningens — — — förekommande vägunderhållsarbete. 4. Ledningens innehavare —— — —— må föranledas.

5. Behöver ledningens —— —— dennas innehavare.

6. Vid framdragande av starkströmsledningar för lågspänning skall efter- strävas, att antalet korsningsställen med allmän väg blir det minsta möjliga.

Om starkströmsledning inom område för vattentrafikled 6 &.

Framdrages starkströmsledning —— —— —— till efterrättelse.

1. Förlägges ledningen i luften över vattentrafikled, skall, där ej i sam- manhang med beviljande av koncession särskild föreskrift meddelas om led- ningens höjd över vattenytan, ledningen förläggas så högt, att den ej utgör hinder för den på platsen i allmänhet förekommande trafiken. På lämplig plats i närheten av korsningsstället skola uppsättas tydliga varningstavlor med uppgift om segelfri höjd under ledningen, såvida icke befrielse härifrån medgives av elnämnden efter hörande av Iotsstgrelsen.

Därest trafikleden —— _ finna erforderlig.

I övrigt skall ledningen vara anordnad i enlighet med vad elnämnden efter hörande av lotsstyrelsen bestämmer.

2. Förlägges ledningen under vattentrafikled, skall ledningen nedläggas i trafikledens botten på sådant sätt, att den ej blir till hinder för sjöfarten. Vid ledningens landningsplatser skola tydliga varningstavlor uppsättas. Där så av Iotsstgrelsen finnes påkallat skola ensmärken och ensfyrar an-

ordnas till utmärkande av ledningens sträckning samt förbud utverkas mot ankring inom lämpligt avstånd från ledningen.

Ledningens innehavare är skyldig att senast i samband med ledningens anordnande till sjökarteverket insända karta utvisande ledningens sträck- ning inom vattenområdet samt, då fråga är om luftledning, uppgift om lägsta segelfria höjden under ledningen.

3. Behöver till _ _ _ dess försorg.

4. Vid framdragande av starkströmsledningar för lågspänning skall efter- strävas, att antalet korsningsställen med vattentrafikled blir det minsta

' möjliga. Om starkströmsledning "inom område för järnväg . 7 5. ' Framdrages starkströmsledning _ _ _ till efterrättelse. 1. Förlägges ledningen _ _ spåren erhålles. Ledningsstöd och ledningstrådar skola hava sådan hållfasthet och vara försedda med sådana särskilda skyddsanordningar, som elnämnden före- ; skriver.

2. Förlägges ledningen _ _ _ lämpligen medgiva. Förlägges ledningen _ _ _ under jordytan. Förlägges ledningen — _ _ upprensat skick. Är ledningens — _ _ vid banvallen.

3. Ledningens innehavare _ _ _ banans längdriktning. Därest dubbelspår _ _ _ därav betingas. Stolparna å _ _ _ banbefälets anvisningar.

4. Jämväl andra _ _ _ ofördröjligen vidtagas.

5 Innan arbete _ _ _ av banbefälet.

6. Sådana arbeten _ _ _ ledningens innehavare. 7 Ledningens innehavare _ _ _ eller underhåll.

8. Vid framdragande av starkströmsledningar för lågpänning skall efter- strävas, att antalet korsningsställen med järnväg blir det minsta möjliga.

Om starkströmslednings anordnande i förhållande till svagströmsledningar 8 5.

1. Framdrages starkströmsledning så att den korsar eller på annat sätt kommer i farlig närhet av förut befintlig ledning för svagström, skola de skyddsåtgärder vidtagas, som föreskrivas av elnämnden. Kostnaderna för skyddsanordnings vidtagande och underhåll skola bäras av starkströmsled- i ningens innehavare.

l 2. Framdrages starkströmsledning _ _ _ till efterrättelse. Starkströmsledningens innehavare _ _ _ för enkelstolpslinje. Härvid iakttages _ _ _ övriga järnvägar. Vid ombyggnad _ _ _ sitt medgivande.

3. Vid framdragande av starkströmsledningar för lågspänning skall efter- strävas, att antalet korsningsställen med svagströmsledningar blir det minsta möjliga.

Om starkströmsledningar inom bebyggt område 9 5.

1. Framdrages blank _ _ — spänning däröver. .

Om byggnad är högre än närliggande lednings lägst belägna ledare, skall ledningens avstånd från byggnaden ökas enligt närmare bestämmande av elnämnden.

Ledningens höjd _ _ _ högre spänning.

Vad ovan i detta moment stadgas skall icke äga tillämpning på kontakt- ledning för elektrisk järnväg, spårväg eller trådbuss.

I detta _ _ _ som helst.

I övrigt skola vid starkströmslednings framdragande inom område, som i detta moment avses, de särskilda säkerhetsåtgärder vidtagas, som av el- nämnden föreskrivas.

Elnämnden må, när skäl därtill äro, meddela eftergift från de i detta mo- ment lämnade föreskrifterna.

2. Är eller blir stadsplan eller byggnadsplan fastställd för område, inom vilket starkströmsledning framdragits skall ledningens innehavare vara skyldig vidtaga de förändringar av ledningen, däri inbegripet dess förläg— gande i marken, som elnämnden kan finna ur säkerhetssynpunkt erforder- liga med hänsyn till områdets bebyggande.

9a &.

Starkströmsledning för högspänning må icke inom område, för vilket ej finnes stadsplan eller byggnadsplan, framdragas ovan jordytan på mindre avstånd än tjugo meter från annan tillhörigt boningshus eller annan vid gård uppförd byggnad eller tomtplats eller trädgård därest byggnadens, tomtplatsens eller trädgårdens ägare motsätter sig detta, utan så är, att annan sträckning, som utan synnerlig olägenhet för anläggaren kan använ- das, av elnämnden prövas medföra minst lika stort men som den föreslagna.

Om starkströmsledning vid flygfält % &.

Starkströmsledning må ej, utan flygfältsinnehavarens medgivande fram— dragas ovan jordytan på mindre avstånd än 2 500 meter från den i vederbör- lig ordning bestämda mittpunkten av staten tillhörigt eller till allmänt bruk godkänt flygfält.

Driftbestämmelser

11 &. Upphäves.

14 5.

Tillsyn över starkströmsanläggningar utövas av befattningshavare hos eI- nämnden och densamma underställda organ. 15 5.

(Första stycket utgår).

Koncessionspliktig starkströmsanläggning må ej tagas i bruk förrän den blivit avsynad och godkänd av särskilt förordnad tillsyningsman hos el- nämnden eller denne eljest funnit hinder ur säkerhetssynpunkt icke före- ligga mot anläggningens brukande.

(Tredje stycket utgår).

16 5.

Vid avsyning skall tillses, att för starkströmsanläggningar i denna stadga eller av elnämnden meddelade föreskrifter så ock de särskilda föreskrifter, som kunna hava blivit beträffande anläggningen i fråga givna, äro vid dess utförande iakttagna, ävensom att anläggningen i övrigt är anordnad på ett betryggande sätt.

17 5.

Sedan koncessionspliktig starkströmsanläggning tagits i bruk har tillsy- ningsman att besiktiga densamma, så ofta elnämnden därom förordnar eller tillsyningsman finner det erforderligt. Besiktning skall ock ske, då sådant hos elnämnden eller tillsyningsman påkallas av väg— och vattenbyggnads— styrelsen, järnvägsstyrelsen, telestyrelsen eller vederbörande länsstyrelse.

Sker besiktning _ _ _ därvid närvara. Därest tillsyningsmannen _ _ _ å anläggningen. Tillsyningsman meddelar _ _ —- blivit vidtagen.

Anmäles hos elnämnden, att fara uppstått i följd av anläggningens drift. äger nämnden där sådant finnes nödigt, förordna, att anläggningen skall sättas ur bruk intill dess besiktning, varom i denna paragraf är sagt, kan företagas.

18 å.

Icke koncessionspliktig starkströmsanläggning må besiktigas i den om- fattning elnämnden eller tillsyningsman, finner erforderligt och gäller där- vid vad i 17 5 angående besiktning och anläggnings sättande ur bruk är stadgat.

Elnämnden må därjämte, när särskilda skäl föreligga, ålägga innehavare av sådan starkströmsanläggning att på egen bekostnad låta besiktiga an- läggningen genom annan fackman, som kan av elnämnden godkännas. El- nämnden må meddela de säkerhetsföreskrifter rörande anläggningen, var- till besiktningen må giva anledning.

. 21 %. Där tillsyningsman _ _ _ myndighet ankomma.

Finner tillsyningsman, att anordning blivit vidtagen, som ej överensstäm- mer med av elnämnden meddelade säkerhetsföreskrifter men som likväl kan anses fullt betryggande, äger tillsyningsmannen hos elnämnden föreslå att anordningen i fråga må godkännas.

22 &. Tillsyningsman må ej för egen eller annans räkning driva eller hava del i eller anställning vid företag, som är underkastat tillsyn enligt denna stadga eller som avser tillverkning av materiel för starkströmsanläggningar, och ej heller, därest icke sådant av elnämnden medgives eller författningsenligt tillkommer honom, för dylikt företag åtaga sig uppdrag mot ersättning.

24 %.

Mot beslut av tillsyningsman må den, som därmed är missnöjd, föra talan genom besvär hos elnämnden inom trettio dagar från det han av beslutet erhållit del.

Beslut att _ _ _ ordning beslutat.

Särskilda bestämmelser 25 å.

Innehavare av koncessionspliktig starkströmsanläggning skall vara skyl— dig att, utöver vad i koncessionen särskilt föreskrives, iakttaga de allmänna bestämmelser i fråga om leverans av elektrisk kraft från sådan anläggning, ävensom i fråga om motverkande av störningar å radiomottagningsanlägg— ning, vilka kunna bliva i laga ordning meddelade.

Ansvarsbestämmelser 27 5.

Den, som icke ställer sig till efterrättelse bestämmelserna i denna stadga eller av elnämnden eller tillsyningsman med stöd av densamma meddelade föreskrifter, straffes med dagsböter, där ej förseelsen är belagd med straff enligt allmän strafflag eller särskild påföljd i stadgan angivits.

28 5.

Allmän åklagare skall tala å förseelse, som avses i 27 &, ändå att angivelse därom ej skett. Han är ock pliktig utföra åtal å dylik förseelse, som hos honom av elnämnden eller tillsyningsman angives.

Åtal utföres _ _ — allmän domstol.

Utkast till lag om accis på elektrisk kraft Härigenom förordnas som följer.

1 5. För elektrisk kraft, som framställes inom riket i kraftstation, i vilken vid generatorspänning uttages minst 500 000 kilowattimmar under året, även-

som för elektrisk kraft, som till samma myckenhet överföres hit från annat land, skall till den i 3 &] angivna fonden inbetalas en avgift (elaccis) i enlig- het med bestämmelserna i denna förordning. Elaccisen skall gäldas av kraft— producenten eller, då fråga är om importerad kraft, av importören.

2 &. Därest enligt gällande avtal producent eller importör är förhindrad att hos kraftavnämare uttaga vad han måst utgiva i elaccis, må koncessionsmyndig- heten på framställning, utan hinder av avtalet, i erforderlig mån reglera priset. 3 5.

Elaccis skall utgå med det belopp som Kungl. Maj:t bestämmer, högst 0,1 öre för varje vid generatorspänning framställd respektive importerad kilo- wattimmc.

Elaccisen skall inbetalas till en särskild fond, elnätsfonden, som skall för- valtas av statens elnämnd. Fondmedlen skola användas, förutom till täck- ning av statens elnämndsorganisations kostnader för elkraftförsörjningens rationalisering, till att genom räntefria lån och bidrag åt elektriska distribu- tionsföretag medverka till en ändamålsenlig försörjning med elektrisk kraft till skäligt pris.

Närmare bestämmelser om lån och bidrag från elnätsfonden meddelas av Kungl. Maj:t.

4 %.

Kontrollen över elaccisens behöriga utgörande utövas av elnämnden. Kungl. Maj:t eller, efter Kungl. Maj:ts bemyndigande, elnämnden äger medgiva de avvikelser för elaccisens utgörande, som med hänsyn till sär- skilda omständigheter må finnas påkallade, samt, då skäl därtill föreligga, medgiva befrielse från eller återbäring av elaccis.

5 5. Den som ämnar framställa eller importera elektrisk kraft, för vilken el— accis skall utgå, skall före rörelsens upptagande göra skriftlig anmälan där— om till elnämnden, med angivande av företagets namn och postadress. Vid anmälan skall härjämte angivas belägenheten av och den installerade gene- ratoreffekten för varje kraftverk, som nyttjas i rörelsen. Skall kraft impor— teras skall i anmälan uppgivas från vem kraften skall inköpas och till vilken myckenhet. Inträder ändring i förhållande, varom uppgift lämnats i anmälan, skall elnämnden underrättas därom inom fjorton dagar.

6 5. För kontrollen över elaccisens behöriga utgörande äger elnämnden anlita biträde av särskilda kontrolltjänstemän.

7 5.

Den som har att erlägga elaccis är pliktig att ordna sin mätning av kraf— ten och sin bokföring på sådant sätt, att den enligt elnämndens bedömande möjliggör kontroll av den kraftmängd, som skall ligga till grund för beräk- ning av elaccisen. Vid anfordran skall den accispliktige tillhandahålla el— nämnden eller kontrolltjänsteman sina handelshöcker och tillhörande hand- lingar samt andra erforderliga uppgifter.

8 5.

Accispliktig skall utan anmaning till elnämnden avlämna på tro och heder upprättad deklaration angående producerad eller importerad elektrisk kraft, för vilken elaccis skall utgå.

Deklaration, som här avses, skall avlämnas vid samma tid som deklara- tioner vid taxering för inkomst eller förmögenhet och avse samma räken- skapsår som dessa. Närmare föreskrifter angående deklarationer meddelas av Kungl. Maj:t.

' 9 5.

Underlåter deklarationsskyldig att avlämna föreskriven deklaration eller befinnes deklarationen oriktig, äger elnämnden fastställa den elaccis, som rätteligen skall utgå.

10 5.

Samtidigt med att deklaration avlämnas skall den accispliktige erlägga enligt deklarationen upplupen accis genom insättning på elnämndens post- girokonto.

I fall som avses i 9 & ankommer det på elnämnden att bestämma tid, inom vilken accisen skall erläggas.

Försummar accispliktig att inleverera accis enligt denna lag, må accisen på framställning av elnämnden omedelbart utmätas.

11 %.

Underlåter någon att fullgöra enligt 5 & föreskriven anmälan, straffes med dagsböter, ej under tjugo.

Underlåter någon i andra fall än som i 10 5 eller ovan i första stycket av- ses att fullgöra åtgärd, som åligger honom enligt denna förordning eller med stöd av densamma meddelade föreskrifter, straffes med böter, högst trehundra kronor.

12 &.

Elnämnden må vid vite förelägga producent eller importör av elektrisk kraft att fullgöra åtgärd, som åligger honom enligt denna lag eller med stöd av densamma meddelade föreskrifter, dock att föreläggande icke må avse erläggande eller inleverans till elnämnden av elaccis.

Om ansvar i vissa fall för den, som i deklaration lämnat oriktig uppgift, stadgas i skattestrafflagen.

Har någon i annat fall än i första stycket avses uppsåtligen eller av grov oaktsamhet i deklaration lämnat oriktig uppgift, ägnad att leda till inleve- rans av för låg elaccis, straffes med dagsböter eller fängelse i högst sex månader.

14 5.

Den, som har eller har haft att taga befattning med kontroll enligt denna lag, må ej i vidare mån än hans tjänsteutövning fordrar yppa affärsförhål— lande, varom han därvid erhållit kännedom. Tjänsteman som bryter häremot vare underkastad ansvar såsom för tjänstefel. Gör annan än tjänsteman sig skyldig till förseelse som nu sagts, straffes med dagsböter.

15 å. Polismyndighet åligger att på begäran tillhandagå elnämnden eller kon- trolltjänsteman med upplysning om person eller företag, som kan antagas producera eller importera elektrisk kraft.

16 5. Förseelse, som avses i 11 5, må av allmän åklagare åtalas allenast efter angivelse av elnämnden. Böter och viten, som utdömas enligt denna lag, tillfalla kronan.

17 5. Kungl. Maj:t äger utfärda föreskrifter, som erfordras för tillämp- ningen av denna lag.

Denna lag träder i kraft den 1 januari 1956. Härvid skall iakttagas att om i lagen avsedd produktion eller import av elektrisk kraft bedrives vid tiden för ikraftträdandet, skall den i 5 5 omför- mälda anmälan göras senast den 15 januari 1956.

Utkast till förordning angående lån och bidrag från elnätsfonden

Härigenom förordnas som följer.

1 5.

Från elnätsfonden, som förvaltas av statens elnämnd, må i den ordning och under de villkor nedan angivas elnämnden bevilja räntefritt lån och bidrag för anläggande av distributionsnät för elektrisk kraft, för upprust- ning, varmed menas förnyelse, omläggning eller förstärkning av sådant nät, samt för medverkan i övrigt till en ändamålsenlig försörjning med elektrisk kraft till skäligt pris.

Lån eller bidrag må beviljas företag med ändamål att bedriva allmän dist- ribution av elektrisk kraft, vilket prövas lämpligt bedriva sådan verksamhet eller eljest av elnämnden finnes vara i behov av ekonomiskt stöd i avvaktan på ytterligare åtgärder för kraftförsörjningens ändamålsenliga ordnande.

3 &.

Låne- och bidragsbelopp skall, där ej bestämmelserna i andra stycket av denna paragraf till annat föranleda, avvägas så att det stödsökande företa— get kan tillämpa skäligt elkraftpris. Grunder för bestämmande av detta pris fastställas i särskild ordning av Kungl. Maj:t.

Är lånets eller bidragets ändamål att möjliggöra upprustning av distribu— tionsnät, må vid bestämmande av låne- eller bidragsbeloppets storlek hän- syn tagas till de faktorer, som varit orsak till nätets bristfälliga tillstånd. Lån och bidrag gemensamt må, tillsammans med samtidigt beviljat statligt räntebärande lån, icke överstiga den verkliga anläggnings- och upprustnings- kostnaden, jämte de medel som erfordras för gäldande av företagets skulder.

4 5. Vid beviljandet av lån eller bidrag äger elnämnden meddela de särskilda villkor och föreskrifter, som kunna anses erforderliga för vinnande av de med lånet eller bidraget avsedda ändamålen.

5 5.

För lån skall ställas säkerhet, som elnämnden finner godtagbar. Utgöres erbjuden säkerhet av inteckning i stationsfastighet må sådan in- teckning, i avvaktan på registrering enligt lagen den 22 juni 1920 (nr 474) med vissa bestämmelser om registrering av elektriska anläggningar samt om rätt till elektrisk kraft m. m., godtagas på särskilda av elnämnden före- skrivna villkor.

Elnämnden äger att i förekommande fall på sökandens bekostnad anlita det biträde, som kan befinnas erforderligt för prövningen av den erbjudna säkerheten. Därest för beviljat lån icke inom två månader efter därom er- hållet föreläggande avlämnats säkerhet, som av elnämnden godkännes, skall rätten till lånets utbekommande anses förverkad.

6 5.

Ansökan om län eller bidrag skall ställas till elnämnden och innehålla uppgift om det sökta lånets eller bidragets storlek, det ändamål, vartill lånet eller bidraget är avsett att användas, och den säkerhet för lånet, sö- kanden erbjuder. Vid ansökan skola fogas:

a) registreringsbevis, stadgar. bolagsordning eller andra behörighetshand— lingar för det sökande företaget; b) uppgifter om företagets ekonomiska ställning, företagets tidigare finan-

siering, tillämpade tariffer samt antalet i distributionsrörelsen anställda eller eljest anlitade personer och deras fackliga kompetens; en av sakkunnig person upprättad plan jämte nödiga ledningskartor även- som kostnadsberäkning rörande den anläggning, för vilken lån eller bidrag sökes; d) räntabilitetsberäkning enligt elnämndens anvisning samt el bevis angående företagets tillgång till elektrisk kraft.

Elnämnden äger meddela de ytterligare föreskrifter, som kunna finnas erforderliga i fråga om ansökningens innehåll och avfattning.

7 5.

Över låne- eller bidragsansökan skall elnämnden inhämta utlåtande från vederbörande länsstyrelse samt, därest anläggningen är eller avses bli an- SIuten till statens vattenfallsverks kraftledningsnät, från vattenfallssty- relsen.

8 %.

Beviljat lån utlämnas av elnämnden, sedan låntagaren dit avlämnat god- tagbar skuldförbindelse jämte säkerhet för förbindelsens behöriga fullgö- rande och nämnden förvissat sig om att hinder i övrigt ej föreligger för länets utlämnande.

Bidrag utlämnas av elnämnden sedan nämnden förvissat sig om att hinder härför ej föreligger.

Låne— eller bidragsbelopp skall, då elnämnden finner det erforderligt, ut- betalas i särskilda poster efter nämndens bestämmande i den mån arbetet fortskrider och kostnaden därför styrkes.

9 %.

Lån skall, sedan det innehafts under två år från första lyftningsdagen, återbetalas under vart och ett av därpå följande högst tjugoåtta år med av elnämnden vid lånets beviljande föreskriven amortering, låntagaren dock obetaget att snabbare än föreskrivet amortera lånet. För belopp, som ej gäldas inom föreskriven tid, skall från förfallodagen, tills betalning sker, gäldas dröjsmålsränta enligt de grunder, som angivas i kungörelsen den 31 december 1943 (936).

10 %.

Därest genom ökad anslutning eller annan omständighet de för storleken av ett utlämnat län eller bidrag bestämmande förutsättningarna ändrats, så att det utlämnade lånet eller bidraget blivit större än som motsvarar det verkliga behovet beräknat enligt tilldelningsgrunderna,äger elnämnden före— skriva återhäring av det mot ifrågavarande kostnadsminskning svarande låne- eller bidragsbeloppet.

11 &.

Därest elnämnden under lånetiden skulle finna den ställda säkerheten icke vidare vara nöjaktig, skall låntagaren inom två månader efter därom

av nämnden erhållet föreläggande avlämna nya säkerhetshandlingar, som av nämnden kunna godtagas. 12 å.

Det åligger elnämnden att i den omfattning, som finnes erforderligt, om- besörja fortlöpande kontroll av de företag, till vilka län eller bidrag läm- nats. Lån- eller bidragstagaren skall vara skyldig underkasta sig dylik kon- troll samt årligen inom tid och på sätt elnämnden föreskriver till nämnden avgiva redogörelse för företagets drift och ekonomiska ställning.

13 å.

Elnämnden äger förklara att lån skall vara genast eller inom viss tid, helt eller delvis, förfallet till återbetalning eller att utlämnat bidrag skall återbäras, därest a) i fråga om lån låntagaren ej fullgör sina förpliktelser avseende amorte— ring eller säkerhet;

b) anläggningen icke drives eller underhålles på tillfredsställande sätt i en- lighet med de villkor, som uppställts vid lånets eller bidragets beviljande; c) lån- eller bidragstagaren genom oriktiga uppgifter föranlett lånets eller bidragets beviljande eller ock förfogat över låne- eller bidragsmedel för annat än stadgat ändamål;

d) Sådana förhållanden eljest inträtt, att lån— eller bidragstagaren med hänsyn till ändamålet med lånet ej längre bör få tillgodonjuta detsamma.

Utkast till kungörelse om ändring i bestämmelserna för

kraftledningslånefonden

Kungl. Maj:t har, med stöd av riksdagens beslut, funnit gott förordna, att kungl. kungörelsen den 13 september 1918 (nr 718) angående allmänna bestämmelser för lån från kraftledningslånefonden skall erhålla följande ändrade lydelse.

1 5.

Från kraftledningslånefonden, som förvaltas av statskontoret, må i den ordning och under de villkor nedan angivas statens elnämnd bevilja lån för anläggande av distributionsnät för elektrisk kraft, för upprustning, varmed menas förnyelse, omläggning eller förstärkning av sådant nät, samt för med- verkan i övrigt till en ändamålsenlig försörjning med elektrisk kraft till skäligt pris.

2 5.

Lån må beviljas företag med ändamål att bedriva allmän distribution av elektrisk kraft, vilket prövas lämpligt bedriva sådan verksamhet eller eljest av elnämnden finnes vara i behov av statligt lån i avvaktan på ytterligare åtgärder för kraftförsörjningens ändamålsenliga ordnande.

3 5. Län må ej beviljas till högre belopp, än som kan förräntas genom företa-

gets verksamhet med tillämpning av skäligt elkraftpris. Grunder för bestäm- mande av detta pris fastställas i särskild ordning av Kungl. Maj:t.

4 &.

Vid beviljandet av lån äger elnämnden meddela de särskilda villkor och föreskrifter, som kunna anses erforderliga för Vinnande av de med lånet avsedda ändamålen.

5 5.

För lån skall ställas säkerhet, som elnämnden finner godtagbar. Utgöres erbjuden säkerhet av inteckning i stationsfastighet må sådan in- teckning, i avvaktan på registrering enligt lagen den 22 juni 1920 (nr 474) med vissa bestämmelser om registrering av elektriska anläggningar samt om rätt till elektrisk kraft m. m., godtagas på särskilda av elnämnden före— skrivna villkor.

Elnämnden äger att i förekommande fall på sökandens bekostnad anlita det biträde, som kan befinnas erforderligt för prövningen av den erbjudna säkerheten. Därest för beviljat lån icke inom två månader efter därom erhållet föreläggande avlämnats säkerhet, som av elnämnden godkännes, skall rätten till lånets utbekommande anses förverkad.

6 5.

Ansökan om lån skall ställas till elnämnden och innehålla uppgift om det sökta lånets storlek, det ändamål, vartill lånet är avsett att användas, och den säkerhet för lånet, sökanden erbjuder. Vid ansökan skola fogas:

a) registreringsbevis, stadgar, bolagsordning eller andra behörighetshand- lingar för det lånesökande företaget;

b) uppgifter om företagets ekonomiska ställning, tillämpade tariffer samt antalet i distributionsrörelsen anställda eller eljest anlitade personer och deras fackliga kompetens;

c) av sakkunnig person upprättad plan jämte nödiga ledningskartor även- som kostnadsberäkning rörande den anläggning, för vilken lån sökes;

d) räntabilitetsberäkning enligt elnämndens anvisning samt

e) bevis angående företagets tillgång till elektrisk kraft.

Elnämnden äger meddela de ytterligare föreskrifter, som kunna finnas erforderliga i fråga om ansökningens innehåll och avfattning.

7 5.

Över låneansökan skall elnämnden inhämta utlåtande från vederbörande länsstyrelse samt, därest anläggningen är eller avses bli ansluten till statens vattenfallsverks kraftledningsnät, från vattenfallsstyrelsen.

8 &.

Statskontoret skall givas del av elnämndens beslut om beviljande av lån från fonden. .

Beviljat lån utlämnas av statskontoret sedan låntagaren dit avlämnat dels godtagbar skuldförbindelse jämte av elnämnden godkänd säkerhet för

förbindelsens behöriga fullgörande, dels ock av elnämnden utfärdat bevis att hinder i övrigt ej föreligger för länets utlämnande.

Lånebelopp skall, då elnämnden finner det erforderligt, utbetalas i sär- skilda poster efter nämndens bestämmande i den mån arbetet fortskrider och kostnaden därför styrkes.

9 &.

Å lyftat lånebelopp skall, intill dess lånet innehafts under två år från första lyftningsdagen, erläggas årlig ränta från lyftningsdagen med av Kungl. Maj:t för varje budgetår fastställd normalränta.

Lån skall, sedan det innehafts under två år från första lyftningsdagen, återbetalas under vart och ett av därpå följande högst tjugoåtta år med lika annuitet, därav såsom ränta räknas av Kungl. Maj:t för varje budgetår fast- ställd normalränta, utgörande lägst 4 procent å det oguldna kapitalbeloppet, låntagaren dock obetaget att före lånetidens utgång på en gång inbetala ogulden del av länet. För belopp, som ejgäldas inom föreskriven tid, skall från förfallodagen, tills betalning sker, gäldas dröjsmålsränta enligt de grun- der, som angivas i kungörelsen den 31 december 1943 (936).

10 %.

Därest statskontoret eller elnämnden under lånetiden skulle finna den ställda säkerheten icke vidare vara nöj aktig, skall låntagaren inom två må- nader efter därom erhållet föreläggande avlämna nya säkerhetshandlingar, som av elnämnden godkännas.

11 5.

Det åligger elnämnden att i den omfattning som finnes erforderligt ombe— sörja fortlöpande kontroll av de företag, till vilka lån lämnats, samt under- rätta statskontoret om vad därvid förekommit. Låntagaren skall vara skyl- dig underkasta sig dylik kontroll samt årligen inom tid och på sätt elnämn— den föreskriver till nämnden avgiva redogörelse för företagets drift och eko- nomiska ställning.

Elnämnden skall meddela statskontoret sådana av nämnden uppmärk- sammade förhållanden, som äro av beskaffenhet att höra föranleda åtgärder enligt 12 5.

12 å.

Statskontoret äger förklara lån vara genast eller inom viss tid, helt eller delvis, förfallet till återbetalning, därest a) låntagaren ej fullgör sina förpliktelser i fråga om räntelikvid, amorte- ring eller säkerhet;

b) anläggningen icke drives eller underhålles på tillfredsställande sätt i en— lighet med de villkor, som uppställts vid lånets beviljande;

c) låntagaren genom oriktiga uppgifter föranlett lånets beviljande eller ock förfogat över lånemedel för annat än stadgat ändamål;

d) sådana förhållanden eljest inträtt, att låntagaren, med hänsyn till ända- målet med lånet, ej längre bör få tillgodonjuta detsamma.

Ändringarna i lagen den 27 juni 1902 innefattande vissa bestämmelser om elektriska anläggningar

Elkraftutredningens förslag innebär i huvudsak, att distributör av elkraft i princip skall vara skyldig att tillgodose alla normala elkraftbehov inom ett givet distributionsområde och för detta ändamål hålla anläggningarna i gott stånd. I samband härmed föreslås en del ändringar beträffande koncessions- prövningen i syfte att säkerställa planmässighet vid utbyggnad särskilt av huvudledningar. Vidare avses med förslaget att möjliggöra, att distributions- företag skapas, som äro väl ägnade att svara för en ändamålsenlig elkraft- försörjning.

För att genomföra dessa förslag erfordras att delar av 1902 års lag om- arbetas. Lagen innehåller i huvudsak bestämmelser om expropriation (1 5), om koncession och prisreglering (2 €), om ansökningsförfarandet i expro- priations— och koncessionsärenden (3 5), om skadestånd (4—14 åå) samt om rätt för Kungl. Maj:t att utfärda erforderliga föreskrifter (15 5). De ändringar som elkraftutredningen föreslår hänföra sig till 1—3 55. Särskilt 2 & har genomgripande omarbetats. Bestämmelserna om skadestånd i 4—— 14 55 ha icke behandlats, enär elkraftutredningen icke anser att dessa om— fattas av utredningsuppdraget.

1 5.

Kommun är f. n. i princip ej pliktig att inom område med stadsplan eller byggnadsplan eller inom fastställt hamnområde avstå eller upplåta gata, torg, allmän plats eller vattendrag för framdragande av elektrisk stark- strömsledning. Denna s. k. kommunala vetorätt behandlas närmare i kap. 12 under rubriken »Kommunernas inflytande på elkraftförsörjningen» (s. 270 f276). Som där framhålles anser elkraftutredningen att vetorätten kan bli till hinder vid en framtida rationalisering av elkraftförsörjningen. Med stöd av den föreslagna nya lydelsen av 2 5 3 mom. i 1902 års lag kan kon- cession även för ett kommunalt företag tänkas bli upphävd, när synnerlig anledning därtill förekommer med hänsyn till kraftförsörjningens ända- målsenliga ordnande. Koncessionen kommer då att överföras på annat före- tag. För att detta företag skall kunna framdraga ledningar inom kommunen fordras att den kommunala vetorätten icke lägger hinder i vägen. Expropria- tionstillstånd skall därför enligt förslaget kunna meddelas mot kommunens bestridande, om det finnes erforderligt med hänsyn till elkraftförsörjningens ändamålsenliga ordnande.

Redan enligt nuvarande lag gäller undantag från vetorätten då >>synner- liga skäl» kunna åberopas. Då sådana skäl kunna föreligga, som ej ha direkt samband med kraftförsörjningens ändamålsenliga ordnande — exempelvis framdragande av en industriägd ledning —— är tillägget >>eller eljest synner— liga skäl föreligga» motiverat.

2 5 i 1902 års lag är f. n. uppdelad i sju moment. Bestämmelser finnas i 1—3 mom. om vilka elektriska ledningar som äro koncessionspliktiga, i 4 mom. om koncessionsprövningen, i 5 mom. om förhandstillstånd, i 6 mom. om prisreglering och i 7 mom. om straff för överträdelser av lagens be— stämmelser.

Paragrafen har enligt förslaget helt omredigerats och uppdelats i fyra moment, av vilka mom. 1 behandlar koncessionsskyldighetens föremål och omfattning, prövningsmyndighet, olika koncessionsformer, riktlinjer för prövningen, giltighetstid och föreskrivande av särskilda villkor för konces— sion. I 2 mom. upptagas de nya bestämmelserna om distributionsskyldighet, innefattande även prisreglering, i 3 mom. bestämmelser om hävande av kön— cession och i 4 mom. straffbestämmelser.

Elkraftutredningens förslag innebär bl. a., att principiellt alla stark- strömsanläggningar skola vara underkastade koncessionsplikt. Jordkablar liksom ledningar över egen eller frivilligt upplåten mark ha därför ej såsom nu undantagits. Å andra sidan anses det icke nödvändigt, att alla i nuvarande 1—3 mom. intagna speciella bestämmelser till skydd för enskild rätt (led— nings avstånd från boningshus m. m.) eller för allmänna intressen (led— nings framdragande inom trafikled eller i närheten av flygfält) inflyta i lagen. Dessa bestämmelser ha överförts till 1939 års stadga om elektriska starkströmsanläggningar. 1 mom. I utredningens förslag ha införts begreppen koncession, linjekon- cession och områdeskoncession. Oavsett om begreppet koncession rent veten— skapligt är fullt riktigt i detta sammanhang så är det dock vedertaget språk- bruk även officiellt. Genom att införa detta begrepp förenklas lagtexten. Begreppet starkströmsanläggning finnes definierat i 1939 års stadga.

Ehuru något oegentligt har koncessionen liksom f. n. knutits till led— ningen och ieke till anläggningen i dess helhet. Koncession erfordras alltså icke för exempelvis en transformatorstation. Av de undantag från konces— sionsskyldigheten, som finnas i nuvarande lag, har endast bibehållits un- dantaget för ledning, som till hela sin sträckning faller inom byggnad eller inhägnad gård. Koncessionsprövning av dylika ledningar anses icke erfor— derlig varken ur behovs- och planmässighetssynpunkt eller med hänsyn till säkerhetskraven.

Koncessionen skall enligt förslaget ej utfärdas för viss företagare »eller hans rättsinnehavare» utan endast för bestämd person eller bestämt före— tag, som är anläggningens innehavare. Denne anses principiellt såsom bärare av de rättigheter och skyldigheter, som koncessionen medför. Om alltså koncessionerad anläggning upplåtes med nyttjanderätt, kräves ny konces- sion för nyttjanderättshavaren. Hinder synes för sådant fall ej möta att även nya ledningar, som framdragas med stöd av koncession för nyttj ande- rättshavaren, tillhöra ägaren av anläggningen i övrigt.

Som koncessionsmyndighet har angivits Kungl. Maj:t eller den Kungl. Maj:t bemyndigar. Enligt elkraftutredningens förslag skall det stora fler- talet koncessionsärenden avgöras av det föreslagna organet statens elnämnd. I lagtexten har emellertid icke elnämnden omnämts bl. a. därför att den avses bli av provisorisk karaktär. Under alla förhållanden synas vissa ären- den liksom nu böra förbehållas Kungl. Maj:ts avgörande (jfr SFS 627/1950) och bemyndigande av elnämnden sker lämpligen i samband med blivande beslut om kompetensfördelningen mellan Kungl. Maj:t och nämnden.

Koncession kan meddelas som linjekoncession eller områdeskoncession. En närmare redogörelse för dessa olika slag av koncessioner finnes i be— tänkandets kap. 19 (s. 376—378). Som där framhålles kommer linjekonces- sion att erfordras huvudsakligen för stamledningar, landsledningar och bygdeledningar, men även för en del ledningar med lägre spänning, som icke omfattas av områdeskoncession.

Områdeskoncession skall meddelas för närdistributionsnät. Som i kap. 19 framhålles kunna dessa nät vara av högst varierande spänning beroende på om de exempelvis tillgodose ren landsbygd eller större städer. Närdistri- butionsnät har i lagtexten beskrivits såsom >>lågspänningsledningar och orts- ledningar på landsbygden samt motsvarande lokala ledningar i städer och samhällen». För dylika ledningar kan endast områdeskoncession meddelas och enligt den ändrade 3 & avviker ansökningsförfarandet från det, som till- lämpas för linjekoncessionen. Av redogörelsen 1 kap. 1 (s. 58) för över- föringssystemet framgår närmare, vilka ledningar som f. n. böra hänföras under begreppet ortsledning. Utvecklingen kan emellertid tänkas medföra förskjutningar av de spänningsvärden, som nu anses normala för överfö- ringssystemets olika delar. En närmare definition av de ledningar, som skola innefattas i områdeskoncession, kan därför knappast ges i lagtexten. Avsikten är att koncessionsmyndigheten i koncessionsbeslutet skall ange, vilka slag av ledningar och för vilken högsta spänning dessa få utföras med stöd av områdeskoncessionen.

Områdeskoncession skall endast meddelas för ett område, som befinnes lämpligt som enhet för detaljdistributionsverksamhet. Härför bör krävas att det utgör en lämplig förvaltningsenhet och att distributionsapparaten är eller kan bli tekniskt-ekonomiskt riktigt utbyggd. Hänsyn måste därvid även tagas till att grannområdena bli lämpliga.

Den som erhåller områdeskoncession har icke blott rätt utan även skyl- dighet att distribuera inom området. Leveransskyldighet kan åläggas även den som erhållit linjekoncession. Avser koncessionsansökan ledningar för allmän elkraftdistribution skall sökandens lämplighet att driva verksamhet för allmän distribution prövas. Prövningen bör ske med beaktande av kon- cessionssökandens tekniska, ekonomiska och organisatoriska förutsätt- ningar härför. (Se vidare kap. 19 s. 383—384).

Bestämmelsen att linjekoncession ej må meddelas för ledning, som bör

innefattas i områdeskoncession, har tillkommit för att hindra att en distri— butör söker undandraga sig distributionsskyldigheten genom att i ett visst fall begära linjekoncession i stället för områdeskoncession.

Rätten att utan koncessionsprövning framdraga ledningar inom områ—

det begränsas givetvis av hänsynen till markägares m. fl. motstående in— tressen, vilka vid områdeskoncession icke kunna beaktas i samband med koncessionsgivningen utan först i samband med utbyggandet. De regler som erfordras härför återfinnas i 1939 års stadga med däri av elkraftutred- ningen föreslagna ändringar. 2 mom. I detta moment behandlas bestämmelserna om koncessionshavares distributionsskyldighet, vilka utgöra en av de mest betydelsefulla nyheterna i elkraftutredningens förslag. I fråga om motiveringen hänvisas till vad som yttrats i kap. 19 s. 381—385.

Distributionsskyldighet åligger främst områdeskoneessionshavare för nor- mala förbrukningsobjekt inom området, dvs. sådana som det ur belastnings— synpunkt är tekniskt och ekonomiskt riktigt att ansluta till närdistribu— tionsnätet. En områdeskoncessionshavare har rätt men ej plikt att leverera till exempelvis en kraftslukande storindustri inom området.

För att innehavaren av områdeskoncession skall kunna fullgöra sin distri- butionsskyldighet fordras att han har nödig tillgång till råkraft. Skulle det bli omöjligt för honom att genom frivilligt avtal anskaffa den råkraft, som erfordras för distributionsskyldighetens fullgörande, kan, efter särskild prövning, innehavare av linjekoncession åläggas skyldighet att leverera rå— kraft, eller — om han själv ej har tillräcklig krafttillgång att upplåta sin anläggning för transitering av råkraft till områdeskoncessionshavaren. Här— utöver bör linjekoncessionshavare kunna efter prövning i varje särskilt fall åläggas leveransplikt till sådana industrier eller andra förbrukare, vilkas verksamhet finnes vara av större betydelse för det allmänna. Ifrågavarande skyldighet bör i första hand åläggas innehavare av linjekoncession, som avser ledning för allmän distribution, däremot icke exempelvis en industri— ägd ledning, som kan utnyttjas blott för industrins eget behov.

En förutsättning för distributionsskyldighetens fullgörande är att distri— butionsanläggningen hålles i gott stånd. Envar distributör, som har distribu— tionsskyldighet, har därför uttryckligen förpliktats att hålla distributions- anläggningen i sådant skick att den fyller skäliga krav på driftsäkerhet och belastningsbarhet. Detta stadgande medför givetvis ingen inskränkning i gällande säkerhetsföreskrifter beträffande anläggning, vars innehavare icke ålagts distributionsskyldighet.

Distributionsskyldig koncessionshavare är pliktig att tillhandahålla kraft »på skäliga villkor». Detta innebär att han i förekommande fall måste un— derkasta sig reglering icke blott av priset utan även av andra villkor för kraftens tillhandahållande. Prisregleringsinstitutet har utvidgats även i så måtto, att undantagandet av statliga och kommunala taxor på sätt närmare—

motiverats 1 kap. 12 (s. 280) och 19 (s. 384) ansetts icke böra bestå efter införandet av bestämmelserna om distributionsskyldighet. När skäl därtill föreligger skall prisreglering kunna begäras jämväl av kraftleverantör, nämligen i samband med täckning av kostnader för accis på elkraft (se förslag till lag om accis på elektrisk kraft, 2 €.)

Uppstår fråga om fullgörandet av distributionsskyldighet skall denna prö— vas och avgöras av koncessionsmyndigheten. Detta gäller sålunda även pris— frågor, som förut ankommit på statens prisregleringsnämnd för elektrisk ström. Prisregleringsärenden liksom andra ärenden av större vikt förutsät— tas bli avgjorda av elnämnden in pleno. Hinder synes ej möta att konces- sionsmyndigheten, liksom förut prisregleringsnämnden, hänskjuter vissa uppkomna tvistefrågor till Svenska elverksföreningens tariffkommission för förlikningsförsök. Bestämmelse härom bör intagas i instruktion för el- nämnden.

Prövningen av frågor, som innefattas i distributionsskyldigheten, torde när de beröra statens vattenfallsverk böra förbehållas Kungl. Maj:t i sam- band med den fördelning av ärenden mellan Kungl. Maj:t och elnämnden, som förutsättes ske genom särskilt beslut av Kungl. Maj:t. 3 mom. I gällande lag finnes icke utsagt att en koncession kan upphävas och hos koncessionsmyndigheterna synes tveksamhet råda, om en konces— sion kan upphävas utan direkt lagstadgande härom. För att för framtiden undanröja denna ovisshet har i lagen intagits bestämmelser om hävande av koncession därest för densamma gällande villkor åsidosättas. Beträf- fande de närmare motiveringarna härtill hänvisas till kap. 19. Enstaka smärre avvikelser från gällande bestämmelser böra dock icke vara skäl till upphävande av koncessionen. Straffbestämmelserna i 4 mom. kunna då i stället tillämpas.

I koncessionsbeslut, gällande ny anläggning, bör anges viss tid, inom vilken anläggningen skall vara tagen i bruk, vid äventyr att koncessionen eljest förklaras förverkad. Koncession för äldre ledning, som ej längre nytt— jas, skall även kunna upphävas.

För att kunna genomföra den av elkraftutredningen föreslagna rationali— seringen av elkraftförsörjningen kan det bli erforderligt att upphäva en koncession trots att innehavaren icke åsidosatt gällande bestämmelser. För dessa fall kan det framdeles bli nödvändigt att införa särskilda bestämmel- ser om inlösen. Elkraftutredningen utgår ifrån att ersättningsfrågorna tills vidare skola kunna lösas genom förhandlingar. ' 4 mom. Överensstämmer i sak helt med nuvarande 7 mom.

Bestämmelserna om förhandstillstånd i nuvarande 2 5 5 mom. ha icke medtagits i det nya förslaget. Förhandstillståndet har till syfte att den stun— dom långvariga handläggningen av ett koncessionsärende icke skall onödigt— vis hindra att arbetet med anläggningen påbörjas. Om koncessionsförfaran-

det förenklas enligt det nya förslaget synes förhandstillstånd ej längre be- hövligt.

3 5.

I fråga om ansökan om expropriationsrätt enligt 1 5 har ingen ändring i förut gällande bestämmelser föreslagits.

Expropriationsrätt och koncession begäres enligt nu gällande praxis van— ligen i en och samma ansökan och beviljas i ett och samma beslut. Enligt _ föreliggande förslag blir denna praxis mindre lämplig. Erfarenheten har visat, att Kungl. Maj:ts tillstånd till expropriation behöver utverkas endast i undantagsfall. Vanligen har koncessionssökanden träffat överenskommelse med vederbörande markägare i sådan omfattning, att några egentliga hinder för företagets påbörjande icke föreligga, frånsett att koncessionsansökan ej blivit slutligen prövad av koncessionsmyndigheten. Såsom i kap. 13 fram- hålles (s. 290) kan handläggningen av ett koncessionsärende bli mycket tids- ödande. Genom de nya bestämmelserna eftersträvas, att i mån av möjlighet förenkla ansökningsförfarandet.

Förslaget utgår från regeln, att en koncessionsansökan skall kunna be- viljas oavsett att alla vederbörande rättsägare icke hörts och oavsett att eventuella frågor om expropriationstillstånd icke prövats. Detta är en nödvändig förutsättning vid områdeskoncession, enär denna avser även framtida, ännu ej projekterade utbyggnader av närdistrihutionsnätet. Men regeln är lämplig även vid linjekoncession, även om den då icke är nöd- vändig. Förutsättningen för att linjekoncession skall kunna beviljas är en- ligt 2 5 att den prövats vara behövlig och planmässig samt att innehavaren är lämplig som distributör. Koncessionen skall meddelas under förbehåll av allmän och enskild rätt. Att sådan rätt icke trädes för när kan vid behov prövas i efterhand. Enligt den nya lydelsen av 3 5 har ansökningsförfarandet med hänsyn härtill förenklats.

Ansökan om linjekoncession skall vara åtföljd av beskrivning, kostnads— förslag och karta. Det nu gällande kravet att beskrivningen skall vara full- ständig har icke bibehållits, enär beskrivningen endast skall tjäna som underlag för bedömande av anläggningens behövlighet och planmässighet. Att den planerade sträckningen skall anges å karta behöver ej betyda att denna sträckning måste bli definitiv, vilket kan antydas genom att konces- sionsbeslutet anges gälla en ledning med huvudsaklig sträckning enligt för— slaget. Bestyrkta förteckningar över ägare och innehavare av fastigheter, vilkas rätt beröres av ledningens framdragande, har icke ansetts nödigt in— fordra i varje koncessionsärende. Däremot har det förutsatts att sökanden försökt träffa överenskommelse med dessa rättsägare samt att uppgift lämnas om de fall, där hinder för frivillig överenskommelse förelegat. Om dessa hinder angå så oväsentliga delar av ledningen eller eljest äro av så- dan art, att ledningen oberoende därav kan väntas bli utförd i huvudsaklig överensstämmelse med förslaget, bör koncession kunna meddelas. Det nu

gällande stadgandet, att alla berörda rättsägare skall lämnas tillfälle yttra sig över ansökningen, har i överensstämmelse härmed begränsats att gälla endast de rättsägare, med vilka överenskommelse ej kunnat träffas. Detta torde innebära en betydelsefull lättnad vid remissbehandlingen, enär som nämnts hinder mot överenskommelse brukar föreligga endast i undantags- fall.

Vid ansökan om områdeskoncession skall fogas karta över det område, som sökanden anser slutligen höra försörjas med det närdistributionsnät som han innehar och avser att vidare utbygga. Gränserna kunna emellertid ändras av koncessionsmyndigheten, som i samband med rationaliserings- arbetet skall bevaka att distributionsområdena bli lämpligt utformade. I allmänhet torde den s. k. generalstabskartan (topografiska kartan) vara lämplig; i varje fall bör kartan utvisa vägar, vattentrafikleder och järn— vägar inom området. Å kartan skall särskilt utmärkas icke blott det befint— liga närdistributionsnätet och matande huvudledningar inom området utan även den huvudsakliga sträckningen av de högspänningsledningar, som böra utföras för en rationell elkraftförsörjning av området.

övergångsbestämmelserna

Genom den föreslagna lagen utsträckes koncessionsplikten att omfat- ta alla starkströmsledningar, som ej till hela sin sträckning falla inom byggnad eller inhägnad gård. Härigenom bli åtskilliga redan ut— förda ledningar, som förut varit undantagna, exempelvis alla före den 1 juli 1939 tillkomna lågspänningsledningar, många jordkablar samt vissa hög- spända luftledningar, som framdragits över ledningsägarens egen mark eller som avgrena från förut koncessionerad ledning och framdragits över fri- villigt upplåten mark, principiellt underkastade koncessionsplikt i och med nya lagens ikraftträdande. Huvuddelen av dessa utgöras av lokala ledningar för allmän distribution, som enligt nya lagen böra innefattas i områdeskon- cession. Innehavare av dylika ledningar skall därom göra anmälan till koncessionsmyndigheten (9 mom.), men särskilt tillstånd för desamma i avvaktan på områdeskoncession erfordras ej (3 mom. andra stycket).

I den mån ifrågavarande förut koncessionsfria ledningar enligt nya lagen äro linjekoncessionspliktiga, skall den som vid lagens ikraftträdande är in- nehavare därav meddelas linjekoncession, vilken i allmänhet torde få for— men av en tilläggskoncession till innehavaren förut meddelad koncession med samma giltighetstid som denna.

Genom stadgande i 2 5 2 mom. i lagförslaget har distributionsskyldighet ålagts såväl områdeskoncessionshavare som efter särskild prövning _ linjekoncessionshavare. Distributionsskyldighetsprincipen skulle enligt detta stadgande icke kunna bli helt genomförd förrän områdeskoncessioner om— fattande hela landet blivit fastställda. Detta måste beräknas taga lång tid

i anspråk. Med beviljandet av områdeskoncession kan nämligen i många fall böra anstå, exempelvis om det gäller ett mindre företag, vars distribu- tionsområde icke befinnes lämpligt såsom enhet för detaljdistributions- rörelse. Fråga om områdeskoncession skall beviljas eller ej kan vara bero— ende av elnämndens bedömande med hänsyn till föreliggande aktuella ratio- naliseringsplaner. Någon skyldighet att söka områdeskoncession skall där- för ej föreligga förrän koncessionsmyndigheten funnit förutsättningar före— ligga för beviljande av områdeskoncession (2 mom.)

I avvaktan på att områdeskoncession meddelas skall enligt 4 inom. i över- gångsbestämmelserna innehavare av närdistributionsnät, dvs. sådana led- ningar som borde ingå i områdeskoncession enligt nya lagen —— oavsett om nätet i dess helhet varit koncessionspliktigt eller ej enligt förut gällande lag — ha distributionsskyldighet inom det område, som skäligen här för— sörjas med elkraft från nätet. Uppstår i vissa fall fråga om distributions- skyldighet föreligger, kan denna enligt 2 5 2 mom. sista stycket nya lagen hänskjutas till koncessionsmyndigheten för avgörande.

Innan en detaljdistributör erhållit områdeskoncession har han icke den rätt att utan föregående prövning av behov och planmässighet framdraga lokala ledningar, som tillkommer Honom enligt 2 ä 1 mom. femte stycket nya lagen. I avvaktan på områdeskoncession skall därför interimistiskt till- stånd för lokala ledningar meddelas i den för linjekoncession stadgade ord— ningen (3 mom. första stycket). Detta innebär att nu gällande tillstånds— system i princip bibehålles intill dess områdeskoncession meddelas, dock att tillstånd kräves även för vissa förut koncessionsfria ledningar, såvida dessa ej varit i bruk redan vid lagens ikraftträdande (3 mom. andra stycket). När områdeskoncession sedermera meddelas ersätter den icke blott de interimis- tiska tillstånd, som kunna ha meddelats efter lagens ikraftträdande, utan även enligt äldre lag meddelade tillstånd avseende lokala distributionsled- ningar (5 mom.). För samtliga ledningar, som innefattas i en områdes— koncession, kommer sålunda att gälla en gemensam koncessionstid.

För den som efter lagens ikraftträdande vill framdraga och nyttja stark— strömsledningar av den natur, att linjekoncession enligt nya lagen erfordras därför, möta inga liknande hinder att omedelbart utfärda koncession. För vid lagens ikraftträdande befintliga ledningar av denna natur, som förut va- rit koncessionsfria, skall, sedan koncessionsmyndigheten mottagit anmälan om innehavet, linjekoncession meddelas för innehavaren, dock utan pröv— ning av ledningens behövlighet och planmässighet eller innehavarens lämp- lighet att bedriva allmän distribution (6 mom.) Vid lagens ikraftträdande skall distributionsskyldighet anses vara ålagd alla innehavare av förut kon- cessionerade anläggningar av den natur, att de skulle vara linjekoncessions- pliktiga enligt nya lagen. Befrielse från distributionsskyldighet skall dock kunna meddelas efter särskild ansökan (7 mom.).

Genom över—gångsbestämmelserna kommer distributionsskyldighet att åligga alla innehavare av starkströmsledningar för allmän distribution, som äro principiellt koncessionspliktiga enligt nya lagen, oavsett om beviljandet av koncession verkligen sker i samband med lagens ikraftträdande eller

! uppskjutes till en senare tidpunkt. För att bedöma frågor, som angå distri— butionsskyldigheten, måste koncessionsmyndigheten ha kännedom om vilka ledningar, som beröras därav, och vem som är innehavare av dessa led— ningar. Enär tillstånd enligt nu gällande lag utfärdas för sökanden »eller hans rättsinnehavare» samt anmälan om upplåtelse med nyttjanderätt av koncessionerad anläggning icke erfordras, har kommerskollegium inga full- ständiga uppgifter om vederbörande innehavare ens vad angår koncessione— rade anläggningar. Genom stadgandeti 9 mom. kan koncessionsmyndigheten erhålla fullständiga upplysningar om ifrågavarande ledningar och deras innehavare.

Ändringarna i stadgan den 5 maj 1939 om elektriska starkströmsanläggningar

Enligt elkraftutredningens förslag komma de ledningar, som omfattas av områdeskoncession, att få framdragas utan särskild koncessionsprövning. Koncessionshavaren är dock därmed icke befriad från skyldighet att taga hänsyn till motstående, allmänna och enskilda intressen. I 1939 års stadga lämnas närmare bestämmelser härom. Koncessionshavare är sålunda skyl- dig att taga hänsyn till allmänna intressen då han skall framdraga en led- ning över en väg, en järnväg, en vattentrafikled etc. eller i närheten av ett flygfält. Till stadgan har överflyttats den bestämmelse till skydd för en- skilda intressen, som nu är intagen i 1902 års lag och enligt vilken ledning icke får framdragas på mindre avstånd än tjugo meter från boningshus och tomtplats om ägaren motsätter sig detta. I stadgan finnes härjämte lik- som tidigare bestämmelser om anmälningsskyldighet för vissa fall, om drif- tens handhavande, om tillsyn över anläggningens utförande och skötsel samt om ansvarsskyldighet.

1 5. I denna paragraf liksom på andra ställen i stadgan har elnämnden angi— vits som tillsynsmyndighet i stället för kommerskollegium.

2 &.

Anmälningsskyldighet enligt denna paragraf har tidigare ålegat den, som skulle anlägga koncessionsfri starkströmsledning för högspänning som ej till hela sin sträckning föll inom byggnad eller inhägnad gård. Anmälnings— skyldighet föreslås här föreligga för den, som vill framdraga starkströms— ledning för högspänning med stöd av områdeskoncession. Genom denna an- mälningsskyldighet får elnämnden kännedom om alla högspänningsled— ningar jämte transformatorstationer som byggas inom landet och kan på

ett tidigt stadium lägga in dem på översiktskartor. Anmälningsskyldighet föreligger liksom f. n. ej för ledning som framdrages inom byggnad eller in- hägnad gård. Dylik ledning är icke koncessionspliktig och omfattas alltså icke av områdeskoncessionen.

Med stöd av sista stycket i paragrafen kan elnämnden i sådana fall, där det befinnes önskvärt och lämpligt, medge exempelvis den lättnad i anmäl- ningsskyldigheten, att anmälan må göras i efterhand en gång om året för alla under året tillkomna anläggningar.

3 5.

Enligt 2 5 i 1902 års lag skall koncession meddelas endast för bestämd person eller bestämt företag. Överlåtes anläggningen skall nye ägaren söka koncession. Med anledning av dessa bestämmelser i lagen kan 3 5 i stadgan upphävas.

4 5.

I gällande lydelse av tredje stycket av 4 % finnes detaljerade bestämmelser om skyldighet för anläggningsägare att på anfordran inge uppgift om än- läggningskostnader, balansräkning, vinst- och förlusträkning samt uppgift om tillämpade taxor ävensom beskrivning och ritningar över anläggningen. För att kunna avgöra frågor, som sammanhänga med distributionsskyldig- heten, kan elnämnden tänkas erfordra ytterligare uppgifter av olika slag. Det har därför ansetts lämpligt att mera allmänt ange att elnämnden kan infordra alla uppgifter av teknisk och ekonomisk art, som kunna finnas er- forderliga för avgörande av frågor om distributionsskyldighet.

5—8 55.

I dessa paragrafer ha icke föreslagits några större ändringar. I sista styckena av paragraferna är f. n. stadgat att ledningarna skola anordnas så, att antalet korsningsställen med väg, järnväg osv". blir det minsta möjliga. Denna bestämmelse föreslås modifierad på så sätt, att det skall >>eftersträ- vas» att antalet korsningsställen blir minsta möjliga; detta för att lämna utrymme för praktiska jämkningar. I 6 5 har på förslag av kommerskollegii elektriska byrå införts några ytterligare detaljbestämmelser för lednings framdragande över vattentrafikled, vilka intagas i koncessioner, som kunna beröra vattentrafikled.

9 5.

* Fjärde stycket i första momentet har tillagts på förslag av kommerskol- legii elektriska byrå, enär det visat sig praktiskt omöjligt att efterfölja ifrågavarande bestämmelser när det gäller kontaktledningar för elektrisk järnväg, spårväg eller trådbuss.

Denna paragraf är ny och bestämmelserna i den äro hämtade från 2 & i 1902 års lag. Elkraftutredningen anser att dessa bestämmelser icke böra ingå i lagens mer allmänna bestämmelser utan att de ha sin rätta plats i stadgan. % 5.

Även denna paragraf har överförts från 2 5 i 1902 års lag. Bestämmelsen är av likartad karaktär som bestämmelserna om hur ledning skall framdra— gas vid väg, järnväg o. dyl. och anses därför ha sin plats i stadgan. Ända- målet med bestämmelsen anses kunna vinnas genom den föreslagna mera kortfattade utformningen. Flygfält med större utsträckning än 5 000 meter finnas icke f. n. Om sådana framdeles skulle anläggas kan paragrafen kom- pletteras på sätt som då finnes erforderligt.

11 %.

Med hänsyn till den lämplighetsprövning av koncessionssökande, som skall ske enligt 2 5 i 1902 års lag, och med hänsyn till att anläggning icke kan överlåtas utan ny sådan prövning, finnes icke något behov av de nu- varande bestämmelserna i 11 &, varför utredningen föreslår att paragrafen upphäves.

12 5.

Någon ändring av denna paragraf har icke föreslagits ehuru väl diskute- rats med hänsyn till behovet av kvalificerad driftledare vid varje självstän- digt företag. Paragrafen bör även med sin nuvarande lydelse tolkas så, att för anläggning skall finnas driftledare, som skall äga för sin verksamhet nödiga kvalifikationer.

15 5.

Enligt vad som anföres i kap. 19 (s. 380) bör man för framtiden kunna undvara tillsyn under anläggningars utförande. I anledning härav föreslås att första stycket av paragrafen utgår. Även sista stycket bör utgå, enär den nuvarande bestämmelsen i 2 & 5 mom. i 1902 års lag om förhandstillstånd icke anses böra kvarstå i lagen.

Lagen om accis på elektrisk kraft

Enligt elkraftutredningens förslag skola kostnaderna för kraftförsörj- ningens understödjande i samband med rationaliseringar och nätupprust- ningar, ävensom del av kostnaderna för elnämndsorganisationen, täckas av kraftförsörjningen själv genom en accis på producerad och importerad elkraft. De huvudsakliga skälen härtill och motiven för lagens utformning återfinnas i kap. 19 s. 411—415. Utöver vad som sålunda framgår av kap. 19 må följande tilläggas.

Enligt lydelsen är även den elkraft, som förbrukas inom den egna anlägg- ningen, accis'pliktig. Det finnes givetvis skäl som tala för att denna egen- förbrukning skall avräknas och sålunda befrias från accis. Emedan en be- stämmelse om sådan avräkning skulle medföra tolkningsproblem i avseende på vad som är egenförbrukning och emedan accisen på egenförbrukningen under alla förhållanden blir jämförelsevis ringa och fördelningen av accis— medel på producenterna vid ett givet totalbehov — ändock blir ungefär densamma, anser elkraftutredningen icke tillräckliga skäl föreligga att ge- nerellt undantaga egenförbrukningen från accis.

, ._ . 2 5.

Enligt denna paragraf kan kraftleverantör för täckning av sina accis- kostnader begära prisreglering. För prisregleringen gäller i övrigt vad som är stadgat i 2 5 2 mom. i 1902 års lag angående elektriska anläggningar.

Förordningen angående lån och bidrag från elnätsfonden

' Fonden, beträffande vilken bestämmelse finnes i 3 & i förslaget till lag om accis på elektrisk kraft, är avsedd att bl. a. möjliggöra ekonomisk stödgiv- ning genom statens medverkan till elektrifieringsarbete —— såväl i samband med nyelektrifiering som vid upprustning av befintligt distributionsnät —— i enlighet med de huvudprinciper, som framlagts i kap. 11 (s. 234—254) och som vidare behandlats i kap. 19 (s. 388—391).

Stödgivning (genom medel ur elnätsfonden kan kombineras med utläm- nande av räntebärande lån ur kraftledningslånefonden, eventuellt även vat— tenkraftslånefonden och elektrifieringslånefonden.

De närmare reglerna för stödverksamheten skola fastställas av Kungl. Maj:t efter förslag av elnämnden.

Ändringarna i bestämmelserna för kraftledningslånefonden

Ändringarna motiveras av behovet att öka möjligheterna att lämna stat— ligt räntebärande lån för elektrifieringsarbete, såväl i samband med ny- elektrifiering som vid upprustning av befintligt distributionsnät. Lån ur kraftledningslånefonden skall därvid kunna lämnas även i samband med stödgivning genom lån eller bidrag ur elnätsfonden. De närmare motive- ringarna till ändringarna framgå av kap. 11, s. 234 254, samt kap. 19, s. 390.

' |

AVDELNING I

Förutsättningar för fortsatta bedömanden

Kap. 1. Elkraftförsörjningens uppbyggnad och teknik

För att underlätta studiet av föreliggande betänkande skall i detta kapitel lämnas en överblick över kraftförsörjningsapparatens uppbyggnad i vårt land och i samband därmed en orientering rörande kraftförsörjningens tek- nik med speciell inriktning på svenska förhållanden. Som ytterligare under- lag hänvisas till elkraftutredningens tidigare publikationer, särskilt redo- görelse nr 1 (SOU 1947: 3). I denna har bl. a. lämnats en kort översikt an- gående produktionen och distributionen av elektrisk kraft i Sverige samt dessutom förklaringar till vissa förkortningar och begrepp _ främst berö- rande den kommersiella sidan av kraftförsörjningen.

Elkraftens betydelse samt huvuddragen av elkraft- försörjningens uppbyggnad

Elektriciteten ger möjlighet att på ett bekvämt sätt överföra energi från en plats till en annan. Den utgör dessutom i sig själv en för många ända- mål synnerligen användbar energiform. Dessa förhållanden ha lett till att den elektriska kraftindustrins utveckling gått mycket snabbt sedan slutet av förra århundradet, när man för praktiskt ändamål började kunna an- vända och överföra elkraft. Det torde icke vara någon överdrift att säga, att elkraften i dag är av fundamental betydelse för vårt materiella välstånd.

Den elektriska energin användes inom industri och hantverk för belysning, för drift av maskiner och ugnar

samt för andra värmeändamål, för elektrokemiska processer, transpor- ter etc.; inom jordbruket för belysning, för drift av transportmaskiner av skilda slag, fläktar, pumpar, mjölkningsmaskiner, tröskverk m. fl. maskintyper, för varmvattenberedning och andra värmeändamål etc.; inom samfärdseln för elektriska järnvägar, spårvägar och bussar etc. samt inom hemmen för belysning, matlagning och varmvattenberedning, för drift av småmaskiner såsom dammsugare och hushållsmaskiner av olika slag, för radio etc. Även om användningen av ekonomiska och andra skäl icke nått lika långt överallt torde elektricitetens grundläggande möjligheter härvidlag vara all-

mänt kända och någon mera ingående redogörelse härför erfordras icke i detta sammanhang.

Att elektriciteten erbjuder goda möjligheter till energitransport är av värde speciellt för vårt land med dess stora, avlägset belägna energikällor, vilka utan dessa möjligheter i huvudsak skulle ligga outnyttjade. Energi- källorna utgöras främst av vattenfallen i våra vattendrag och äro till över- vägande delen lokaliserade till Norrland. De huvudsakliga energibehoven finnas emellertid i mellersta och södra Sverige, varför stora kraftmängder årligen överföras från norr till söder på elektrisk väg.

I fråga om den totala elkraftproduktionen i förhållande till invånar- antalet intar Sverige en framskjuten plats, vilket till stor del får tillskrivas den rikliga tillgången på vattenkraft. Endast Norge och Kanada, i vilka länder vattenkrafttillgången är förhållandevis ännu rikligare, kunna här— vidlag uppvisa nämnvärt högre siffror.

Kraftförsörjningsapparateu i stort

Elkraften i Sverige produceras sålunda huvudsakligen i vattenkraftstatio- ner i norrländska älvar. Betydelsefulla kraftstationer finnas emellertid även i Dalälven, Klarälven, Göta älv och Motala ström samt i några vattendrag i sydligaste Sverige, främst Lagan.

Från kraftstationerna utgå kraftledningar till förbrukningsplatserna. Ut- vecklingen har medfört att landet från kraftförsörjningssynpunkt blivit uppdelat i ett antal kraftverksområden. Varje kraftverksområde är lokali- serat omkring en eller ett fåtal äldre kraftstationer, som ursprungligen genom ett avgränsat kraftledningsnät ha försett området med elkraft. Efter hand som krafttillgången inom områdena i södra och mellersta Sverige blev otillräcklig måste kraft tillföras genom överföringslinjer från de stora kraftöverskottsområdena i Norrland. För bättre utnyttjande av krafttillgångarna inom de olika kraftverksområdena skedde dessutom en vittgående sammankoppling av näten genom kraftiga förbindelseledningar. För närvarande finnes ett landsomfattande överföringssystem för elektrisk kraft, till vilket så gott som samtliga kraftstationer av betydelse äro an- slutna och från vilket kraften uttages av förhrukarna i olika punkter. Över nämnda överföringssystem sker sålunda en så gott som fullständig »sam- körning» mellan landets större kraftföretag och kraftstationer.

I begränsad utsträckning utnyttjas även i vårt land andra energikällor än vattenfallen för produktion av elkraft, huvudsakligen dock för reservända— mål och för insättning vid tider med särskilt hög kraftförbrukning. Dessa energikällor utgöras så gott som uteslutande av bränslen, främst importe- rade dylika (kol och olja), vilka medelst ångmaskineri eller förbrännings- motorer omsättas till elektrisk energi. Kraftstationer, vilka utnyttja dylika energikällor, kunna av naturliga skäl förläggas nära förbrukningsområdena

' ”e//0/)5VC/75k " ””=” 23% kraf/jfa/l'on : . .. .-_* w-_ 5faÄÄ7/lh/Ä'Åeoäljaa kV] [ |

50— /30 kV

5/05/105- sfa/fon bygde/kyri- &_!” uf

4. ..

Bild 1. Schematisk bild över den elektriska kraftöverföringen

för den elektriska kraften. I några punkter i överföringssystemet, i nära an- slutning till förbrukningstyngdpunkter, ha sålunda anslutits större ång- kraftcentraler, exempelvis i Stockholm, Västerås och Malmö. Överföringssystemets uppbyggnad i stort åskådliggöres av den schema- tiska framställningen i bild I.

Elkraft från en mellansvensk kraftstation fördelas inom vederbörande kraft- verksområde —— av storleken ett eller flera län genom landslinjer med en spän- ning av 50—130 kV till transformatorstationer (landslinjestationer), där spän- ningen nedtransformeras till 6—40 kV. Till landslinjenätet föres även kraft från en norrländsk kraftstation genom avtappning från en därifrån utgående stamlinje med 200 eller 380 kV spänning, vilken är avsedd för överföring av kraft över hela riket. Landslinjestationerna förläggas på ett avstånd från varandra av i runt tal 50 km, ofta i närheten av större belastningsobjekt, såsom städer, större industrier eller omformarstationer för elektrifierad järnväg.

Från landslinjestationerna sprides kraft bl. a. ut över bygden genom bygdelin- jer med normalt 20—40 kV spänning (bygdespänningen). Till dessa äro i sin tur anslutna transformatorstationer (bygdestationer), som normalt ligga på ungefär 10 km avstånd från varandra.

Vid bygdestationerna hämta detaljdistributionsföretagen på landsbygden sin rå- kraft och vanligen äges det därifrån matade ledningssystemet (detaljdistributions— nätet) — stundom även själva bygdestationen — av vederbörande detaljdistribu- tionsföretag. I bygdestationerna transformeras kraften till 3—20 kV ortsspänning (undantagsvis 1,5 kV) och överföres i första hand på ortslinjer till ortsstationer. Efter transformering i dessa till lågspänning föres kraften via lågspänningsled- ningar med en normal räckvidd av 500—800 m till de olika förbrukarna.

I det ovan beskrivna överföringssystemet kan i enskilda fall något mellanled saknas. Exempelvis sker stundom transformering till lågspänning direkt i en byg- destation. En bygdelinje kan i vissa fall övergå direkt till ortslinje av samma spänning utan transformering. Beträffande den här använda benämningen detalj— distributionsnät (ortsnät jämte därifrån matade lågspänningsnät) må också fram- hållas, att detaljdistribution i vissa fall sker från nät av högre ordning, ävensom att engrosdistribution (råkraftdistribution) i undantagsfall sker från ett detalj- distributionsnät.

Till de norrländska förbrukningsområdena överföres kraften på samma sätt som till de mellansvenska och sydsvenska endast med den avvikelsen, att överföringen på stamlinje för de högsta spänningarna —— med hänsyn till de totalt sett kortare avstånden mellan kraftkällor och förbruknings- områden _ uteblir eller blir av mindre betydelse, medan däremot överfö- ringsavstånden inom näten av de övriga typerna ofta bli väsentligt mycket större beroende på den glesare bebyggelsen.

Elkraftpreduktion

Som tidigare nämnts produceras elkraft normalt med vattenkraft eller värmckraft som energikälla. I vårt land dominerar vattenkraften men i värl- den i dess helhet överväger värmekraften enär huvudparten av all elkraft lämnas av stenkolseldade ångkraftverk med kondenseringsmaskineri.

Även vindkraft utnyttjas i Sverige för alstring av elkraft ehuru i mycket liten utsträckning. Atomkraften torde ännu icke ha någon praktisk bety— delse i något land men kan givetvis komma att innebära lösningen på fram— tidens energiproblem.

Krafttillgången i ett vattenfall beror på vattenföringen och fallhöjden. Om vattenföringen angives i kubikmeter per sekund och betecknas med Q samt fallhöjden uttryckes i meter och betecknas med H, kan man överslags- vis räkna med att den vid utbyggnad av fallet tillgängliga elektriska effek- ten, som må betecknas med P, blir lika med 8 QH kilowatt (kW; 1 kW' :: 1.36 hästkrafter, hk).

Vattenföringen i våra floder varierar emellertid högst avsevärt såväl mel— lan olika årstider som från år till år. Endast om en kraftstation bygges ut för högst minimivattenföringen, kan man därför påräkna att kontinuerligt ha tillgång till nämnda effekt, dvs. kunna taga ut ett energibelopp av P - 8 760 kilowattimmar per år (kWh/år; ett år omfattar 8 760 timmar). Bestämmande för vattenföringens storlek är i första hand nederbörden men därjämte temperaturförhållandena. Vattentillgångens samt kraftuttagning— ens växlingar och det härmed sammanhängande regleringsproblemct ha i korthet behandlats i redogörelse nr 1 (s. 17—21) och lämnas här åsido.

Gemensamt för alla kraftstationer är att man låter ett energimedium på— verka ett drivmaskineri (vattenturbin, ångturbin, förbränningsmotor, vind- hjul etc.), vilket i sin tur driver en elektrisk generator. Turbin och gene— rator äro i en modern kraftstation normalt direkt hopkopplade med var- andra och utgöra ett aggregat. Utvecklingen har lett till allt större enheter av turbiner och generatorer och det är närmast transportsvårigheterna till uppställningsplatsen samt erforderlig uppdelning med hänsyn till driftsäker- heten, som numera bestämma storleken och antalet aggregat i de största kraftstationerna. I äldre stationer kan antalet aggregat uppgå till ett tiotal eller mera men i moderna stationer har man vanligen endast två å tre.

Vattenkraftstationernas konstruktiva utformning är i hög grad beroende av lokala förutsättningar. Normalt sammanföres vattnet på uppströmssidan av en damm, utförd av betong, sten eller jord. Turbinerna uppställas i en del fall, speciellt vid förhållandevis låga fallhöjder, i öppna sumpar i anslut- ning till dammbyggnaden. I andra fall ledes vattnet i tuber eller tunnlar till turbinerna, som kunna placeras över eller under jorden, ungefär i nivå med den nedre vattenytan. Det avgående vattnet återföres till den naturliga strömfåran i kanaler eller tunnlar, vilka ibland kunna bli mycket långa. En placering av turbinerna jämte större eller mindre del av kraftstationens övriga utrustning helt under jorden är normalt möjlig endast vid fallhöjder överstigande ett visst minimimått.

Med hänsyn till timmerflottningen ordnas flottningsrännor förbi fallen och flottningsutskov i dammarna och med hänsyn till vandringsfisken byggas laxtrappor etc. Dessa anordningar äro emellertid icke alltid tillräck- liga utan man får stundom ordna med timmertransporter och fisktranspor- ter på bil eller järnväg.

Kraftstationsgeneratorn alstrar vid drift en elektrisk spänning mellan

sina uttag och matar ut en elektrisk effekt, som bestämmes av den anslutna belastningen (dvs. den för tillfället rådande elkraftförbrukningen) och den till turbinen framsläppta vattenmängden (respektive ångmängden, bränsle- mängden etc. vid andra typer av drivmaskineri) . Av konstruktiva skäl måste generatorspänningen väljas relativt låg och normalt upptransformeras till högre spänning för att kraften skall kunna överföras till förbruknings— området. (Se mera härom i det följande under rubriken elkraftdistribution) . Denna upptransformering sker i kraftstationens huvudtransformatorer (vissa mindre transformatorer för lokaldrift, närdistribution etc. finnas också som regel).

Från transformatorcrna ledes kraften genom skenor eller kablar till ett fördelningsställverk, vid moderna, större stationer vanligen av utomhus— typ, varifrån de anslutna kraftlinjerna matas över strömbrytare och andra kopplingsorgan.

Till varje större, modern kraftstation hör en kontrollanläggning, varifrån driften med tillhjälp av diverse instrument kan övervakas och manövrer, såsom in- och urkoppling av maskiner, transformatorer och linjer, kunna utföras. I denna finnas även apparater av olika slag för skydd mot drift- störningar, för automatiska kopplingar, för mätning av effekt och energi i utgående linjer etc.

Ängkraft

Genom uppvärmning av vatten i en ångpanna åstadkommes ångbildning. Genom fortsatt värmetillförsel ges ångan allt högre temperatur och värme— innehåll samtidigt som dess tryck ökar. Enbart för ångbildningen förbrukas en avsevärd bränslemängd. Det arbete, som ångan uträttar i en ångturbin, motsvarar i huvudsak skillnaden i dess värmeinnehåll före och efter turbi— nen. Ju högre tryck och ju högre ångtemperatur, som väljes vid inloppet, och ju lägre tryck vid utloppet, desto mer kraft erhålles per kg ånga, som passerar turbinen. Material och konstruktioner sätta emellertid vissa grän— ser.

Två huvudtyper av elkraftalstring genom ånga finnas. Man talar om kondenskraft respektive om mottryckskraft.

Vid en anläggning för kondenseringsdrift utnyttjas ångan enbart för el— kraftalstringen, varför trycket hos den avgående ångan hålles så lågt som möjligt. Avloppsångan kondenseras vid detta låga tryck till vatten i en s. k. kondensor och kondensatet inpumpas åter i ångpannan. En del av den av bränslet avgivna energimängden tillvaratages i ångturbinen och omvandlas till elektrisk energi men huvudparten går förlorad dels såsom värmeför— luster i ångpannan, turbinen och ångledningarna, dels och framför allt vid kondenseringen, varvid den avledes i kylvattnet. Vid större anläggningar av det slag, som f. n. användas i Sverige, tillgodogöres i praktiken omkring

20 % av bränslets effektiva värmevärde, motsvarande en förbrukning av omkring 0,6 kg prima kol per kWh. Vid mindre samt äldre anläggningar är bränsleförbrukningen ofta betydligt högre. Vid moderna anläggningar med längre årlig utnyttjningstid än den i Sverige nu aktuella är bränsle- förbrukningen däremot avsevärt lägre.

, Med mottryckskraft menas elkraft alstrad med ånga i mottrycksanlägg- ningar företrädesvis vid industrier, vilka för sin fabrikation behöva stora mängder lågtrycksånga. Sådan industri är framförallt cellulosaindustrin. Ångan alstras med högt tryck och användes för produktion av elkraft innan den för uppvärmnings— eller annat ändamål införes i fabrikationsprocessen. Vid ångalstring erfordras den ojämförligt största värmemängden för att över— föra vattnet i ångform, under det att värmebehovet för att därefter erhålla högt ångtryck är måttligt. Det för elkraftproduktion vid mottrycksdrift er- forderliga värmetillskottet är sålunda jämförelsevis ringa och har förut- sättning att ge gott utbyte i elektrisk energi. Såsom bränsle användes ej sällan avfall från fabrikationen, vilket ytterligare bidrager till att kostnaden per kWh blir måttlig och som regel lägre än kostnaden för inköpt vatten— kraft. Då därtill kommer att den tillgängliga kraftmängden från industrins mottrycksanläggningar står i direkt proportion till industrins ångbehov, dvs. vanligen till dess industriella produktion och kraftbehov, är det som regel ekonomiskt att inom sådana industrier, som det här är fråga om. utnyttja mottrycksanläggningar för elkraftproduktion. För kraftleverans utanför det egna företaget är emellertid mottryckskraftens beroende av framställningen av fabrikationsånga en nackdel. Som jämförelse med förut- nämnda verkningsgradssiffror vid kondenseringsdrift må nämnas att man under gynnsamma förutsättningar vid mottrycksdrift och vid relativt stora aggregat kan räkna med en verkningsgrad för den rena elkraftproduktionen av omkring 60 %, motsvarande en kolförbrukning av omkring 0,2 kg prima kol per kXVh. '

Vid anläggningar för s. k. fjärrvärmedistribution, exempelvis för bostads- uppvärmning inom en stad eller stadsdel, kan det vara ekonomiskt att för samtidig elkraftproduktion anordna mottrycksdrift. Som förutsättning för att dylik kombinerad drift skall vara lönande gäller bland annat att behoven av värme och elkraft variera ungefär likformigt med samtidig högbelast- ning, så att såväl energi- som effektuttagningen i stadens elkraftförsörjning från annat håll reduceras, samt att frågorna om maskinreserv för kraftpro- duktionen och om bränsleförsörjning vid avspärrning av bränsleimporten få en tillfredsställande lösning.

De bränslen, som företrädesvis användas för ångkraftframställning i vårt land, utgöras som nämnts av importerad stenkol och mineralolja samt, be- träffande industriell mottryckskraft, även avfallsprodukter av olika slag. 1 relativt liten utsträckning användas inhemska bränslen såsom ved, sten- kol, torv och alunskiffer.

Ett bränsle karakteriseras av dess värmevärde. Man räknar vanligen med >>effek- tivt värmevärde» varmed menas den värmemängd, som alstras vid fullständig för— bränning av ett kg av ämnet med förbränningsvatten och bränslefuktighet i ång- form. Importerad kol och olja ha ett effektivt värmevärde av 6 000 år 7 000 kcal/kg för kol respektive 10000 kcal/kg för olja, medan de svenska stenkolens effektiva värmevärde uppgår till i medeltal 4 000 kcal/kg. För torv är motsvarande siffra 3 500, för ved 3 000 och för alunskiffer 1 500 kcal/kg. För ved och torv gäller att de redan normalt ha en hög fuktighet samt att ytterligare fuktighet avsevärt nedsätter värmevärdet. Det bör påpekas, att ångpannornas verkningsgrad är lägre ju större fuktighet bränslet innehåller. Problemen rörande de inhemska bränsle— tillgångarnas utnyttjande samt användningen av torv och alunskiffer för fram— ställning av flytande och gasformiga bränslen skall icke närmare beröras här.

De flytande och gasformiga bränslena värdesättas förhållandevis högre än de fasta, emedan de äro mera lätthanterliga och förbrännas fullstän- digare. Genom finmalning av stenkol får man ett bränsle, som i vissa av- seenden liknar de flytande.

Vid anläggandet av en ångkraftstation spela, förutom kravet på en lämp- lig placering med hänsyn till kraftförbrukningen, även transport- och lag— ringsproblemen för bränslet stor roll. Ångkraftstationer placeras därför helst i omedelbar anslutning till en god djuphamn, som bör vara isfri så stor del av året som möjligt. Även tillgången till kylvatten och matarvatten är av stor betydelse för valet av byggnadsplats.

Annan värmekraft

Bland förbränningsmotorer, avsedda för elkraftproduktion, intar i vårt land dieselmotorn den främsta platsen, ehuru även den för elkraftförsörj— ningen i dess helhet är av underordnad betydelse. Den användes huvudsak— ligen för toppkraftalstring och reservhållning inom industrier och elverk. Även bensinmotorer användas för samma ändamål men i ännu mindre ut— sträckning. En förbränningsmotortyp, som i utlandet har börjat få en rela— tivt stor betydelse för bl. a. elkraftproduktion, är gasturbinen. Diesel- och bensinmotorer förekomma normalt i storlekar på upp till några tusen res— pektive några hundra kW, medan gasturbiner i utlandet förekomma i stor- lekar upp till några tiotal tusen kW. Bränsleförbrukningen för dieselmotorn varierar inom relativt vida gränser beroende på bl. a. anläggningens storlek och modernitet samt dess driftsätt. Den ligger normalt mellan 0,25 och 0,35 kg mineralolja per lth avgiven elektrisk energi. En bensinmotor förbrukar i praktisk drift ca 0,8 kg bensin per kWh.

Samkörning

Med samkörning menas att flera kraftstationer samtidigt mata in kraft på ett hopkopplat överföringsnät och sålunda gemensamt svara för den totalt erforderliga kraftproduktionen inom nätet. En väl utvecklad sam—

körning bidrager till att bättre tillvarataga tillgängliga vattenkraftresurser och minska behovet av ångkrafttillsats.

För närvarande drivas praktiskt taget samtliga landets kraftstationer ständigt sammankopplade och utbyte av kraft företages i stor utsträckning enligt planer, som kontinuerligt uppgöras i samråd mellan driftledningarna vid de olika företagen. Det gäller därvid att taga vara på all överskottskraft var den än finnes och att se till att på intet håll sådan kraft på olämpligt sätt användes för ångframställning i elektriska ångpannor samtidigt som ång— kraft produceras på annat håll. I sådana fall är det naturligtvis i allmänhet bättre att använda bränslet direkt för ånggenerering. Även under sådana tider, då ångkraft icke produceras, tillvaratages överskottskraft, antingen för att minska kraftproduktionen vid sådana kraftverk, som icke ha sina vattenmagasin fyllda, eller för att avsättas till elektriska ångpannor eller andra lågvärdiga ändamål.

För att erhålla en rationell krafthushållning strävar man efter att verk- ställa dygns- och veckorcglering. dvs. vattentappning anpassad efter belast- ningens dygns- och veckovariationer, i de stationer, där förlusterna på grund av regleringen bli minst. I stationer med ett flertal aggregat fördelas lasten mellan dessa så att bästa totala verkningsgrad erhålles och samma sak gäller för samkörningen mellan olika kraftstationer och olika kraftföretag. De större kraftföretagen få därvid i vissa fall vidtaga ändringar i den produktionsplan, som närmast skulle ha motsvarat deras egna behov, och i stället anpassa produktionen efter landets behov.

Vattenkraftproduktionen vid sådana företag, som ha stor utbyggd vatten- krafteffekt och goda regleringsmöjligheter, koncentreras till högbelastnings- tid, varigenom vid behov av ångkrafttillsats en jämnare och mera ekono- misk körning av ångkraftverken erhålles. Kraftproduktionen vid de stora ångkraftverken fördelas såvitt möjligt så, att god gemensam verkningsgrad erhålles. Under sådana tider, då ångkraftverken var för sig skulle behöva gå med låg belastning med åtföljande relativt dålig ekonomi ordnas det därför ofta så, att verken köra omväxlande.

De stora ångkraftverken ha i regel bättre verkningsgrad än de mindre. [ den mån överföringsförlusterna icke utjämna denna verkningsgradsskill- nad och i den mån bränsletransporterna till de större verken icke ställa sig avsevärt ogynnsammare än till de mindre är det därför ekonomiskt att koncentrera ångkraftproduktionen till de större.

Elkraftöverföring och distribution Allmänt För kraftöverföring över elektrisk ledning användas i praktiken tre olika huvudsystem, nämligen likström, enfas växelström och trefas växelström.

I en generator alstras vid drift en elektrisk spänning, som mätes i volt (V) eller kilovolt (kV = 1 000 V). Vid anslutning av en belastning till generatorns uttag

via en längre eller kortare överföringsledning framdriver spänningen en elektrisk ström genom den sålunda bildade slutna strömkretsen. Strömmen, som beroende på generatorns konstruktion är av konstant storlek och riktning (likström) eller pulserande med växlande riktning (växelström) och som mätes i ampere (A), är till sin storlek beroende av i första hand den anslutna belastningens storlek. Den av generatorn utmatade elektriska effekten, som mätes i watt (W) eller kilowatt (kW), är bestämd av i första hand spänning och ström. Den under en viss tid utmatade energimängden, som mätes i kilowattimmar (kWh), utgör produkten av den under tiden rådande medeleffekten i kW och tiden i timmar.

Generatorer för likström och enfas växelström ha två huvuduttag. Överförings- ledningen till förbrukningsobjektet utgöres vid dylikt system av två ledare (fram— och återledning) och förbrukningsobjektet är utfört för >>tvåpolig>> anslutning. Tre- fassystemet utgör i princip tre enfassystem. De tre återledningarna slås tillhopa till en gemensam »nolla», vilken vid lika belastning på de tre faserna också kan helt utelämnas. I förra fallet utgöres överföringsledningen av fyra ledare (tre fas- ledare och en nolledare) i senare fallet, vilket är normalt vid högspänningsöver- föring, av tre fasledare.

Den elektriska strömmen har att övervinna ett visst motstånd i ledningarna, vilket är större ju längre ledning och ju klenare ledningsarea som användes och ju lägre ledningsförmågan hos det begagnade ledarmatcrialet är. Härigenom för— brukas en del av den utmatade effekten, vilket även yttrar sig på så sätt, att spän- ningen vid mottagningsändan av ledningen är lägre än inmatningsspännigen. Led- ningsmotståndet åstadkommer sålunda ett >>spänningsfall». Vid variabel belastning varierar spänningsfallet och därmed spänningen i mottagningsändan. För en ostörd drift på förbrukningsplatsen fordras att spänningsvariationerna ej bli för stora. Ledningens överföringsförmåga är sålunda begränsad. (De vanligaste matc- rialslagen för elektriska ledningar äro koppar, järn och aluminium. Av dessa har koppar den högsta ledningsförmågan. Hos aluminium är den 60 % och hos järn 13 % av ledningsförmågan hos koppar.)

Av det sagda framgår indirekt att en lednings överföringsförmåga är större ju högre spänning som användes. Å andra sidan medför en högre spänning större komplikationer i avseende på såväl materielens utförande som den personliga sii- kcrlieten. För normala bruksföremål användes av dessa anledningar en relativt låg spänning (110—220 V). För överföring till förbrukningsplatserna begagnas emellertid oftast en högre spänning. Ju större effekt som skall överföras och ju längre överföringsavstånden äro desto högre spänning användes. Växelströmrnen har härvidlag den stora fördelen framför likströmmen, att den kan transformeras från en spänning till en annan.

De i Sverige vanligaste spänningssystemen för lågspänning äro: 380/220 V: trefas växelspänning med 380 V mellan faserna (huvudspän- ning) och 220 V mellan fas och nolla (fasspänning),

3 X 220 V: trefas växelspänning utan nolla med 220 V mellan faserna, 220/127 V: analogt med förstnämnda, 220 V huvudspänning, 127 V fas- spänning samt 2 X 220 V: likspänning med 220 V mellan ytterpol och nolla, 440 V mellan ytterpolerna. Periodtalet för de i Sverige använda trefas växelströmssystemen är till den helt Övervägande delen 50 p/s (perioder per sekund). De elektrifierade järn- vägarna drivas med enfas växelström av 16% p/s.

Så länge endast likström stod till förfogande för överföring av elektrisk kraft voro anläggningarna för detaljdistribution rent lokala före- tag med mycket begränsad räckvidd. Kraftens väg från producent till kon— sument var därvid enkel, i det att förbindelsen mellan generator och för- brukningsapparat utgjordes av en enda strömkrets. Först genom växelström— men, som medförde möjlighet till upptransformering till höga spänningar för överföring på längre sträckor samt lokal nedtransformering till lämplig l'örbrukningsspänning, öppnades fältet för allmän distribution av kraft över större områden. Kraftens väg blev därigenom uppdelad på flera led, hop— kopplade över transformatorstationer.

Växelströmmen ger sålunda goda möjligheter att anpassa spänningen efter den transporterade effekten och överföringsavståndet, så att totalkostnaden för anläggningar och kraftförluster blir den lägsta möjliga. Härigenom sjun- ker kostnaden per kilowatt och kilometer väsentligt med ökad effekt. Det riktiga är därför, att kraftöverföringen så mycket som möjligt koncentreras och ordnas gemensamt för olika kraftleveranser. Detta leder till att man för kraftdistribution inom ett större område använder ett flertal över— och underordnade ledningsnät av olika spänning, sammankopplade medelst transformeringsanläggningar. Besparingen i fråga om ledningskostnader in- klusive förluster uppväger därvid de transformeringskostnader, som till- komma. Dock bör man naturligtvis icke onödigt öka antalet nättyper och spänningarna få väljas bland ett antal fastställda standardspänningar. Som exempel på hur kraftöverföringen är ordnad hänvisas till den schematiska framställningen i bild 1.

Det kan synas som om alltför många spänningssystem valts på olika håll för samma slag av ledningar. Detta beror emellertid huvudsakligen på tekni- kens ståndpunkt vid den tid då respektive nät började byggas.

Fjärröverföring och fördelning

Fördelningen av kraft inom de olika kraftverksområdena sker i första hand genom landslinje- och bygdenät, medan den under senare tid till- komna överföringen från de stora kraftkällorna i Norrland till konsum- tionsområdena i mellersta och södra Sverige ombesörjes genom ett stam— linjenät för högsta förekommande spänningar.

Landslinje- och bygdenäten byggdes ursprungligen i huvudsak enligt radialprincipen. Linjerna utgingo sålunda radiellt från en matande kraft- eller transformatorstation. Längs efter varje dylik linje placerades stationer för nedtransformering av spänningen för matning av nät av lägre ordning. även dessa med de utgående linjerna radiellt ordnade. Spänningsförhållande- na (härmed avses i detta sammanhang möjligheten att hålla spänningen konstant vid varierande belastning) inom dylika nät äro. om inga speciella

åtgärder vidtagas, mindre gynnsamma i det att spänningen sjunker ju längre ut i nätet man kommer och detta i högre grad ju högre belastningen är. Spänningsvariationerna bli därigenom stora för de längst ut i nätet befint— liga konsumenterna. Även reservmatningsmöjligheterna vid driftstörningar äro mindre goda. Vid exempelvis ett linjefel blir hela den del av linjen inklusive därifrån matade konsumentanläggningar, som ligger >>efter>> fel— stället, spänningslös tills felet är avhjälpt.

Landslinjenäten ha numera i stor utsträckning utvidgats och komplet- terats till masknätstyp, dvs. de enskilda linjerna utgöra förbindelseled— ningar i ett större masknät med flera inmatningspunkter. Härigenom ha skapats större möjligheter till gynnsamma spänningsförhållanden samt bättre reserv.

Bygdenäten —— liksom de därifrån matade näten av lägre ordning —— äro fortfarande till största delen ordnade enligt radialprincipen. Såväl spän- nings- som reservmatningsförhållandena i bygdenäten äro dock numera förbättrade tack vare de senaste decenniernas framsteg på kraftteknikens område. Sålunda regleras vanligen spänningen efter belastningen i den matande stationen, ofta automatiskt, så att Spänningsvariationerna i nätet bli så små som möjligt. Anordningar finnas också för spänningsreglering ute i linjerna, särskilt i långa eller hårt belastade dylika. Anordningar för att undanröja övergående fel utan störning av driften och för att automatiskt bortkoppla minsta möjliga del av näten vid bestående fel ävensom förbätt- rad standard på anläggningarna för att så långt möjligt undgå fel ha bidra- git till att höja driftsäkerheten för såväl bygdenäten som näten av högre ordning. Även om bygdelinjerna drivas som radiallinjer äro de numera ofta byggda som slingor eller som sammanbindningslinjer mellan olika matande stationer, vilket möjliggör reservmatning genom omkopplingar.

Karakteristiskt för stamlinjerna är naturligtvis i första hand den höga spänningen, vilken i och för sig, innan den kunde helt behärskas, medförde många svårlösta tekniska problem. Då stamlinjenätet har till huvudsaklig uppgift att överföra kraft från Norrland till mellersta och södra Sverige, där vattenkrafttillgången numera är helt otillräcklig, är det tydligt, att driftstörningar på detsamma kunna ha allvarliga konsekvenser för kraft- försörjningen inom landet. Det är ofrånkomligt att dylika störningar stun- dom inträffa (att helt undanröja störningsrisken är otänkbart eller skulle i varje fall leda till orimliga kostnader) men deras antal har nedbringats tack vare ett energiskt utnyttjande av teknikens resurser.

Stamlinjenätets driftspänning är 200 och 380 kV. De första stamlinjerna, vilka tillkommo före den tidpunkt då överföringen i större skala från Norr— land till mellersta Sverige blev aktuell, byggdes för 130 kV. Av 130 kV linjerna ha emellertid en del omlagts för drift med 200 kV, medan övriga 130 kV linjer numera i avseende på sin betydelse ha reducerats till lands- linjekaraktär.

Utvecklingen har på allra senaste tiden lett till att även 200 kV blivit en alltför knapp spänning för de nu och för framtiden aktuella överförings- behoven. De prognoser för kraftförbrukningen, som uppgjordes efter andra världskrigets slut, tydde på en stegring, som inom få år skulle nödvändig- göra att överföringssystemet utbyggdes med en ny, i genomsnitt 500 km lång 200 kV linje varje år. Detta föranledde undersökningar rörande möjlighe— terna att bygga ett överföringssystem med större kapacitet än 200 kV lin- jernas. Undersökningarna resulterade i att de senast färdigställda överfö- ringslinjerna från Norrland till mellersta Sverige utförts för en växelspän- ning av 380 kV. Ytterligare 380 kV linjer äro under byggnad, varför så småningom ett 380 kV nät kommer att utbildas.

I samband med ovannämnda undersökningar rörande »storkraftöverfö- ringen» har även övervägts användningen av högspänd likström, som ger vissa fördelar framför växelström. Denna strömart har dock av olika skäl ännu icke kunnat användas för de största kraftöverföringsprojekten men kommer däremot till användning för kraftöverföringen till Gotland.

Transformatorstationerna med tillhörande fördelningsställverk i stam— linje-, landslinje- och bygdenäten äro utförda på i princip samma sätt som motsvarande anläggningsdelar i kraftstationerna. De äro av naturliga skäl enklare ju lägre spänning och ju lägre genomgående effekt de äro byggda för.

Detalj distribution

Detaljdistributionsnäten äro väsentligt olika utformade i städer och på landsbygd, främst beroende på de skilda förutsättningarna med hänsyn till bebyggelsen men i vissa avseenden även på grund av historiska skäl. Led- ningarna i städer och andra större tätorter förläggas sålunda till huvudsak- lig del i gatorna i form av kablar, medan de på landsbygden nästan uteslu- tande byggas som luftledningar på stolpar. Även transformatorstationerna byggas i städerna ofta underjordiskt, t. ex. i gatorna eller i källarutrymmen tillhörande byggnader av olika slag. Detta är särskilt fallet i de medelstora och större städernas centralare delar och för övrigt där det är brist på lämp— liga tomtutrymmen. Där tomtutrymmen för stationer kunna ordnas, exem- pelvis i nyplanerade stadsområden, byggas stationerna vanligen i separata hus eller kiosker. På rena landsbygden däremot anordnas transformatorsta- tionerna oftast, då icke onormalt stora transformatorer erfordras eller andra speciella förhållanden råda, i ett par kraftiga ledningsstolpar med alla spän— ningsförande delar inklusive transformatorn på betryggande höjd över marken.

Om ovannämnda faktorer medföra förhållandevis lägre kostnader för landsbygdens eldistribution än för tätorternas, så medför å andra sidan den avsevärt lägre belastningstätheten (belastningen per geografisk yt- enhet) på landsbygden och de därav betingade större överföringsavstånden

och den sämre utnyttjningen av anläggningarna högre kostnader för lands— bygdsdistributionen jämfört med stadsdistributionen. Även inom lands- bygdsdistributionen variera kostnaderna avsevärt. Man får exempelvis räk— na med att vissa hushåll på landsbygden äro så avsides belägna, att en elektrifiering där överhuvudtaget icke kan genomföras till rimliga kost— nader.

De kortare överföringsavstånden och den högre utnyttjningcn av anlägg— ningarna inom städerna gör att man där har större möjligheter än på lands— bygden att vidtaga åtgärder för att höja driftsäkerheten. Sålunda äro stads— nätcn ofta utformade som masknät, medan landsbygdens detaljdistribu- tionsnät merendels äro radialmatade och oftast sakna reservmatningsmöj— ligheter. Stationernas utrustningar för skydd mot driftstörningar äro också som regel bättre i städerna än på landsbygden. Då därtill kommer att stör- ningsrisken är avsevärt högre på luftledningsnät än på jordkabelnät är det uppenbart, att förutsättningarna för störningsfri elkraftdistribution äro be- tydligt sämre på rena landsbygden än inom tätorterna.

...Strömarten för den detaljdistribuerade lågspänningskraften är såväl i städer som på landsbygd som regel trefas växelström.l många städer kvarstå emellertid sedan den ursprungliga elektrifieringen områden med likströms— distribution, merendels de centrala stadsdelarna. Likaledes förekommer det att lokala landsbygdsnät, vilka matas från någon äldre generatorstation utan anslutning till riksnätet, drivas med likström. Spänningsvalet är för detaljdistributionsnäten liksom för andra överföringsnät beroende av i första hand överförd effekt och överföringsavstånd. För ortsnäten i södra och mellersta Sverige är 3, 6 eller 10 kV den vanligaste spänningen, medan ortsnäten i de glesare bebyggda områdena i Norrland ofta drivas med 20 kV. Bland de standardiserade lågspänningssystemen ger 380/220 V systemet den högsta överföringsförmågan. Vid valet av lågspänning måste emellertid även hänsyn tagas till beröringsfaran.Denna är betydligt större vid 380/220 V än vid de lägre standardspänningarna. Med hänsyn till möjligheterna till god kvalitet på såväl installationer som förbrukningsapparater anses dock numera svårigheterna med nämnda spänning som i stort sett övervunna. Lågspänningssystemet 380/220 V torde därför numera allmänt anses som det lämpligaste för allmän distribution och användes också vid flertalet nyanläggningar.

Organisationer och myndigheter verksamma inom

elkraftförsörjningen

Bland de organisationer som äro verksamma inom elkraftförsörjningen må i första hand nämnas de kraftproducerande och kraftdistribuerande fö- retagen. För att tillvarataga kraftföretagens och konsumenternas gemen— samma intressen finnas ett antal samarbetsorgan, vilkas verksamhet är in-

riktad på olika områden av elkraftförsörjningen. Dessutom finnas förutom olika statliga myndigheter vissa av staten stödda eller auktoriserade institu- tioner, vilkas uppgift företrädesvis är av övervakande och kontrollerande art. I det följande redogöres i korthet för de viktigaste av ovannämnda or-. ganisationer och myndigheter.

Kraftföretag Statens vattenfallsverk

Statens vattenfallsverk är det största av de kraftproducerande företagen. Kraften alstras vid vattenkraftstationer, belägna i olika älvar från Lule älv i norr till Göta älv i söder samt i en ångkraftstation i Västerås. Därutöver sker kraftutbyte med företag, vari vattenfallsverket är delägare samt med, andra samkörande kraftföretag. Verket svarar för kraftförsörjningen såväl i mellersta Sverige i områdena kring Vänern, Vättern, Mälaren och Hjäl- maren som i stora delar av Norrland norr om Indalsälven. Vid årsskiftet 1952—1953 var den installerade effekten i egna kraftstationer 1 700 000 kW, varav huvudparten eller 1 480 000 kW i vattenkraftstationer. År 1952 pro- ducerades vid egna vattenkraftstationer 8000 milj. kWh och samma år uppgick den totalt omsatta energimängden till 8980 milj. kWh. Av detta energibelopp härrörde 490 milj. kth från kraftstationer, vari vattenfalls- verket endast är delägare eller vilkas produktion disponeras av vattenfalls— verket.

Vattenfallsverket är organiserat som ett fristående statligt affärsverk med ett centralt organ, vattenfallsstyrelsen, i Stockholm och förvaltningar ute i landet. Dessa äro sju kraftverksförvaltningar, nämligen Trollhätte, Motala, Västerås, Älvkarleby, Mellersta Norrlands, övre Norrlands och Norr— bottens kraftverk, Trollhätte kanalverk samt byggnadsavdelningar för de pågående kraftstations- och linjebyggnaderna samt sjöregleringarna. Kraftverksförvaltningarna handha drift, underhåll och mindre byggnads— arbeten för anläggningarna inom området samt svara för kraftförsäljningen och kontakten i övrigt med abonnenterna. De fyra kraftverksförvaltningar— na i Götaland och Svealand ha tidigare i olika sammanhang benämnts med ett gemensamt namn, Centralblocket, medan de tre norrländska kraftverks-l förvaltningarna benämnts Norrlandsblocket. Beträffande vattenfallsverkcts organisation se även 5. 341 samt bild 21.

De ungefärliga gränserna för vatt'enfallsverkets liksom för de största av de övriga kraftföretagens distributionsområden framgå av bild 2.

Kommunala Icraftföretag .

Av de rent kommunala kraftföretagen ombesörja en del såväl produktion som distribution av elkraft, under det att andra enbart distribuera från annat håll inköpt kraft. Många intaga en mellanställning genom att de kom- plettera egna kraftresurser med inköpt kraft. '-

Kraft AB Gullspång-7 Munkfors

Kanalerna-sens Kraft AB

Krångede AB

AB Skandinaviska Elverk med dotterbolag

Skellefteå Stads Kraftverk

Statens Vattenfallsverk

Trollhätte kraftverk Motala " Älvkarleby " Övre Norrlands " Norrbottens "

Stockholms Stads Elverk Stora. Kopparbergs Bergslags AB

Sydsvenska Kraft AB Uddeholm AB

Ingeredsfora Kraft AB

Bild 2. De. största kraftföretagens distributionsområden. (Detaljdistribationen handhaves inom områdena i varierande omfattning nu åter- försäljande detaljdistribulionsförelag)

Bland de kommunala företag, som själva producera sin energi, är Stockholms elektricitetsverk det största. Elverket förfogade vid årsskiftet 1£152——1953 över 175 000 kW i egna vattenkraftstationer i Indalsälven och Dalälven, är delägare i bl. a. Krångede aktiebolag och har dessutom en ängkraftstation på ca 100 000 kW. Under år 1952 omsatte elverket 1140 milj. kWh för så gott som enbart huvudstadens behov. Till de stora kom— munala kraftproducenterna hör även Skellefteå stads kraftverk, som har kraftstationer om sammanlagt 82 000 kW i Skellefte älv och en betydande kraftavsättning även utanför stadens område. Exempel på andra städer med betydande egen kraftproduktion äro Borås, Linköping, Norrköping och Umeå. Göteborg har tillgodosett sitt kraftbehov genom abonnemang hos statens vattenfallsverk. Malmö och några andra städer i södra Sverige ha ordnat sin krafttillförsel genom delägarskap i ett enskilt kraftföretag, Syd- svenska kraftaktiebolaget. I ett fåtal städer handhas kraftförsörjningen direkt av staten eller större enskilda kraftföretag.

Enskilda kraftföretag

Bland de större enskilda kraftföretagen äro att nämna Sydsvenska kraft- aktieholaget, Yngeredsfors kraftaktiebolag, Kraftaktiebolaget Gullspång- Munkfors, Krångede aktiebolag och Hammarforsens kraftaktieholag, vilka äro rena kraftföretag, samt Stora Kopparbergs bergslags aktiebolag och Ud- deholms aktiebolag, vilka driva kraftverksrörelsen som komplement till den huvudsakliga, industriella verksamheten. Härutöver må även nämnas Bergslagens gemensamma kraftförvaltning aktiebolag, som är delägare i och distributör av kraft från Krångede aktiebolag, samt Aktiebolaget Skan- dinaviska elverk, som genom olika dotterföretag bedriver kraftproduktion med kraftdistribution i olika delar av landet, bl. a. i Bohuslän, i Vänersborgs stad, i Småland och på Gotland.

Sydsvenska kraftaktieholaget förfogade vid årsskiftet 1952—1953 över vattenkraftstationer om sammanlagt 130 000 kW, varav huvuddelen i Lagan. och har dessutom genom delägarskap i Hjälta aktiebolag och Krångede aktiebolag samt långtidsabonnemang på kraft från ett par statliga kraft— stationer försäkrat sig om ett avsevärt krafttillskott från Norrland. Här- jämte disponeras bl. a. ett äldre och ett nyare ångkraftverk i Malmö (det senare under fortsatt utbyggnad) med en sammanlagd effekt av f.n. 135 000 ldV. Bolaget distribuerar kraft inom större delen av södra Sverige med en nordgräns ungefär i linjen Halmstad—Västervik. I stor utsträck- ning levereras kraften till kommunala elverk och till distributionsförening- ur, men bolaget har även en omfattande egen detaljdistribution. Totala ener- giomsättningen under år 1952 var 2 250 milj. kWh.

Yngeredsfors kraftaktiebolag har sin verksamhet förlagd till ett område utmed västkusten söder om Göteborg. Bolaget disponerade vid årsskiftet 1952—1953 över vattenkraftstationer, företrädesvis i Ätran, på samman-

lagt 22000 kW och ett ångkraftverk på 16000 kW. Energiomsättningen under år 1952 var drygt 150 milj. kWh.

Kraftaktiebolaget Gullspång-Munkfors svarar för huvuddelen av kraft- distributionen inom ett område norr om Vättern och öster om Vänern, inne- fattande bl. a. Örebro stad. Kraften erhålles företrädesvis från vattenkraft— stationer i Gullspångsälven, Svartälven och Ljusnan om sammanlagt 92 000 kW. Energiomsättningen under år 1952 var 410 milj. kWh.

Krångede aktiebolag äges dels av några stora industriföretag nämligen Korsnäs aktiebolag, Sandvikens jernverks aktiebolag, Fagersta bruks aktie— bolag och Aktiebolaget Svenska kullagerfabriken för Hofors bruk och dels av kraftföretagen Stockholms elektricitetsverk, Sydsvenska kraftaktiehola- get och Bergslagens gemensamma kraftförvaltning aktiebolag. Krångede— bolaget förser huvudsakligen sina delägare med råkraft. Det ägde vid års- skiftet 1952—1953 kraftstationer huvudsakligen i Indalsälven på samman- lagt 315 000 kW samt ett ledningsnät för överföring till de delägande före— tagen. Under uthyggnad äro två stationer i Faxälven om tillhopa 250 000 ldV. Bolaget hade år 1952 en energiomsättning av 2 490 milj. kWh och pro— ducerade 12 % av landets totala kraftproduktion.

Hammarforsens kraftaktieholag tillgodoser kraftbehovet för en stor del av cellulosaindustrierna i mellersta och södra Norrlands kustland samt för städerna Sundsvall och Härnösand. Kraften erhålles huvudsakligen från en kraftstation i Indalsälven på 78 000 kW. Under 1952 omsatte bolaget ] 120 milj. kWh.

Stora Kopparbergs bergslags aktiebolag är det dominerande företaget inom Dalarna. Bolaget har flera stora kraftstationer i Dalälven och dispo- nerade vid årsskiftet 1952—1953 över 165 000 ldV i hydroelektrisk effekt samt 15 000 kW i direktdrivande vattenkraft. Några anläggningar av större betydelse för värmekraftproduktion finnas ej. Omsättningen av elektrisk energi under 1952 var 1 020 milj. kX'Vh. Kraften användes till större delen för egna järnverk, trämasse— och pappersfabriker samt för elektrokemisk industri.

Uddeholms aktiebolag svarar för kraftförsörjningen inom större delen av Värmland. Bolaget hade vid årsskiftet 1952—1953 vattenkraftstationer om sammanlagt 137 000 kW, de flesta i Klarälven. Dessutom disponeras 17 000 kW ångkraftmaskineri huvudsakligen för mottrycksdrift. Den omsatta ener- gin, som under 1952 var 790 milj. kWh _ varav 38 milj. producerades av ångkraft genom mottrycksdrift —- användes till större delen för bolagets järnverk, trämassefabriker och elektrokemisk industri.

Samarbets- och intresseorganisationer Centrala driftledningen (CDL) CDL, som bildades år 1934, är en på frivillighetens grund uppbyggd organisation, varom överenskommelse träffats mellan vattenfallsstyrelsen

och de åtta största kommunala och enskilda kraftföretagen under med— verkan av beredskaps- och militärmyndigheterna. Den var ursprungligen avsedd att träda i verksamhet under förstärkt försvarsberedskap, vid mobi— lisering eller när Kungl. Maj :t eljest förordnade därom. De i CDL represente— rade kraftföretagen, de s.k. CDL-företagen, äro statens vattenfallsverk, Ham— marforsens kraftaktieholag, Kraftaktiebolaget Gullspång—Munkfors, Krång— ede aktiebolag, Stockholms elektricitetsverk,Stora Kopparbergs bergslags ak— tiebolag. Sydsvenska kraftaktieholaget, Uddeholms aktiebolag samt Aktiebola- get Gotlands kraftverk (det senare ett dotterföretag till Aktiebolaget Skan- dinaviska elverk). Chef för CDL är vattenfallsstyrelsens generaldirektör. Chefen för CDL är ensam beslutande för att organisationen skall tillför- säkras tillräcklig handlingskraft under krigsförhållanden. Det verkställande och utredande organet inom CDL är en riksdriftbyrå, som är organiserad av vattenfallsstyrelsen med personal huvudsakligen från dess driftbyrå. Denna personal utövar sina CDL-funktioner vid sidan om sina ordinarie arbetsuppgifter inom vattenfallsstyrelsen.

Beträffande CDL:s uppgifter, speciellt den fredsmässiga sidan av verk— samheten, hänvisas till den utförligare behandlingen i kap. 8.

Varje CDL-företag har organiserat en motsvarande driftledning inom sitt område (elblock), benämnd blockdriftledning (BDL), i vilken de s. k. BBL-företagen ingå. På det sättet kommer organisationen att omspänna alla kraftföretag av betydenhet i landet. Varje CDL— respektive BBL—företag svarar för sina egna av samarbetet betingade omkostnader.

Den för CDL gällande organisationsplanen och instruktionen fastställdes ursprungligen den 27 november 1934 i enlighet med då föreliggande plan för förberedelser för den elektriska kraftförsörjningen vid krig eller krigs— fara samt i enlighet med den överenskommelse om samarbete, huvudsak- ligen under krisförhållanden, som då träffades mellan de stora kraftföre- tagen. Organisationsplanen har därefter med ledning av under åren vunna erfarenheter modifierats i vissa detaljer, huvudsakligen i samband med till- komsten och utvecklingen av stamlinjenätet. Åren 1938 och 1939 komplette- rades den centrala organisationsplanen med lokalt upprättade planer inom varje elblock. År 1944 träffades mellan de nio CDL-företagen en ny överens— kommelse om fortsatt verksamhet även under normala förhållanden med uppgift för CDL »att verka för en rationellt ordnad kraftproduktion och kraftdistribution inom landet».

Svenska elverksföreningen

Svenska elverksföreningen, som är den äldsta rikssammanslutningen på hithörande område, började sin verksamhet är 1903. Dess bildande hade dryftats långt tidigare men blev särskilt aktuellt i samband med tillkomsten av 1902 års lag om elektriska anläggningar. Antalet medlemmar är för när- varande ca 200, innefattande alla stadselverk utom ett 20-tal av de allra

minsta, ett antal elverk i köpingar och andra större tätorter samt omkring 40 större eller medelstora kraftföretag, bland vilka må nämnas statens vat— tenfallsverk och samtliga övriga CDL-företag.

Föreningen verkar bl. a. genom att göra utredningar i frågor av gemen- samt intresse, ordna utbyte av erfarenheter mellan medlemmarna, hålla möten med föredrag och diskussioner, insamla statistik, utgiva handlingar och andra publikationer samt samarbeta med in- och utländska samman- slutningar och institutioner. Vid upprepade tillfällen har frågan om säker- hetsföreskrifter och i samband därmed entreprenörs— och installatörsprohlc— men utretts. På tariffområdet har föreningen spelat en ledande roll, liksom i det med modern distributionspraxis förknippade tekniska utrednings— och utvecklingsarbetet. Juridiska, administrativa och kvalitetsforskningsfrågor ha vidare bearbetats liksom även redovisnings-, bokförings— och littererings— frågor.

Genom en särskild tariffkommission med förlikningsuppdrag medverkar föreningen i den statliga regleringen av priset för elektrisk ström.

Kostnaderna för elverksföreningens verksamhet bestridas helt av med- lemmarna. Någon affärsverksamhet utövas ej.

Svenska vattenkraftföreningen

Svenska vattenkraftföreningen bildades år 1909 bl. a. med anledning av de då pågående vattenfallsprocesserna. Medlemmar äro bl. a. praktiskt taget alla större icke statliga vattenkraftproducenter. Föreningen har till ända- mål att befrämja ett rationellt utnyttjande av landets vattenkraft genom att bidraga till kännedom om tillgången på vattenkraft samt om sätt och medel att tekniskt och ändamålsenligt tillgodogöra denna, genom att stödja genomförandet av nationalekonomiskt berättigade regleringar av sjöar och floder samt genom att verka för upplysning i dylika frågor.

Föreningen utger publikationer, verkställer utredningar och undersök- ningar samt besvarar förfrågningar rörande allmänna vattenkraftförhål- landen, sammanför intresserade till överläggningar samt tillvaratar de icke statliga vatenkraftägarnas allmänna intressen hos myndigheter m.m. Kostnaderna för föreningens verksamhet bestridas helt av medlemmarna. Någon affärsverksamhet utövas ej.

Föreningen för elektricitetens rationella användning (Fera)

Fera är ett samordnande och rådgivande organ för upplysningsverksam- het i fråga om elektriciteten och dess utnyttjande. Föreningen, som bildades 1927, har till ändamål att verka för mångsidigare och bättre utnyttjande av elektrisk energi genom att sprida kunskap om elektricitetens möjligheter och rationella användning samt att genom upplysningsverksamhet befordra utvecklingen inom det elektriska området och förebygga misstag och olycks- fall. För detta ändamål utger föreningen tre tidskrifter, Era, Joel och El,

alla i betydande upplagor, och framställer härjämte ett stort antal andra publikationer och upplysningsmaterial av olika slag. Fera anordnar även kurser, föreläsningar och utställningar, exempelvis för att belysa elektrici- tetens användning i hushåll och hantverk.

I Fera samverka statliga, kommunala och privata elektriska intressen genom de sex medlemmarna Svenska elverksföreningen, Sveriges elektro- industriförening, Elektriska engrossistföreningen, Sveriges elektriska entre— prenörsförening, Svenska föreningen för ljuskultur och Elgrossisternas för- ening. Fera samarbetar med lokala föreningar med liknande syften på olika platser i landet.

Fera är en ideell förening, som finansieras genom årsavgifter från med- lemsorganisationerna, inkomster från försäljning av trycksaker och annat upplysningsmaterial samt genom tillfälliga anslag från de olika intressen- terna för speciell upplysningsverksamhet.

Svenska brandskyddsföreningens elektriska nämnd

De större brandförsäkringsanstalterna i landet ha träffat överenskom- melse om tillsättande av en nämnd, Svenska brandskyddsföreningens elekt- riska nämnd. Denna nämnd har att utöva kontroll över revisionsbesikt— ningar av elektriska anläggningar. Dessa besiktningar skola utföras enligt i försäkringsanstalternas överenskommelse angivna former.

Nämnden består av åtta ledamöter, av vilka tre äro representanter för Svenska brandskyddsföreningen. En av ledamöterna skall representera det elektriska säkerhetsväsendet och tillika vara ordförande i nämnden. Nämn- den tillkommer bl. a. att utse revisionsbesiktningsmän. Kostnaderna för nämndens verksamhet fördelas på deltagarna i ovannämnda överenskom- melse.

Sammanslutningar med konsulterande verksamhet

Ett flertal sammanslutningar med konsulterande verksamhet rörande elektrifieringsfrågor finnas. Bland dessa märkas elektriska länsföreningar samt Riksförbundet landsbygdens folk (RLF). Dessa sammanslutningars verksamhet berör i huvudsak landsbygden och kommer att närmare be- handlas i kap. 11 i samband med frågan om företagens tillgång till teknisk och ekonomisk sakkunskap.

Bland övriga organisationer med konsulterande verksamhet märkas Södra Sveriges ångpanneförening samt Mellersta och Norra Sveriges ångpanne- förening, vilka bland sina medlemmar huvudsakligen räkna industriföretag och olika offentliga inrättningar. Ångpanneföreningarnas konsulentverk— samhet bedrives på flera håll i samarbete med vederbörande elektriska länsförening.

Statliga myndigheter och av staten stödda

eller auktoriserade institutioner

Statsdepartementen

Handläggningen inom Kungl. Maj:ts kansli av förvaltningsärenden, som ha samband med elkraftförsörjningen, tillkommer olika departement.

Kommunikationsdepartementet handlägger ärenden rörande expropria— tion och koncession samt statens vattenfall och deras tillgodogörande, i den mån dessa ärenden ej tillhöra annat departement.

Finansdepartementet handlägger ärenden rörande kommunala borgens- åtaganden samt kommunal upplåning för elektrifieringsföretag.

Jordbruksdepartementet handlägger ärenden rörande landsbygdens elektrifiering samt tillämpning av vattenlagen, utom i vad angår vatten— domstolarna och deras personal.

Handelsdepartementet handlägger ärenden rörande materielprovning.

Kommerskollegium

Kommerskollegii elektriska byrå handlägger de ärenden, som ankomma på kollegium såsom chefsmyndighet för statens elektriska inspektion, samt ärenden angående säkerhetsföreskrifter för elektriska starkströmsanlägg— ningar; tillstånd att utföra och nyttja elektriska starkströmsanläggningar; statslån för vattenkraftanläggningar och elektriska distributionsanlägg— ningar; kommunala borgensåtaganden samt kommunal upplåning för elek— trifieringsföretag ; registrering av elektriska starkströmsanläggningar ; reg- lering av priset på elektrisk kraft; kontroll av elektrisk materiel; behörig— het att utföra elektriska starkströmsanläggningar samt yrkesutbildningen på området ävensom övriga ärenden, som angå det elektriska kontroll- väsendet eller elektriska anläggningar i allmänhet.

Statens elektriska inspektion

Inspektionen sorterar under kommunikationsdepartementet, men har kommerskollegium till chefsmyndighet. Den är indelad i fyra inspektions- distrikt, nämligen norra, södra, östra och västra med en överinspektör för varje distrikt. Samtliga inspektörer och den inom inspektionen i övrigt tjänstgörande personalen äro stationerade i Stockholm.

Det åligger befattningshavare inom inspektionen att med uppmärksamhet följa starkströmsteknikens utveckling samt de åtgärder, som inom och utom riket vidtagas för främjande av dess praktiska tillämpning och av skydd mot de med sådana anläggningar förenade farorna. Överinspektör skall vid behov biträda kommerskollegium vid beredning av visst ärende inom om— rådet för hans särskilda sakkunskap. överinspektör har även i egenskap av specialinspektör inom yrkesinspektionen att öva tillsyn över efterlevna- den av lagen den 3 januari 1949 om arbetarskydd och med stöd av den—

samma meddelade föreskrifter i vad angår skydd mot olycksfall genom in— verkan av elektrisk ström vid elektriska starkströmsanläggningar.

Statens prisregleringsnämnd för elektrisk ström

Reglering av priset på elektrisk ström kan sedan 1938 ske jämlikt 2 & i lagen den 27 juni 1902 innefattande vissa bestämmelser om elektriska anläggningar.

Prisregleringen verkställes av en särskild nämnd bestående av fem av Kungl. Maj:t för viss tid förordnade ledamöter. Vid förordnandet av leda- möter skall tillses, att såväl leverantörintressena som förbrukarintressena bli representerade.

Elektrifieringsberedningen

Elektrifieringsberedningen tillsattes år 1941. Den har till uppgift att taga den befattning med ärenden angående statsbidrag till landsbygdens elektri— fiering, som av Kungl. Maj:t närmare bestämmes. I brev till beredningen den 30 december 1947 har Kungl. Maj:t uppdragit åt beredningen att tills vidare från och med den 15 januari 1948 pröva och avgöra ansökningar an— gående statsbidrag till befrämjande av landsbygdens elektrifiering. Bered— ningen äger till prövning upptaga jämväl fråga om att ändra av Kungl. Maj:t eller beredningen fastställda villkor för åtnjutande och lyftande av bidrag. I uppdraget innefattas emellertid icke ärenden angående framställ— ningar av länsstyrelse om medel till undersökningar rörande elektrifiering av länens landsbygd m. m. eller ansökningar avseende statsbidrag åt elekt- riska länsföreningar till deras allmänna verksamhet.

Elektrifieringsberedningen består av fyra ledamöter förordnade av Kungl. Maj:t. Kostnaderna för beredningens verksamhet bestridas av anslaget till befrämjande av landsbygdens elektrifiering.

Vattenfallsstyrelsen

Vattenfallsstyrelsen åligger

a tt såsom styrelse för statens vattenfallsverk ombesörja förvaltningen av därtill hörande egendom och affärsrörelse samt utförandet av därtill hö- rande anläggningar;

a t t föreslå samt efter Kungl. Maj:ts därtill lämnade bemyndigande vidtaga åtgärder, ägnade att främja tillgodogörandet av vattenkraften inom landet;

a tt föreslå och i mån av befogenhet vidtaga åtgärder för åstadkomman- de av en rationell tillförsel av elektrisk kraft till sådana delar av landet, där statens ingripande i detta avseende prövas lämpligt; samt

a t t bevaka statens rätt och bästa, då staten ingått såsom delägare i före— tag, avseende tillgodogörande av vattenfall eller användning av kraft från staten tillhörigt kraftverk, så ock i andra företag, i vilka styrelsen för sta— tens räkning kan bliva intresserad.

Riksnämnden, som år 1947 efterträdde den tidigare rikskommissionen, är under Kungl. Maj:t centralorgan för landets ekonomiska försvarsberedskap och handhar i denna egenskap vissa beredskapsuppgifter bl. a. på kraftför— sörjningsområdet. Efter bränslekommissionens avveckling ankomma så- lunda exempelvis förberedelserna för en reglering av konsumtionen av el— kraft på riksnämnden. De beredskapsuppgifter på kraftförsörjningsområ— det, som avse produktion och distribution, torde huvudsakligen överlåtas på Centrala driftledningen.

Krigsskyddsnämnden för kraftanläggningar

Krigsskyddsnämnden bildades år 1942 i enlighet med lagen den 12 juni 1942 om särskilda skyddsåtgärder för vissa kraftanläggningar (SFS 335/ 1942). Det åligger nämnden att handlägga ärenden om åtgärder till skydd för anläggningar av väsentlig betydelse för kraftförsörjningen mot skador genom luftanfall eller annan krigshandling eller sabotage. Nämnden består av en lagfaren ordförande, en representant för försvarsstaben, en för civil— försvarsstyrelsen, en för vattenfallsstyrelsen och en för kommunala och enskilda kraftföretag.

Elskattenämnden

Elskattenämnden tillkom år 1951 i samband med att skatt å elektrisk kraft beslutades (SFS 375/1951). Den har till uppgift att till kontroll- styrelsen avgiva yttrande och förslag i ärenden rörande elskatt. Kontroll- styrelsen är skyldig att höra nämnden i alla frågor av principiell betydelse eller eljest av större vikt. Nämnden består av ordförande, som skall vara eller ha varit domare i överrätt, en representant för kontrollstyrelsen, en för kommerskollegium, en för Svenska elverksföreningen samt en för för- brukare av elektrisk kraft. Förbrukarrepresentanten växlar efter ärendenas olika beskaffenhet.

Sveriges standardiseringskommission (SIS) och Svenska elektriska kommissionen (SEK)

Sveriges standardiseringskommission, som tillkom år 1922, har till upp- gift

att väcka intresse för och befordra en riktigt avvägd standardisering inom svenskt näringsliv samt medverka till att erforderliga undersökningar och arbeten härför utföras;

att utgöra centralorganisation för standardiseringsarbetena inom lan- det samt uppdela och avgränsa verksamhetsområdet mellan olika kommit- téer och andra organisationer, som ombesörja utförandet av hithörande arbeten;

a tt övervaka att inom berörda organisationer nödig uppmärksamhet ägnas åt vikten av internationell överensstämmelse i fråga om standardise- ring;

a t t efter behörig prövning såsom svensk standard fastställa av nämnda organisationer utarbetade förslag; samt

att verka för att fastställd standard kommer till användning inom sta- tens och kommunernas verk och inrättningar samt inom näringslivets olika grenar.

Kommissionen består av en av Kungl. Maj:t förordnad ordförande, en verkställande ledamot, en vice verkställande ledamot samt i övrigt av minst trettio och högst sextio ledamöter. För kommissionens verksamhet utgår statsanslag.

Till Sveriges standardiseringskommission är ansluten bl. a. Svenska elektriska kommissionen, som erhöll sin nuvarande form är 1937 och sedan dess har till uppgift

a t t utgöra en svensk elektroteknisk centralorganisation med uppgift att omhänderha det elektriska standardiseringsarbetet, dvs. utarbeta normer i vidsträckt bemärkelse, såsom definitioner, klassificering, dimensions- och kvalitetsbestämmelser samt anvisningar för utförande, provning och an— vändning av elektrisk materiel;

a t t samarbeta med in— och utländska organisationer med ovan angivna och liknande arbetsuppgifter samt att utgöra den svenska nationalkom- mittén av International Electrotechnical Commission (IEC); samt

att förelägga Sveriges standardiseringskommission (SIS) normer för fastställelse.

SEK arbetar bl. a. genom sakkunnignämnder och normkommittéer. De förstnämnda, vilka skola bestå av erfarna fackmän, tillsättas årligen av SEKzs fullmäktige och ha till uppgift att granska och avgiva yttranden om normförslag eller behandla andra därmed sammanhängande frågor. Norm- kommittéer tillsättas vid behov av SEK:s styrelse med uppdrag att utarbeta eller förbereda normförslag. SEK finansieras dels genom andel i SIS” stats— anslag, dels genom bidrag från i första hand elektroindustriföreningen och elverksföreningen.

Svenska elektriska materielkontrollanstalten (Semko)

Genom samverkan mellan Svenska elverksföreningen, Svenska brand— skyddsföreningen och Sveriges elektroindustriförening bedrives provnings— verksamhet på installationsmaterielområdet. Verksamheten handhas av ett aktiebolag, Svenska elektriska materielkontrollanstalten (Semko), som hör- jade en provningsverksamhet år 1928. I samband med det elektriska kon- trollväsendets omorganisation 1933—1936 auktoriserades den av Semko drivna provningsanstalten av staten. Kommerskollegium erhöll samtidigt

bemyndigande att utfärda bestämmelser om provningstvång, innebärande användnings- och försäljningsförbud av materiel, som icke provats och god- känts av Semko. Dylikt provningstvång gäller nu för de viktigaste grup- perna av installationsmateriel och bruksföremål. Kostnaderna för prov- ningsanstaltens verksamhet bestridas helt genom provningsavgifter. Den tekniska ledningen av anstalten omhänderhas av en särskild nämnd på femton personer, varav Kungl. Maj:t utser ordförande och åtta ledamöter och de tre delägarföreningarna vardera två ledamöter.

Jordbrukstekniska institutet

Jordbrukstekniska institutet har till uppgift bl. a. att utföra vetenskaplig. teknisk och ekonomisk forskning beträffande jordbrukets mekaniska och elektriska hjälpmedel och deras rationella användning samt att, i den mån arbetet i övrigt det tillåter, verkställa undersökningar på det jordbrukstek— niska området åt enskilda.

Institutets verksamhet regleras av ett avtal av den 1 september 1945 mellan Kungl. Maj:t och Jordbrukstekniska föreningen. Enligt detta avtal, som gäller till den 1 juli 1955, förbinder sig Kungl. Maj:t att genom årliga anslag bidraga till bestridandet av kostnaderna för institutets verksamhet. Institutets angelägenheter handhas av en styrelse, bestående av ordförande och åtta ledamöter. Kungl. Maj :t förordnar ordförande jämte fyra ledamöter och Jordbrukstekniska föreningen utser fyra ledamöter.

Kap. 2. Elkraftförsörjningens utveckling

Elkraften kom efter århundradens experimenterande först på 1870-talet till praktisk användning och därvid till en början enbart för belysning. Se- dan denna tid har utvecklingen på elektricitetens område gått raskt, så att i våra dagar användningen av och därmed även försörjningen med elektrisk energi är av fundamental betydelse.

I det följande skall först lämnas en allmän redogörelse för elektrifie- ringens utveckling, för den successiva, ehuru icke fullt kontinuerliga an- passningen av vårt näringsliv och vår dagliga levnad till de betingelser, som användningen av den elektriska energiformen för med sig, samt den därmed sammanhängande utbyggnaden av våra anläggningar för produktion och distribution av elektrisk energi. Nämnda utveckling, som i första hand är betingad av de tekniska framsteg, som möjliggjort elkraftens användning för olika ändamål samt dess framställning i allt större skala, överföring på allt längre avstånd och försäljning till allt lägre pris, bör även ses mot bakgrunden av samtida, betydelsefulla händelser av politisk, social och eko— nomisk karaktär. Efter den allmänna översikterf lämnas en kompletterande redogörelse för vissa förhållanden, som känneteckna elektrifieringens ut- veckling i städerna respektive på landsbygden samt tariffutvecklingen. För att ge en uppfattning om den rent kvantitativa utvecklingen inom såväl elkraftkonsumtionen som -produktionen och -distributionen visas, utan något särskilt omnämnande i texten, diagrammen i bilderna 3——_7.

Allmän redogörelse

Man kan urskilja sex olika skeden i den hittillsvarande utvecklingen, låt vara att tidsgränserna ej exakt kunna anges.

Det första skedet, som började med elektricitetens tidigaste utnyttjande för praktiskt ändamål under senare delen av 1870—talet, varade fram till början av 1890-talet. Under detta skede användes elektricitet nästan uteslu- tande för belysning och alstrades så gott som helt av ångkraft. Kraftanlägg- ningarna voro små och överföringsavstånden korta.

Redan på 1860—talet uppmonterades i vårt land, särskilt i Stockholm vid festliga tillfällen, elektriska »solar» och lampor av olika slag. De erhöllo emellertid i samtliga fall sin elektriska energi från galvaniska element eller batterier och voro därför av mycket blygsam effekt. Först när det blev möj- ligt att framställa elektrisk energi genom roterande maskiner kunde effekten ökas, så att den elektriska belysningen blev effektiv och kunde få praktisk betydelse.

/

4 000 STÖRRE DWSTRI

/Y/l///////l/1/ exkl. elkemisk och ät

/ ”” AQ * 1 % i ' EXIMX sx oca E TERMISK nms X **xxxai L xm'xx

O . 1920 25 30 55 40 45

Bild 3. Elkr'af'tkonsumlionen åren 1920—1952 exkl. elektriska ångpannor och export. (Enl. kommerskollegii industristatistik)

Under 1880-talet byggdes i landet en mängd elektriska anläggningar, samtliga avsedda för belysning inom ett mycket begränsat avstånd från kraftkällan. Göteborg blev den första svenska stad, som fick en distribu- tionscentral (år 1884), varifrån ström levererades till allmänheten och för gatubelysning. Under samma årtionde tillkom en inhemsk industri för till— verkning av elektrisk materiel. År 1883 konstituerades sålunda Elektriska aktiebolaget i Stockholm, som sedermera (1891) ombildades till Allmänna svenska elektriska aktiebolaget, Asea. Även andra svenska firmor började tillverka elmateriel.

Våren 1885 ordnade Tekniska samfundet i Göteborg en elektrisk utställ-

ning, där åtskilliga nykonstruktioner i fråga om bl. a. elektriska genera— torer visades. Det har beräknats att den tillgängliga effekten från samtliga generatorer i landet vid denna tid utgjorde 550 kW. Den alstrades till över— vägande delen av ångkraft och användes nästan uteslutande för belysning. Drygt hälften disponerades av industrier, bl. a. vid sågverk, där det nya be- lysningssättet särskilt uppskattades på grund av den minskade brandrisken. Flertalet anläggningar voro belägna i Stockholm och Göteborg.

Det andra skedet i elkraftförsörjningens utveckling sträckte sig från 1890— talets början till omkring år 1906. Det karakteriseras främst av en snabb utveckling i elkraftens användning och inom kraftöverföringstekniken samt av att vattenkraften började alltmera användas för att mot slutet av skedet vara den dominerande kraftkällan för elförsörjningen.

På 1890-talet började elektriciteten på allvar tagas i anspråk även för in— dustriellt bruk såsom för drift av pappersmaskiner och valsverk samt för elektriska ugnar. Ett pionjärarbete härvidlag var elektrifieringen för vals- verksdrift vid Hofors 1894——1895. Vid denna tid började elektriciteten även användas för järnvägsdrift. De först elektrifierade järnvägarna utgjordes av några kortare bansträckor, utnyttjade för interna transporter. År 1895 öppnades den första elektriskt drivna järnvägen för allmän persontrafik, Stockholm—Djursholm.

Den viktiga händelse, som främst motiverar påståendet om ett nytt skede, var uppfinningen av det elektriska trefassystemet, vartill svensken Jonas Wenström verksamt bidragit genom sitt år 1889 erhållna patent på »anord- ningar för omsättning och spridning av arbete genom användning av tre elektriska växelströmmar». Genom trefassystemet blev det möjligt att över- föra stora kraftmängder över långa avstånd, varigenom avlägsna kraft- källor började kunna utnyttjas. Det var också nu som vattenkraften började få sin stora betydelse för vår kraftförsörjning.

Den svenska vattenkraften har gamla anor som drivkraft. Redan några av våra landskapslagar bära vittne om att äganderätt till vattenfall tillmät- tes Värde. På 1400- och 1500-talen finna vi vattenkraften som ett av de bety- delsefullaste hjälpmedlen till den inhemska järnindustrin. Vattenkraften utnyttjades emellertid under mycket enkla former ända tills man på 1870- talet mera allmänt började bruka vattenturbiner, fortfarande dock för direktdrift. År 1882 kom den första hydroelektriska anläggningen nämligen vid Rydals bomullsspinneri i Seglora socken vid Viskan, där 3 hk effekt ut— togs från en större turbins axel och fick driva en generator.

Genombrottet för vattenkraftens moderna utnyttjande kom emellertid, som nämnts, först sedan trefassystemet gjort det möjligt att överföra större kraftmängder över längre avstånd. Som epokgörande kan betecknas kraft- överföringen från Grängesbergsbolagets vattenkraftstation vid Hellsjö bruks- fall till gruvorna vid Grängesberg, en sträcka på 12 km. Överföringsspän- ningen var 9,5 kV, systemet trefas och den överförda effekten 300 hk.

Vattenleafttillgång under normalår

J generering Hela la?/ ”E% [(J—4

5 000 Eheldlda och l/kannunala förr-etag

Xl

&

Xl

/ Statens vattenfallsverk / /-—”N,_/ 0 . 1950 55 40 45 50

Bild 4. Elkraflförbrukningen och vattenkrafttillgången åren 1928—1952. (Enl.CDL)

Medan 20 % av landets förbrukade elkraft år 1885 alstrades av vatten- kraft och 80 % av ångkraft, voro år 1906 motsvarande siffror 70 respektive 30 %.

Det tredje skedet, vilket började omkring år 1906 och sträckte sig fram till början av 1920-talet, markeras av tillkomsten av flera stora kraftdistri- butionsföretag och statens framträdande som företagare på kraftområdet samt av landsbygdselektrifieringens början och första kraftiga utvecklings- period. '

Efter den internationella depressionen under seklets första år, kännbar även för det svenska näringslivet, följde ett uppsving och en utökning av våra industriella resurser, som krävde en stark utökning av landets energi— försörjning. Elektriciteten hade redan tidigare visat sig lämplig för såväl belysning som maskinell drift. Den började nu i allt större omfattning att

% i i i l #

bli efterfrågad på sådana platser och för sådana ändamål, där den i pris- hänseende kunde konkurrera med övriga energiformer. Detta var till en början endast vid de större industrierna samt i städerna och de mest tät- bebyggda landsbygdsområdena.

År 1906 påbörjades statens kraftstation vid Trollhättan i Göta älv, Syd- svenska kraftaktiebolagets anläggningar vid Knäred m. fl. platser i Lagan, Hemsjö kraftaktiebolags1 första kraftstation i Mörrumsån samt Kraftaktie- bolaget Gullspång—Munkfors anläggning nära Gullspångsälvens utlopp i Vä- nern. Redan under åren dessförinnan hade Finsjö kraftaktiebolag samt Yngeredsfors kraftaktiebolag igångsatt utbyggandet av Finsjöfallen i Emån respektive Yngeredsforsen i Ätran. De till samtliga dessa verk anslutna kraftnäten fingo redan från början en relativt stor utbredning, och verksam- heten var inriktad på att inom rimliga gränser tillgodose alla uppkom— mande kraftbehov inom vederbörande verksamhetsområden.

Beträffande Trollhättefallens utbyggande' hade enskilda förslag till an- läggande av en kraftstation väckt frågan om statens rättigheter till vatten- kraften. Frågan löstes efter en långvarig process genom högsta domstolens utslag år 1901. Staten tillerkändes därvid större delen av vattenrätten i Trollhättefallen. Efter diverse utredningar beträffande hur statens fastig- heter vid Trollhättan skulle förvaltas inrättades år 1905 styrelsen för Troll- hätte kanal- och vattenverk, som enligt sin instruktion skulle förvalta sta— tens egendom vid Trollhättan och till landets bästa tillgodogöra den mäk- tiga tillgången på vattenkraft i Trollhätte strömmar. Den 9 maj 1906 god- kände riksdagen ett av den nytillsatta styrelsen utarbetat förslag angående de väsentligaste principfrågorna om Trollhättefallens utnyttjande, bl. a. rörande inköp av den privatägda delen av vattenrätten, samt att staten själv skulle ställa sig som företagare. År 1909 ombildades styrelsen för Trollhätte kanal- och vattenverk till Kungl. vattenfallsstyrelsen. Den 9 maj 1906 har betecknats som en bemärkelsedag i Sveriges elkrafthistoria, ty då lades en fast grundsten till statens kraftförsörjningsverksamhet.

Ehuru vattenkraftens dominerande ställning såsom kraftkälla ytterligare befästes under loppet av tredje skedet, spelade ångkraften dock en bety- dande roll. Man började betrakta ångkraft såsom ett värdefullt komple- ment till vattenkraft genom att ångkraftcentraler kunde svara för reserv— och toppkraftalstringen inom ett samkörande nät och sålunda göra den utbyggda vattenkraften värdefullare. De större kraftföretagen började också göra ekonomiska beräkningar över gynnsammaste fördelning vattenkraft- ångkraft. Bland de ångkraftcentraler, som under detta skede byggdes med ledning av dylika bedömanden, må nämnas Sydsvenska kraftaktiebolagets anläggning i Malmö och statens vattenfallsverks anläggning i Västerås. Stockholms elverk hade vid byggandet av en ny större ångkraftcentral

1 Hemsjö kraftaktiebolag uppgick år 1920 i Sydsvenska kraftaktiebolaget.

11115. kWh/år

KONDEZNSKRAET m .m . MUPTRYCKSKPJLFT

Vännen-artens andel av den totala kraft- produktionen

Kondensla'af't | 1 %

O 0 1940 50 Bild 5. Jämförelse mellan uallenkrafl- och värmelcraftprodllklionen åren 1940— 1952. (Enl. CDL)

förutsett att denna senare skulle utgöra reserv för redan planerade vatten- kraftanläggningar. Även förbränningsmotorer, vilka vid sekelskiftet börjat in en viss användning för elkraftalstring inom industrin och stadselverken, blevo under detta skede i ökad omfattning utnyttjade bl. a. för reservdrift.

Då trefassystemet infördes i vårt land ägnade man ringa intresse åt valet av periodtal. Följden blev att man i början av 1900-talet i Sverige hade ett flertal olika periodtal, av vilka emellertid 50 p/s redan då var förhärskande. Periodtalet 25, som senare kom att spela så stor roll, infördes av Stockholms elverk i samband med att den nya ångkraftcentralen år 1903 togs i drift. Vid planerandet av Trollhätteverkct blev periodtalsfrågan föremål för nog- grann prövning, vilken även här resulterade i att 25 p/s valdes. Beslutet rö- rande Trollhättan medförde att det 25-periodiga systemet infördes även på andra håll, bl. a. vid Uddeholms anläggningar och vid statens kraftstation i Porjus.

Statens utbyggande av Älvkarlebyfallet (kraftstationen färdigställdes år 1915) innebar en betydelsefull vändpunkt i periodtalsfrågan. Efter omfat- tande utredningar, vilka visade att 50 p/s ur såväl teknisk som ekonomisk synvinkel skulle ställa sig gynnsammare än 25 p/S, fastställdes år 1913 pcriodtalet för Älvkarlebynätet. Detta kom i realiteten att innebära att 50 p/s stadfästes som svensk standard. Sedan dess har man inriktat sig på att an— vända 50 p/s vid nyanläggningar, och man har även i allt större utsträck- ning börjat omändra äldre, för andra periodtal utförda anläggningar till 50 p/s. Det 50-periodiga systemet kan nu anses vara praktiskt taget allena- rådande i vårt land bortsett från anläggningar för enfasväxelström eller likström.

Intresset för den egentliga landsbygdens elektrifiering framträdde i bör- jan av tredje skedet. Enstaka landsbygdselektrifieringar hade dock genom- förts tidigare, såsom inom Färila socken i Hälsingland, där några hemmans- ägare i Stocksboby 1892 tagit initiativet till uppförande av en elkraftstation jämte ledningsnät för belysning inom några kringliggande gårdar, samt inom Njurunda socken, Västernorrlands län, där byamännen 1895 låtit ut— föra en elanläggning för såväl yttre belysning som belysning inom bonings- hus och ladugårdar. Bortsett från dcssa tidiga exempel på elkraftdistribu- tion till närbelägna lantgårdar och några liknande fall från åren omkring sekelskiftet utfördes ingen elektrifiering av egentlig landsbygd förrän i samband med tillkomsten av nyssnämnda större distributionsföretag, av vilka Sydsvenska kraftaktiebolaget och Hemsjö kraftaktiebolag verkade i sydligaste Sverige samt Trollhätte kraftverk och Kraftaktiebolaget Gull- spång—Munkfors i mellersta respektive norra Västergötland.

För de nämnda företagen var emellertid distributionen till städer och andra större tätorter samt större industrier det väsentliga. Landsbygds- elektrifieringen var mycket kapitalkrävande och avsättningsmöjligheterna för elkraft där jämförelsevis små. Å andra sidan hade vissa distributions-

Vattenregleringsmagas inens

4 000 energunnehall |

%

2 000 40

_________-—--—-P___——___—_ .50 Ehia'giinnehållet i *—

1 000 förhållande till 20

mttenlq'afttillgånå' under normalår (i. ,o) _10 0 . . . . . . . o

1940 45 50 Bild 6. Vattenregleringsmagasinen åren 1940—1952. (Enl. CDL)

företag fått obehagliga erfarenheter av att industriabonnenter hastigt kun- de upphöra med sin uttagning, vilken risk icke ansågs finnas i samma grad beträffande jordbruksabonnenter. Detta i förening med intresse på lands- bygden att även där få del av elektricitetens fördelar gjorde, att nämnda företag är 1910 påbörjade distribution av elkraft till mera lättelektrifierade landsbygdsområden. Kapitalanskaffningen och distributionsverksamhetcn ordnades olika av de olika företagen. Denna fråga skall närmare behandlas längre fram.

Under åren fram till första världskriget fortsatte landsbygdselektrifie- ringen i jämn takt, bl. a. genom tillkomsten av ett ganska stort antal små distributionsföretag med smärre kraftanläggningar. Under första världs- kriget inträdde emellertid en markerad ökning av elektrifieringshastigheten. som under de båda sista krigsåren och första efterkrigsåren nådde sin kul— men. Anledningen till denna utveckling var den rådande bristen och det höga priset på importerade bränslen, såsom lysoljor och motorbränsle. Elektrifiering av så stora delar som möjligt av Sveriges landsbygd blev un- der denna tid en nationell angelägenhet och omfattades därför av det största

intresse från såväl allmänhetens som den tekniska och ekonomiska expertisens och myndigheternas sida. Staten gynnade utvecklingen genom särskilda lånefonder och de större distributionsföretagen genom att leda ut- vecklingen organisatoriskt och tekniskt. Statens vattenfallsverk, som dit— tills hade haft en ganska blygsam landsbygdsdistribution inom Västergöt- lands slättbygd genom Trollhätte kraftverk, började 11u taga sig nu även denna verksamhet. Älvkarleby kraftverk fick sålunda redan från början ett distributionsnät, som i väsentlig grad var utformat med tanke på allmän distribution på landsbygden inom Uppsala, Stockholms och Södermanlands län samt delar av Gävleborgs, Kopparbergs och Västmanlands län. Den for- cerade elektrifiering, som utfördes mot slutet av detta skede med dess höga prisnivå och materialbrist, medförde dock för många företag en betydande ekonomisk belastning för framtiden.

Det intensiva arbete, som under krigsåren och de närmast därpå föl- jande efterkrigsåren nedlades på landsbygdens elektrifiering, ledde till att i början av 1920-talet gårdarna i de elektrifierade landsbygdsområdena om— fattade 40 % av landets hela odlade areal. Elektrifieringen var dock syn— nerligen ojämn och i huvudsak koncentrerad till de mera tättbebyggda områdena i mellersta och sydligaste Sverige. Även inom dessa områden var anslutningen på grund av den forcerade utbyggnadstakten mycket ojämn.

Det fjärde skedet sträckte sig från början av 1920-talet till mitten av 1930- talet. De under högkonjunkturen 1917—1921 utförda distributionsanlägg- ningarna voro i många fall av bristfälligt utförande. Under den nu följande perioden, vilken inleddes med lågkonjunkturen 1921—1923, gällde det för I kraft- och distributionsföretagen i första hand att konsolidera sin ställning, i vilket i stort sett lyckades tack vare den ökande efterfrågan på elektrisk kraft med successivt förbättrad utnyttjning av anläggningarna. Den under skedet fortgående utbyggnaden av kraftanläggningar medförde för södra och mellersta Sveriges del, att huvuddelen av de värdefullare vattenkraft- tillgångarna där togos i anspråk.

Inom industrin — den utan jämförelse största kraftavnämaren — skedde en ständig ökning av kraftbehovet även om energiåtgången för industrin procentuellt visade en tillbakagång beroende på den stora ökningen för elektrisk järnvägsdrift och allmän distribution. Av järnvägarna hade för— utom vissa småbanor riksgränsbanan elektrifierats redan tidigare i samband med byggandet av Porjus kraftstation (banan öppnad för eldrift 1914). I och med elektrifieringen av västra stambanan (öppnad för eldrift 1926) fick järnvägselektrifieringen ny fart och har sedan dess fortgått i rask takt. Vid slutet av fjärde skedet var sålunda huvuddelen av den nu utförda järnvägselektrifieringen i Götaland och Svealand verkställd, medan den fort- satta elektrifieringen av stambanorna i Norrland huvudsakligen gjordes under de följande åren. Den allmänna förbrukningen genomgick under fjärde skedet en stark utveckling till stor del beroende på den effektiva

l _ : Linjelängd, km Fran till april 1952 ! drevs 580 kV— nätet provisoriskt med ?— 5 000 200 kV späxming [

| !

41 | | I_

4000

J r——— linjer,? .—--—-———' 1 000 låt;—statliga [ FM" |__— r_____g 580 ka rStaHiTgå—fih; [ ,f———4 | 0 . l . . . . . . 1956 40 45 50

Bild 7. Stamlinjenålen för 200 och 380 kV åren 1936—1952. (Enl. CDL)

upplysningsverksamhet. som igångsattes av de större distributionsföretagen samt av Svenska elverksföreningen i samarbete med vissa andra organisa- tioner genom den nybildade Föreningen för elektricitetens rationella an- vändande.

Redan under krigsåren hade man lärt sig den ekonomiska betydelsen av samkörning mellan olika kraftstationer tillhörande samma företag och i viss omfattning också mellan kraftnät tillhörande olika ägare. Under fjärde skedet kom nu samkörning och kraftutbyte till stånd i allt vidare omfatt- ning. Parallellt därmed utformades kraftverksområden (se sid. 56) med vartdera ett eller emellanåt ett par dominerande företag (»storkraftföre— tag»). Praktiskt taget hela landet blev uppdelat i sådana var för sig sam- körande områden.

Landsbygdselektrifieringen kämpade under delar av detta skede med vissa svårigheter. Den forcerade elektrifieringen under de senare krigsåren och första efterkrigsåren hade som nämnts skett vid en våldsamt upp- driven prisnivå och under mycket besvärande materialbrist. Deflationen efter 1921 förde med sig stora ekonomiska bekymmer för Sveriges jordbru- kare och samtidigt härmed började olägenheter av kristidsmaterielen i de elektriska anläggningarna att göra sig gällande.

Ett stort antal mindre distributionsföretag, i synnerhet sådana som star— tats inflationsåren 1917—1921, råkade i ekonomiska svårigheter och från

landsbygdshåll gjordes vid upprepade tillfällen framställningar till staten om bistånd, bl. a. genom sänkning av engrostaxorna för den elektriska kraf- ten. Motionsvis påkallades i riksdagen under åren 1921—1923 stödåtgärder från statens sida. Några sådana genomfördes emellertid icke, bortsett från att de redan tidigare inrättade lånefonderna utvecklade sin verksamhet. Verkställda utredningar ansågos tyda på, att en förbättrad utnyttjning av den elektriska kraften samt en välskött administration och bokföring skulle i tillräcklig hög grad befrämja en fortskridande förbättring av företagens ekonomi. Från sakkunnigt håll uttalades också den meningen, att i många fall de genom elektrifieringen vunna fördelarna väl motsvarade de faktiska kostnaderna därför.

I stort sett kan det sägas, att utvecklingen gick i den riktning man förut- sagt. Elkraftförbrukningen på landsbygden visade en ständig stegring under hela detta skede, bortsett från en tillfällig stagnation under kristiden i bör- jan av 1930-talet. Nyelektrifieringarna voro emellertid förhållandevis fåtali- ga. Den ökade förbrukningen och utnyttjningen av anläggningarna möjlig- gjorde successiva sänkningar av såväl råkraft- som detaljtaxorna, vilket i sin tur stimulerade till ytterligare kraftuttagning. Företagens ekonomiska förhållanden kunde tack vare dessa omständigheter redas upp förhållande- vis snabbt och i stort sett voro krigsårens elektrifieringar redan i slutet av 1920-talet såväl tekniskt som ekonomiskt sanerade. Allmän kännedom här- om spred sig kanske icke lika snabbt, varför intrycken från svårighetsåren länge stodo kvar i det allmänna medvetandet till hinder för ett återuppta- gande av nyelektrifieringsverksamheten.

Det femte skedet började i mitten av 1930-talet och man torde av vissa skäl kunna säga, att det sträckte sig fram till år 1946. Det kännetecknas i huvudsak av att såväl staten som enskilda började för överföring till mel- lersta och södra Sveriges belastningscentra utnyttja de krafttillgångar i mel- lersta Norrland, som tidigare förvärvats av dem med tanke på framtiden, samt av att landsbygdselektrifieringen genomgick sin andra betydelsefulla byggnadsperiod.

Belastningsutvecklingen under denna tid kännetecknas av en fortsatt stegring, beroende på en allt intensivare användning av elektriciteten inom såväl industrin och järnvägsdriften som den allmänna förbrukningen.

Den första storkraftöverföringen från Norrland till mellersta Sverige ut- fördes av Krångede aktiebolag. Kraften från de år 1936 utbyggda Krångede— fallen i Indalsälven överfördes till Mellansverige genom en kraftledning för 200 kV, den första i Sverige med denna höga spänning. Kort tid därefter, sedan Sydsvenska kraftaktiebolaget ingått som delägare i bolaget, förläng- des 200 kV linjen med en gren till Nässjö. En gren till Stockholm hade byggts från början.

Strax efter krigsutbrottet 1939 blev statens vattenfallsverks anläggning i Stadsforsen i Indalsälven färdig och något senare en 200 kV ledning Stads-

arbete med enskilda företag — samt Krångede aktiebolag att utbygga vatten— kraft i Norrland, närmast i Indalsälvens och Ångermanälvens flodområden. Därutöver byggde såväl kommunala som enskilda företag, bl. a. Stockholms stad och Sydsvenska kraftaktiebolaget, större vattenkraftstationer i mel- lersta Norrland. En serie betydande kraftstationeri denna del av landet togos härigenom i bruk. År 1946 svarade Norrland för drygt hälften av pro- duktionen av elektrisk energi i Sverige. I samarbete mellan staten, Stock— holms stad, Krångede aktiebolag och Sydsvenska kraftaktiebolaget kom- pletterades samtidigt med dessa utbyggnader stamlinjesystemet för kraf— tens överföring till mellersta och södra Sverige. År 1946 funnos fyra 200 kV stamlinjer för överföringen från Norrland och av dessa ägde staten två och övriga intressenter två. ,

Den snabba utbyggnaden av vattenkraften i mellersta Norrland medver- kade naturligt nog till en påtaglig stegring i naturkraftpriset i dessa trak- ter. Ehuru naturkraftpriset medförde — och fortfarande medför — en för- hållandevis liten ökning av årskostnaden för kraften, var stegringen av pri— set dock relativt sett så stor, att den föranledde särskild lagstiftning mot spekulation i vattenkraft.

Under det femte skedet gjordes även åtskilliga stora utbyggnader för att tillgodose kraftbehoven inom Norrland. Många av de tidigare omnämnda anläggningarna för leverans av kraft söderut betjäna även betydelsefulla norrländska kraftbehov.

Landsbygdselektrifieringen hade, som nämnts, sin andra betydelsefulla byggnadsperiod under detta skede, nämligen under krigsåren 1939—1945. I vissa avseenden förlöpte denna på samma sätt som den första. Det var även nu bristen på lys- och motoroljor som kom intresset hos de för elektri- fieringen mera passivt inställda att vakna. Under mellankrigsåren hade an- språken på bättre levnadsförhållanden ökat, varvid mekaniseringen av även det stationära arbetet vid jordbruken fått ökad omfattning. Vid de icke elektrifierade gårdarna, där oljan var ljus- och kraftkälla, blev det svårt att utföra föreliggande arbeten, detta så mycket mer som den redan förut knappa tillgången på mänsklig arbetskraft minskades förutom genom lands— bygdens fortgående avfolkning även genom inkallelser till militärtjänstgö- ring. Elektrifieringen av ännu oelektrifierade gårdar och områden blev där- för omedelbart aktuell. Vad som under första världskriget av många hade betraktats som en mer eller mindre umbärlig lyxvara hade nu blivit en oum- bärlig nödvändighetsvara. Visst ekonomiskt understöd för nyelektrifiering på landsbygden började från och med denna period att lämnas av såväl sta— ten och diverse andra samfälligheter som vissa storkraftföretag.

Det sjätte skedet i den svenska elkraftförsörjningens utveckling torde kunna sägas ha blivit inlett, när beslut år 1946 fattades, att statens vatten— fallsverk skulle utbygga Harsprånget och överföra större delen av kraften

söderut genom en stamlinje för 380 kV växelström. Linjen, vilken togs i drift med full spänning samtidigt med att Harsprångets kraftstation färdigställ— des våren 1952, är den första i världen, som byggts för denna höga spänning, och har av den anledningen väckt internationellt intresse. Förutom denna första 380 kV linje har ytterligare en överföringslinje för samma spänning tagits i drift och kompletteringslinjer äro under byggnad, varigenom ett riksomfattande storkraftnät för 380 kV växer fram.

Gotland anslutes till riksnätet genom den kabel, som vattenfallsverket sommaren 1953 har nedlagt i Östersjön för att via högspänd likström förse ön med vattenkraft från fastlandet. Även denna anläggning är en pionjär- anläggning eftersom högspänd likström tidigare icke har utnyttjats för i krafttransport av den omfattning det här är fråga om. : Tekniskt sett kan man nu skönja ett överföringsnät, som möjliggör att , alla utbyggnadsvärda vattenkrafttillgångar inom landet kunna tillgodogöras för hela landets kraftförsörjning.

Stadselektrifieringens utveckling

. Av den ovan lämnade allmänna redogörelsen har framgått, att distribu- ,' tionen av elektrisk energi först upptogs i städerna. Detta är helt naturligt i med tanke på de gynnsammare förutsättningar för elkraftdistribution, , som en tätare bebyggelse medför. I städerna hade dessutom liknande all- l männa anläggningar, såsom för gas— och vattendistribution och för avlopp, i sedan länge varit i bruk och man hade sålunda administrativ erfarenhet I och möjlighet att omedelbart taga itu med frågorna rörande organiserandet och finansieringen av den nya verksamheten. De nystartade företagen blevo redan från början i tämligen stor utsträck- ning kommunalt ägda. Av distributionsföretagen i de svenska städerna ha i runt tal två tredjedelar startats som kommunala företag, medan resten har startats som privata bolag. Efter hand ha stadskommunerna i allt större utsträckning tagit hand om distributionsapparaten, så att den för närvaran- de i 82 % av Sveriges städer —— representerande 92 % av den totala stads- befolkningen — omhänderhas av kommunalt ägda elverk. Samma förhål— lande råder även i ett flertal andra större tätorter av stadskaraktär. Organisationsformerna inom de kommunala elverken ha likaledes växlat i i takt med utvecklingen. Karakteristiskt har varit en successiv övergång till 1 särskilda organ för elverkens skötsel. i De första stadselverken voro i avseende på kraftanskaffningen av två ty— per nämligen dels sådana verk, som både alstrade och distribuerade elkraft, dels sådana, som enbart distribuerade och sålunda inköpte all kraft från utanförliggande kraftverk. Flertalet elverk av den förstnämnda typen voro under ganska lång tid självförsörjande och behövde följaktligen icke kraft- tillskott utifrån. Detta stadium är nu passerat och av ifrågavarande elverk

i nämnda hänseende intaga en rad sydsvenska stadselverk, som medver- kade till bildandet av Sydsvenska kraftaktiebolaget och ha aktiemajoriteten i detta företag.

Elförsörjningens utveckling inom städerna liksom de större tätorterna på landsbygden har kännetecknats av vissa särdrag, av vilka ett par av de viktigaste här skola beröras.

Överallt i världen kom energiförsörjningen till en början att ordnas i form av distribution av likströmsenergi och så blev förhållandet även i Sverige. När distributionen av lågspänd växelström så småningom kommit i gång blev det dock ett önskemål att successivt avveckla likströmsdistribu— tionen såsom ekonomiskt mindre fördelaktig. Särskilt när kraftbehoven stego och distributionsområdena växte visade sig växelströmsdistributionen överlägsen och möjliggjorde sänkta energipriser. Avvecklingen av likströms- distributionen medförde stora kostnader. Den har slutförts på åtskilliga håll men pågår fortfarande inom många av våra större och medelstora städer.

Ett annat särdrag är att kraftöverföringen inom städer och andra tätorter av stadskaraktär i ganska stor utsträckning måste ske genom jordkablar, vilket är väsentligt dyrare än överföring med luftledningar. De fördelar, som man har i en tätort genom att belastningstätheten är relativt hög och den geografiska utsträckningen av distributionsnäten förhållandevis begrän— sad, motverkas av den dyrare materiel, som måste användas, samt de höga kostnader och komplikationer av olika slag, som arbeten på distributions- nät förlagda i gator, medföra.

Elektrifieringens omfattning blev givetvis från början icke fullständig. I detta hänseende torde städerna under första världskriget ha befunnit sig i ungefär samma läge som landsbygden gjorde när andra världskriget bröt ut. Bristen på bränn- och lysoljor 1917—1918 medförde en livlig komplet- terande elektrifieringsverksamhet, vilken fortsatte under de följande åren. Mot slutet av 1920-talet var elektrifieringen helt genomförd i samtliga stä— der och andra större tätorter.

Landsbygdselektrifieringens utveckling

Elektrifieringen av den svenska landsbygden och användningen av elekt— riciteten i jordbrukets tjänst igångsattes, såsom framgår av den allmänna redogörelsen, betydligt senare än stadselektrifieringen. I motsats till förhål— landena inom städer och andra större tätorter blevo här organisations- och finansieringsfrågorna problem av mycket stor räckvidd.

Det har tidigare framhållits, att den första mera betydande landsbygds— distributionen organiserades omkring år 1910 av några större kraftföretag efter något olika linjer.

# l i !

Trollhätte kraftverks och Kraftaktiebolaget Gullspång-Munkfors” första landsbygdsdistribution bestod sålunda i direkt kraftleverans till större lant— gårdar, kvarnar och mejerier etc. i Västergötland i närheten av de båda kraftföretagens för andra ändamål byggda överföringslinjer.

Sydsvenska kraftaktiebolaget hade utbyggt sitt nät i västra Skåne huvud- sakligen för att tillgodose de städer, vilka voro bolagets delägare, med el— kraft. Kraftbolaget ägnade sig icke självt åt landsbygdsdistribution i vidare utsträckning än att det tillät abonnentsammanslutningar, vanligen i form av enskilda aktiebolag bildade genom landsbygdsbefolkningens eget initia- tiv, att köpa elkraft vid transformatorcentraler, uppförda för andra ända— mål, samt vidare distribuera och sälja kraften på samma sätt som städernas elverk. De nämnda sammanslutningarna blevo ofta stora och inom desamma uppstodo underföretag för vidare kraftförsäljning. Den på detta sätt ska- pade s. k. kedjehandeln uppvisade snart en del oförutsedda olägenheter, ofta resulterande i en onödig fördyring av kraften.

Hemsjö kraftaktiebolag, vilket som nämnts sedermera uppgick i Syd- svenska kraftaktiebolaget, tog från början aktiv del i arbetet att så långt det ansågs ekonomiskt möjligt tillgodose landsbygdens behov av elkraft inom sitt verksamhetsområde, Blekinge och östra Skåne. Bolaget medverkade till bildandet av andelsföreningar med en geografisk omfattning av unge- fär en sockens storlek inom vad man ansåg som elektrifieringsbara lands- bygdsområden. Andelsföreningarna åtogo sig att anskaffa erforderligt an- läggningskapital för de överförings— och distributionslinjer samt transfor- matoranläggningar, som erfordrades för respektive områdens elektrifiering. Kapitalanskaffningen ordnades normalt så, att varje föreningsmedlem teck- nade en ansvarsförbindelse i proportion till den av honom tecknade anslut— ningen av elektriska apparater. På ansvarsförbindelserna upplånade för- eningen det erforderliga kapitalet, vilket ställdes till kraftbolagets förfo- gande. Bolaget svarade för byggnad, underhåll och skötsel av hela distribu— tionsanläggningen. I enlighet med bolagets kalkyler erlade detta genom avräkning på kraftavgifterna ränta till föreningen på det utbetalade kapi- talet samt amorterade detta på viss tid, vanligen 20 år. Efter amorterings- tidens slut ägde kraftbolaget anläggningen och föreningen kunde "upplösas.

Hemsjöbolaget ansåg sig på detta sätt kunna ordna en så långt möjligt fullgod landsbygdselektrifiering på ett för bolaget och konsumenterna eko- nomiskt överkomligt sätt. Genom att bolaget självt svarade för detaljdistri- butionen blev kontakten med de enskilda konsumenterna god. Bolaget kun- de på olika sätt biträda konsumenterna och uppmuntra dem till ett ratio- nellt användande av elkraft. Genom att hela anläggningen byggdes och se- dermera sköttes av bolaget ernåddes enhetlighet i det tekniska utförandet samt rationellt och sakkunnigt handhavande av anläggningarna. Förenings— medlemmarnas möjlighet att övervaka användningen av de medel, som de satsade, var emellertid av naturliga skäl begränsad.

När Älvkarleby kraftverk planerades och byggdes 1911—1915, hade man hunnit samla erfarenheter från de tidigare landsbygdselektrifieringarna. Det var sålunda fullt klart att landsbygdens befolkning kunde och borde aktivt deltaga i elektrifieringsarbetet och att de blivande konsumenterna borde få inflytande på den lokala elkraftdistributionen. Organisationsfor- men andelsförening u.p.a. med de enskilda konsumenterna som medlemmar hade för detta ändamål redan visat sig mest användbar. Samtidigt var det uppenbart att landsbygden behövde ett kraftigt stöd från kraftleverantörens sida för att de organisatoriska och tekniska frågorna skulle få en till- fredsställande lösning.

Landsbygdselektrifieringen inom Älvkarleby kraftverks distributions— område ordnades därför i huvudsak så, att kraftverket efter omsorgsfull planering av de lokala distributionsområdenas omfattning och det totala nätets utformning medverkade till bildande av andelsföreningar, s. k. elekt- riska distributionsföreningar, vilkas uppgift var att bekosta och i motsats till Hemsjösystemet även bygga näten inom respektive områden samt handhava detaljdistributionen. Kraftverket svarade härvid för all erforderlig teknisk. ekonomisk och administrativ rådgivning. De enskilda konsumen— terna blevo medlemmar i distributionsföreningarna med ett antal andelar motsvarande >>omfattningen av och ändamålet med den av medlem ägda eller brukade fastigheten eller dess elektriska anläggning».1

Vid tillämpningen av nämnda princip utgjorde från början den odlade arealen den enhet vid jordbruket, varpå andelstalet baserades. Denna av de anslutna apparaternas antal och storlek oberoende beräkningsgrund med- verkade i hög grad till rationell användning av elkraft. Genom förenings- medlemmarnas aktiva deltagande i elektrifieringsarbetet, tillhandahållande av stolpar etc. kunde anläggningskostnaderna för detaljdistributionsnäten hållas relativt låga. Som insats i föreningen fingo konsumenterna till större eller mindre del lämna reverser, vilka de senare förräntade och amorterade helt vid sidan av kraftavgifterna.

Anläggningarna för kraftöverföringen till detaljdistributionsområdena — bygdeledningar och bygdetransformatorstationer —— utfördes, bekos- tades och' handhades av Älvkarleby kraftverk, varigenom enhetlighet, god utnyttjning och efter dåtida förhållanden hög driftsäkerhet erhölls för dessa mera komplicerade nät av högre ordning samtidigt som de totala anlägg- ningskostnaderna därigenom blevo låga. Kraftleveransen till distributions— föreningarna skedde sålunda på nedspänningssidan i kraftverkets bygde— transformatorstationer, vilka normalt placerades i centrum av respektive föreningsnät.

Vid den fortsatta landsbygdselektrifieringen blev i stor utsträckning det av Älvkarleby kraftverk införda systemet begagnat. Därjämte kom emel-

1 Citat ur [vattenfallsstyrelsens normalförslag till föreningsstadgar.

lertid även i fortsättningen en mängd andra organisationsformer till an- vändning, varför elektrifieringen av i dag måste sägas vara präglad av en tämligen stor oenhetlighet.

I samband med elektrifieringen av städerna hade i en del fall kringlig- gande landsbygdsområden blivit anslutna till stadsnäten. På samma sätt hade industrianläggningar, som inköpte eller producerade kraft främst för användning inom sin fabrikation, i stor utsträckning börjat distribuera en om än förhållandevis obetydlig del av kraften först i industrisamhället och därefter även inom den kringliggande landsbygden.

Storkraftföretag, som ursprungligen ej utövade egen detaljdistribution, började efter hand taga sig an dylik i större eller mindre utsträckning inom vissa områden, en utveckling som tilltagit under senare år. Landsbygds- t'öretagen ha nämligen fått allt svårare att finna förtroendemän, som ha tid och intresse för det ofta ganska betungande föreningsarbetet. En annan orsak till nämnda utveckling är att små och av olika anledningar mindre väl skötta distributionsföretag ej haft möjlighet att med bibehållen organi- sation reda upp sina förhållanden, vilket ofta lett till att de omhändertagits av sin råkraftleverantör. Ett visst intresse från de stora kraftbolagens sida att taga hand om detaljdistributionen inom sina områden, i varje fall de mera inkomstbringande delarna därav, torde också ha gjort sig gällande.

Statens vattenfallsverk, som relativt sent började detaljdistribuera kraft i egen regi, har under de senare åren väsentligt utvecklat denna del av verk- samheten. Då det kan vara av särskilt intresse att känna de olika skäl, som föranlett detta, skall här lämnas en närmare redogörelse för nämnda ut- veckling.

Detaljdistributionen påbörjades redan i samband med anläggandet av kraftstationen i Trollhättan och omfattade Trollhättans kommun samt ett par andra samhällen i Västergötland. Distributionsrätten i Trollhättan er- hölls i samband med att Kronan är 1906 överlät mark till Trollhättans kom- mun; distributionen har likväl sedermera övertagits av staden med undantag av vissa delar i förorterna, i vilka den fortfarande handhas av verket.I övriga ovannämnda samhällen saknades från början intresse för kommunal distri- bution, varför verket åtog sig densamma genom 40-åriga koncessionsavtal. När man började bygga kraftstationen i Porjus var det likaledes helt natur- ligt, att verket skulle taga hand om detaljdistributionen i detta samhälle.

Verkets detaljdistribution har sedermera utökats i samband med de inköp av outbyggda fall och befintliga vattenkraftstationer, som genomförts för att trygga krafttillgången. Ibland ha säljarna betingat sig ersättning i kraft och det därför utbyggda nätet har då fått omhändertaga hela distributionen inom området. Ibland ha detaljnät med tillhörande distribution medföljt förvärvet. Det sagda gäller framför allt Motala ströms kraftaktiebolags om— fattande distribution. Förvärvet av denna, vilket ägde rum är 1930, var en följd av att besittning av bolagets kraftstation vid Borensberg var önskvärd

för att verket skulle kunna helt behärska vattentappningen i Motala ström mellan Vättern och Roxen.

Sedan mitten av 1930-talet har den av vattenfallsverket bedrivna detalj— distributionen utvidgats väsentligt såväl genom övertagande av befintlig distribution som genom ren nyelektrifiering. I förstnämnda fall har det i regel gällt sådana elektriska distributionsföreningar, som av skilda orsaker ej velat eller kunnat fortsätta sin verksamhet på ett för bygdens kraftför- sörjning tillfredsställande sätt. De vanligaste anledningarna ha varit risk för ekonomisk katastrof eller svårighet att få kompetent ledning och skötsel av företagets verksamhet. I vissa fall har det gällt att undvika ovidkom- mande mellanhänder och allvarligare rubbningar i kraftförsörjningen. En del av de övertagna företagen drivas fortfarande såsom särskilda företag, ehuru de ägas av staten, och deras verksamhet handhas av verkets personal. De lokala intressena tillgodoses genom representation i företagens styrelser.

I detta sammanhang kan det vara av intresse att omnämna, att vatten- fallsverket i Kiruna bedriver distribution av kraft för uppvärmningsända— mål, under det att kommunen själv tillhandahåller invånarna elkraft till belysning och motordrift. Detta egenartade förhållande har uppkommit av särskilda utvecklingshistoriska skäl.

Ren nyelektrifiering har upptagits av vattenfallsverket inom sådana om- råden, där tillräckligt intresse för bildande av distributionsföreningar sak- nats eller där bebyggelsen är så gles, att betingelserna härför varit särskilt ogynnsamma, exempelvis i en del omåden i Bohuslän och Dalsland.

Aktiebolagsformen för mindre detaljdistributionsföretag har alltid fått en viss användning. På en del håll har en särskild form av aktiebolag med kooperativ betoning tillämpats. Detta har t. ex. varit fallet vid elektrifie— ringen av Stockholms skärgård, vilken skedde under vattenfallsstyrelsens medverkan. De relativt höga kostnaderna vid dessa arbeten gjorde det omöjligt att åstadkomma tillräcklig anslutning till en efter vanliga regler bildad andelsförening. Genom tillämpning av aktiebolagsformen med rätt för varje konsument att teckna valfritt antal aktier samt genom att in- tressera vederbörande kommuner underlättades kapitalanskaffningen. Den ledande principen inom andelsföreningarna, att all vinst av distributions- rörelsen skall komma konsumenterna tillgodo vanligtvis genom låga taxor, sökte man tillämpa även här genom lämplig utformning av bolagsordningen. Sålunda får aktiekapitalet i regel utgöra endast 20 a 25 % av den ursprung- liga anläggningskostnaden. Aktiekapitalet får ej höjas utan vattenfalls- styrelsens medgivande och vinstutdelningen begränsas till 6 %. Kapital- anskaffningen i övrigt har skett dels genom uttagning av anslutningsavgifter från konsumenterna av samma storleksordning som aktiekapitalet, dvs. endast omkring 25 % av anläggningskostnaden, dels genom lån, vanligen mot vederbörande kommuns borgen. Genom bolagsordningens föreskrift att kommun äger företrädesrätt inlösa utbjudna aktier ävensom genom att

begränsa rösträtten till maximum 10 % samt genom vissa föreskrifter i kraftleveranskontraktet har man sökt tillförsäkra befolkningen i den bygd, där dessa bolag verka, samma inflytande på distributionsföretagets förvalt- ning som i andelsföreningarna.

I tekniskt avseende har landsbygdselektrifieringen genomgått en bety— delsefull utveckling. Bygdespänningen valdes i södra och mellersta Sverige efter några trevande försök med lägre spänning vanligen till 20 kV (i en- staka fall annan spänning från 10 upp till 30 kV), medan man i de senare elektrifierade, glesare bebyggda delarna av mellersta och övre Norrland valde 40 kV bygdespänning. För ortsnäten inom stora delar av södra och ] mellersta Sverige valdes ursprungligen i regel 1,5 kV spänning. Valet härav | dikterades av en önskan att kunna ansluta tröskmotorer och andra större * motorer direkt till ortslinjerna utan transformering. Detta var möjligt vid i en spänning av högst 1,5 kV. Ortsnätens begränsade utsträckning och det i låga elkraftbehov, som då förelåg, gjorde också att denna låga spänning » betraktades som mest ekonomisk. Högre ortsspänning användes emellertid ' också, särskilt i glesare bebyggda trakter och även i Norrlands älvdalar, ' där 10 kV eller i vissa fall 20 kV kom till användning. : Snart nog måste spänningen 1,5 kV överges bl. a. på grund av koppar- ! bristen under första världskriget, som framtvingade användningen av stål ; i ledningarna, och 3 kV blev den vanliga ortsspänningen. Tröskmotorernas I anslutning till ortsledningen bibehölls dock i stor utsträckning men gjordes [ nu över en flyttbar transformator. Sedan slutet av 1920-talet, då transfor- matorer med lägre tomgångsförluster kommit i marknaden, ha näten ord- ; nats med stationära transformatorer, tillräckligt stora även för tröskmotor- l belastningen. Ortsspänningen 6 kV har härefter blivit normal för nyanlägg- ningar inom södra och mellersta Sverige.

Med den kraftigt stigande belastningen har det blivit nödvändigt att bygga om de gamla 1,5 kV näten till högre spänning. Härvid syftar man i regel till 6 kV, även om man i en del fall för att utnyttja befintlig materiel utför omläggningen etappvis med 3 kV under ett övergångsskede. Flertalet nät med ursprungligen 1,5 kV spänning äro numera ombyggda. Även 6 kV har på senaste tiden börjat betraktas som en väl låg ortsspänning. 10 kV anses nu på många håll vara den gynnsammaste spänningen och moderna anlägg- ningar byggas i stor utsträckning enligt 10 kV standard, även där man tills

* vidare kommer att driva dem vid lägre spänning.

Lågspänningssystemet 380/220 V har under senare år blivit det normala vid nyanläggningar såväl på landsbygden som i städerna. För landsbygdens del har, i motsats till i städerna, likströmmen aldrig använts i större ut— sträckning. Likströmsdistribution har på landsbygden endast förekommit från smärre icke samkörande kraftanläggningar men kan där fortfarande ge betydande problem av lokal natur. Övergång från lägre spänning, även

likspänning, till 380/220 V växelspänning har emellertid för berörda lands— bygdsområden haft och har stor betydelse. Omläggningar ha redan utförts i stor utsträckning och torde för framtiden bli aktuella på allt flera håll.

Anläggningarnas tekniska utförande har växlat under landsbygdselektri- fieringens olika tidsperioder. Sålunda rådde vid den första intensiva ut— byggnaden under och efter det första världskriget brist på såväl materiel som kvalificerad arbetskraft och många av de distributionsanläggningar som då byggdes fingo ett sådant utförande, att de under mellankrigstiden till stora delar måste byggas om. Även under de senaste krigsåren har för distributionsanläggningar använts kristidsmateriel i tämligen stor utsträck- ning, ehuru denna gång med större urskillning.

Konstruktionernas utformning, som från början präglades av stor oenhet— lighet, har efter hand genom normering och standardisering blivit alltmera enhetlig. Mycket återstod att göra på detta område när elkraftutredningen påbörjade sitt arbete. Genom den på elkraftutredningens initiativ tillsatta samarbetskommittén för landsbygdsnätens standardisering har dock under de senaste åren ett omfattande arbete nedlagts bl. a. på normering och stan- dardisering av de i orts- och lågspänningsnäten ingående konstruktionerna, vilket medverkat till förbättrade förhållanden.

Tarifittvecklingen

Försäljning av elektrisk energi förekom till en början huvudsakligen i städer och därvid i form av detaljdistribuerad, lågspänd kraft. De äldsta tarifftyperna återfinnas därför inom stadsdistributionen, vilken också i viss mån lett utvecklingen på detta område. I nedanstående redogörelse för ut- vecklingen på tariffområdet behandlas (årför städernas detaljtariffer för- hållandevis ingående. Redogörelsen går icke närmare in på de olika tariff- typernas uppbyggnad eller de allmänna principerna rörande prissättning på elektrisk kraft. Härvidlag hänvisas till Redogörelse nr 1, s. 25—43.

Städernas detaljtariffer

De tidigast använda belysningstarifferna bestodo i stor utsträckning av ackordstariffer med ett fixerat pris per lampa och är, per lampa och månad, per lamptimme etc. Priset var beroende av lampans storlek, vilken i regel uttrycktes i normalljus. Fördelarna med denna tarifform vid elektrifie- ringens dåvarande omfattning voro uppenbara. En minimiinkomst garante— rades, vilket från distributionsföretagens synpunkt säkerligen var behövligt, och vidare undvek man de dyrbara mätarna och de ofta återkommande och kostsamma avläsningarna. En viss kontroll måste dock utövas och ganska snart inmonterades strömbegränsare, vilka antingen kopplade av hela an-

läggningen eller gåvo varningssignal, om flera eller större lampor än som var överenskommet anslötos.

Inom stadsdistributionen blevo ackordstarifferna ganska snart, särskilt sedan elmotorer börjat allmänt användas, ersatta med tariffer baserade på uppmätning av den konsumerade energin, varigenom det blev möjligt att avpassa kostnaderna för en viss abonnent efter den verkliga konsumtionen. Ackordstarifferna inbjödo till slöseri med den elektriska energin och nöd- vändiggjorde — om strömbegränsare Eke användes — kontroll av lamp— installationen samt driften och belastningen av anslutna motorer. I deras ställe blevo deras åtminstone i fråga om energiuttagningen motsatta ytter— lighet, energitariffer, förhärskande, ofta dylika av stegrabattyp med kilo- wattimmemåtare. I början på 1900-talet framkommo, speciellt för motorer, värmeapparater o. d., en del nya tarifftyper, vilka skulle komma att spela en stor roll i den fortsatta utvecklingen. Här må nämnas dubbeltariffer, enkla blocktariffer och i vissa fall tariffer, i vilka avgiften var baserad på den uttagna effekten.

Intresset för effektberoende tariffer växte i samband med att detaljdistri— butionen i ökad omfattning utsträcktes till industri och hantverk, varvid olika slag av dylika tariffer framkommo. Betalningen erlades med ett visst pris per uppmätt kW eller hk och år. Debiteringseffekten utgjorde vanligen medelvärdet av ett överenskommet antal halvmånads- eller månadsavläs- ningar. Man kunde också ha ett fast pris för ett visst effektbelopp samt debitera särskild ersättning, ofta efter ett högre å-pris, för den effekt, som togs utöver det faställda beloppet.

Samtliga tariffer hade ursprungligen varit grundade på enkla konsum- tionselcment, dvs. i regel antingen energi i kWh eller effekt i kW. I sam- band med att försäljningen av högspänd kraft under 1900-talets första decennier sköt fart kommo de första kombinerade tarifferna till använd— ning, dvs. tariffer där avgiften bestämdes av såväl energi— som effektför- brukningen. En första form utgjordes av tariffer med betalning efter energi— förbrukningen men med en viss minimiavgift per kW, bestämd efter installa— tionen eller efter uppmätt maximivärde.

Nya idéer i fråga om bostads— och hushållstariffer kommo omkring år 1910 samtidigt från olika håll i utlandet. Man hade börjat att teoretiskt studera tariffproblemet. Bland den mångfald av tarifftyper, som vid denna tid skapades, kan särskilt urskiljas början till den s. k. grundavgiftstariffen, vilken numera dominerar. Olika principer för grundavgiftens bestämning förekommo, bl. a. även anknytningen till golvytan. Pionjären i Sverige för tariffer av denna typ torde ha varit Malmö elverk, som redan 1912 införde en grundavgiftstariff. Exemplet följdes snart av ett antal andra elverk. övergången till grundavgiftstariffer började först på allvar i mitten och slutet av 1920-talet. Den fortsatte sedan ganska hastigt, delvis i samband med det av Svenska elverksföreningens tariffkommitté från och. med år 1932

bedrivna utredningsarbetet. En undersökning strax före andra världskri— gets utbrott visade, att nästan alla svenska stadselverk hade tillgång till grundavgiftstariffer med priser, som bl. a. möjliggjorde billig elektrisk mat- lagning.

För den stora massan y'rkesabonnenter kom utvecklingen från omkring år 1910 att följa andra linjer. Nästan varje elverk uppvisade ganska snart en mycket rikhaltig provkarta av tariffer. Detta var förklarligt med tanke på att man här hade att göra med abonnenter, som hade olika behov av elektrisk energi och olika uttagningsförhållanden och härigenom krävde olika behandling i prishänseende. Elverken sökte att genom de olika tarif- ferna tillmötesgå dessa krav. Det vanligaste slaget av tariffer för yrkes- abonnenter utgjordes av energitariffer såsom dubbel- och trippeltariffer, säsongtariffer och tidspärrtariffer, vidare av effekttariffer med eller utan blockning av energipriset eller med energipris försett med tidspärr eller säsongbestämmelser. Särskilt stor användning fingo effektgränstariffer med lågt pris för den uttagna energin under effektgränsen, vilken i flertalet fall möjliggjorde uttagning av energi för skyltning och skyltfönsterbelysning.

Försöken att renodla och förenkla hela komplexet av detaljtariffer inled- des såsom nämnts i början av 1930-talet av Svenska elverksföreningen. Som resultat av den av föreningen tillsatta tariffkommitténs arbete framlades successivt sammanställningar och beskrivningar av lämpliga tariffer, vilka kommo att spela en stor roll för stadstariffernas utveckling. Kommittén framlade år 1944 ett slutbetänkande med allmänna riktlinjer för utform- ning av lågspänningstariffer för distribution av elektrisk energi inom tät- orter. Efter det arbete, som elverksföreningen sedermera utförde för de av elkraftutredningen framlagda standardtarifferna (varom mera nedan), full- följde nämnda kommitté bearbetningen av stadstarifferna. Vid föreningens årsmöte 1947 framlades förslag till standardtariffer för detaljdistribution av elektrisk kraft i städer och andra större tätorter. Detta förslag, som efter vissa justeringar intogs i föreningens handlingar 1948, nr 20, och som i väsentliga delar ansluter sig till elkraftutredningens standardtariffer, om- fattar dels en polygontariff för alla ändamål, dels komplement- och special- tariffer för vissa ändamål samt dels tariffenhetsnormer. Polygontariffen är avsedd för alla abonnemang av normal typ och motsvarar elkraftutred- ningens normaltariff.

Elverksföreningens arbete har bl. a. lett till att detaljtariffer av enhetlig typ alltmera kommit i bruk inom städer och andra större tätorter.

Landsbygdens detaljtariffer

Inom landsbygdselektrifieringen följde tariffutvecklingen för den låg- 'spända kraftförsäljningen till att börja med i stort sett samma linje som i städerna. Vid små lokala energiföretag, som i krafthänseende voro själv-

för-sörjande, synas sålunda ackordstarifferna och relativt höga, enkla energi- tariffer ha varit de mest använda tarifformerna.

På grund av de speciella förutsättningarna för landsbygdselektrifiering med bl. a. dryga fasta kostnader för nåt m. m. blev man emellertid snart tvingad in på ett för landsbygden speciellt system, enligt vilket konsumen- terna på ena eller andra sättet fingo bistå med kapitalanskaffningen. I den tidigare redogörelsen ha de olika metoderna härvidlag behandlats, särskilt de inom Hemsjö kraftaktiebolags och Älvkarleby kraftverks försörjnings- områden först använda. Det blev på landsbygden normalt, att konsumen- terna vid anslutningen till distributionsnätet fingo erlägga en engångsavgift, vilken varierade inom vida gränser.

Alla övriga omkostnader fördelades på sålda kilowattimmar. För ström till belysningsändamål debiterades exempelvis 40 a 50 öre/kWh, för lågspän- ningskraft till småmotorer och värmeapparater 20 a 30 öre/kWVh och för ; högspänningskraft till tröskning, vedkapning o. d. 10 51 15 öre/kWh. Några , undantag med lägre energipriser funnos. Även på de håll, där detaljdistri—

butionen handhades av större kraftföretag, voro tarifferna av ungefär sam- ma art. För att garantera den minimiinkomst, som erfordrades med hänsyn till kapitalkostnaderna, kombinerades här de enkla energitarifferna ofta ! med minimiavgifter av olika slag; per rum, per hästkraft, per hektar odlad jord osv.

De relativt höga energipriserna omöjliggjorde en mera vidsträckt använd- ning av elenergin. Ett betydelsefullt steg mot tariffernas rationalisering ; torde ha tagits då vattenfallsstyrelsen år 1923 införde sin 5. k. bygdetaxa * (se nedan) för försäljning av råkraft till distributionsföreningar. Bygde—

taxan, som möjliggjorde utvecklingsfrämjande detaljtariffer, resulterade i att distributionsföreningarnas tariffer inom statens vattenfallsverks om- råde i ganska stor omfattning ändrades och utformades till tariffer av grundavgiftstyp, snarlika den av elkraftutredningen år 1947 rekommen— derade normaltariffen. Avgifterna i detaljtarifferna sattes så mycket över bygdetaxans avgifter som krävdes för att ge medel till täckning av för- eningarnas kostnader. Även inom de landsbygdsområden, som voro anslutna till större detalj- distributörer eller som inköpte sin råkraft från större råkraftföretag, skedde en motsvarande utveckling. Sydsvenska kraftaktiebolaget införde sålunda år 1925 vid sidan av äldre tariffer nya tariffer av grundavgiftstyp, dock med förhållandevis högt energipris, och AB Skandinaviska elverk införde år 1927 särskilda bostads-, jordbruks- och hantverkstariffer, vilka byggde på grund- avgiftstariffens idé.

Medan sålunda tarifförhållandena inom de områden, där distributionen av råkraft eller lågspänd kraft handhades av statens vattenfallsverk och andra större kraftföretag, relativt tidigt blevo i viss mån ordnade, blev utvecklingen inom de tusentals småföretag, som arbetade under andra för-

hållanden, oenhetlig och synnerligen rik på varianter. Tariffer med höga energipris funnos sida vid sida med tariffer av modern grundavgiftstyp, där dock i vissa fall priserna satts så lågt att energiuttagningen växte för snabbt och anläggningarna snart blevo överbelastade. De alltför låga tarifferna skänkte ej heller den ekonomi, som behövdes för underhåll och förstärkning samt fortsatt utbyggnad.

Det av elkraftutredningen utförda arbetet för att åstadkomma lämpliga standardtariffer för detaljdistribution resulterade i förslag till standard- tariffer för detaljdistribution av elektrisk kraft, avgivet den 2 januari 1947 (SOU 1947: 4). Förslaget bygger i allt väsentligt på ett av Svenska elverks— föreningens kommitté för landsbygdstariffer, under medverkan av elkraft- utredningen, utarbetat förslag. De av elkraftutredningen sålunda föreslagna standardtarifferna utgöras av en s. k. normaltariff av grundavgiftstyp för alla normala ändamål samt för speciella fall Vissa komplement— och special- tariffer. Förslaget omfattar även riktlinjer för tariffenhetsberäkning.

Engrostariifer

Ehuru engrosförsäljningen av elektrisk energi, vilken huvudsakligen sker vid högspänning, började senare än detaljförsäljningen, voro de första en- grostarifferna av samma enkla beskaffenhet som de ursprungliga belys- ningstarifferna. De utgjordes av ackordstariffer eller enkla effekttariffer med en årlig avgift per hk eller kW. Priserna varierade efter metoderna för effektens bestämning men torde i de fall, då effekten uppmättes med maxi- malmätare, ha legat vid storleksordningen 60 a 80 kr/hk/år. övergången till kombinerade tariffer skedde i början av 1910-talet, då bl. a. vattenfalls- styrelsen införde en effekttariff av detta slag. Tarifferna vid försäljning till landsbygdens distributionsföretag överensstämde till en början med mot- svarande tariffer för städer och industrier, även orn avgifterna genomgåen- de voro högre för landsbygdens del. Detta förklaras av de högre överfö- ringskostnaderna till landsbygdens ofta avlägsna och vidsträckta konsum- tionsområden samt den lägre utnyttjningen av anläggningarna vid lands- bygdsdistributionen.

Återförsäljarnas, dvs. i första hand elverkens, tariffer för den högspända kraftförsäljningen voro utformade på ungefär samma sätt som råkraftför- säljarnas. En vanlig tarifftyp, som slog igenom i södra Sverige och där an— vändes under lång tid, innefattade en låg effektavgift samt ett blockat ener- gipris, där priset i det första blocket låg relativt högt.

Engrostarifferna ha efter hand genomgått en viss normalisering för hela landet i så måtto, att vattenfallsstyrelsens tariffer tjänat som förebild för en— grostarifferna inom andra företag, såväl råkraftföretag som återförsäljande företag. Några kommentarer beträffande utvecklingen av vattenfallsstyrel- sens tariffer kan därför vara av intresse.

| ! ?

På grund av överföringskostnadernas dominerande betydelse utformades vatten- fallsstyrelsens krafttariffer först med betydande prisskillnader med hänsyn till de yttre leveransförhållandena, såsom leveranspunktcns läge och leveransspänningen. Skilda pris gällde sålunda för olika landsdelar allt efter belägenheten i förhållande till vattenkrafttillgångarna. För de första bygdelinjeleveranserna voro avgifterna även beroende av avståndet till de matande transformatorstationerna. Utveck- lingen fram till de senaste åren gick i riktning mot avskaffande av sådana diffe— rentieringar. I 1930 års normaltariffer, genom vilka grunden till vattenfallsstyrel- sens nuvarande engrostariffsystem lades, stadgades sålunda särskild prisnedsätt- ning endast för ett par områden och priserna blevo enhetliga för leveranser från ortsstation respektive bygdelinje etc. I 1936 års tariffer bortföll beroendet av anslutningssättet och i 1947 års tariffer slopades specialområdena helt. År 1951 återinfördes emellertid en differentiering i samband med den då genomförda taxehöjningen. Denna utgjorde nämligen 10 % på de tidigare tarifferna för de norrländska kraftverksområdenas del men 15 % för de mellansvenska. Nämnda differentiering motiveras av den successivt ökande utnyttjningen av distributions- näten inom Norrland och av att fjärröverföringen från de norrländska kraftöver- skottsområdena till Mellansverige icke till någon del skall belasta de norrländska förbrukarna. Förutom den sålunda återinförda geografiska differentieringen fin- nas numera prisskillnader endast på grund av olika leveransspänning, föranledda av transformeringskostnaderna. De vid nämnda tillfällen utfärdade normaltarif— ferna ha även i andra avseenden syftat till ett förenhetligande av kraftvillkoren. Prissänkningarna ha sålunda icke berört leveranser med specialpris lägre än de nya normalprisen och övergång till de nya normaltarifferna har förutsatt strikt tillämpning av dessa, så att förefintliga specialrabatter o. d. i stort sett avvecklats. Ändringarnas verkan för pågående leveranser har varierat i rätt hög grad. I stort sett ha emellertid vid alla tre tillfällena reduktioner för de abonnenter, som be- rörts av ändringarna, uppgått till 5 a 20 %. Därjämte har en reell prissänkning skett under andra världskriget genom att kraftavgifternas dyrtidsstegring betyd- ligt understeg vad som motsvarade den allmänna höjningen av prisnivån. Denna prissänkning har emellertid till en del motverkats genom de senare prishöjning- arna. (Beträffande dyrtidstillägg se närmare redogörelse nedan).

Vid sidan av normaltarifferna har vattenfallsstyrelsen några standardiserade specialtariffer, av vilka en del icke äro offentliggjorda men trots detta allmänt kända. De användas för endast ett fåtal leveranser och spela sålunda reellt mycket liten roll men ha till uppgift att tillgodose en del speciella belastningsförhållan- den. Som exempel må nämnas reservkrafttariffer för företag med egen vattenkraft och med behov av tillskottskraft särskilt vid dålig vattentillgång, säsongtariffer för leveranser, vilka kunna begränsas till delar av året icke omfattande vinter- vardagarnas högbelastningstid, och en sjukhustariff, avsedd för sjukhus med hel— elektrifierade kök. Som specialtariffer kunna också räknas de i vattenfallsstyrel- sens normaltariffredogörelse intagna kvarn- och sågtaxan samt kyrkouppvärm- ningstaxan.

Ytterligare må nämnas de enbart i Norrland tillämpade tarifferna. Den 5. k. norrländska industritaxan är en effekttariff utan energiavgift. Den har bibehållits i stort sett oförändrad sedan 1920-talet, bortsett från att normalt dyrtidstillägg till- kommit. Möjlighet att under vissa villkor kombinera denna tariff med den nor- mala topptaxan finnes från år 1946. En tidigare effekttariff för småleveranser har försvunnit och ersatts med dels den normala industritaxan, dels den s. k. norr- ländska bygdetaxan. Den senare, som är en effektgränstariff liknande subtraktions- taxan, har efter hand praktiskt taget helt utträngts av denna.

Det har städse varit nödvändigt att behandla en del kraftleveranser speciellt i tariffhänseende, antingen medelst rabatteringar i förhållande till normaltarifferna eller medelst helt självständiga specialtariffer. De successiva taxesänkningarna ha emellertid som nämnts lett till att denna särbehandling minskat betydligt i omfång. Vid kraftanvändning för elektrokemiska och elektrotermiska ändamål motsvarar fortfarande bärkraften oftast icke normaltariffernas avgifter, utan ett särskilt prisläge är behövligt. Detta har emellertid då också i regel den bakgrun- den, att ifrågavarande industrier äro gynnsamt förlagda i förhållande till kraft- stationer och stamlinjer, så att överföringskostnaden är lägre än i genomsnitt. Prisformen är i regel effektavgift (kr/kW/år) utan någon energiavgift.

En speciell engrostariff för leverans till landsbygdens distributionsföretag ut- gjorde vattenfallsstyrelsens s. k. rabattaxa, sedermera kallad bygdetaxa, vilken som redan nämnts infördes år 1923. Den föregicks av en dubbeltariff, som inne— fattade en avgift av 10 öre/kWh för energi under normal uttagningstid och 25 öre/kWh under 5. k. spärrtid (i detta fall = normal belysningstid). Nämnda s. k. 10/25 örestaxa, som år 1922 kompletterades med en provisorisk taxereduktion för extra stora tomgångsförluster, gav under vanliga förhållanden ett medelpris av ca 13 öre/kWh för råkraften. Den stora fördelen med bygdetaxan var att energi till lågt fortsättningspris blev tillgänglig.

Bygdetaxan är numera upphävd för nyleveranser men med hänsyn till dess be- tydelse för utvecklingen är en närmare redogörelse för den motiverad. Den utgör en effektgränstariff med enbart effektavgift för bottenkraft och enbart energi- avgift för överkraft. Därjämte utgöres en väsentlig beståndsdel av tariffen av en fast avgift, bygdenätsavgiften (kr/tariffenhet och år), proportionell mot det antal tariffenheter, som abonnenten representerar. Tariffenhetstalen beräknas därvid enligt särskilda normer på grundval av antalet rum, den odlade jordens areal o. (1. För återförsäljare sammanräknas detaljkansumenternas tariffenhetstal. Efter hand har bygdetaxan undergått flera successiva sänkningar dels separat, dels tillsammans med övriga normaltariffer åren 1930 och 1936.

Ett betydelsefullt steg togs år 1930, då valfrihet mellan bygdetaxan och indu- stritaxan infördes för landsbygdsdistributörerna. Detta hade år 1946 lett till att något mindre än hälften av nämnda distributörer, representerande ungefär tre fjärdedelar av totala tariffenhetstalet, övergått till industritaxan. Å andra sidan har bygdetaxan i någon om ock obetydlig omfattning kommit till användning även för industrier, t. ex. tegelbruk.

Den taxesänkning, som vattenfallsstyrelsen genomförde år 1947, berörde icke bygdetaxan. I stället bortföll denna som normaltariff och uteslöts från ytterligare tillämpning vid nya leveranser. Anledningen var att den vid samma tillfälle införda subtraktionstaxan var speciellt lämplig för landsbygdsdistributörerna och för långt övervägande delen förmånligare än bygdetaxan. Vidare hade en över- gång till en enbart av elektriska storheter beroende tariff visat sig vara önskvärd därför att fastställandet av tariffenhetstal, som ursprungligen icke beredde nämn- värda bekymmer, blivit allt svårare att genomföra invändningsfritt allteftersom landsbygdselektrifieringen ökat i omfattning och intensitet.

Fluktuationerna i penningvärdet under senare delen av första världskriget inverkade avsevärt på kostnaderna för elektriska anläggningar och aktualiserade därigenom behovet av dyrtidstillägg på kraftavgifterna och penningvärdesberoende engrostariffer. Att detta behov i första hand inskränkte sig till tariffer för engros- försäljning sammanhänger med att abonnemangen vid engrosleveranser genom kontrakt eller annorledes bindas för längre tid, vilket normalt icke är förhållandet vid detaljdistribution. Många engrostariffer, som infördes vid denna tid, blevo

| |

sålunda försedda med klausuler, enligt vilka kraftavgifterna gjordes beroende av någon faktor, som ansågs avspegla penningvärdet. Dylika faktorer voro bl. a. levnadskostnadsindcx och kolpriset, vilket låg nära till hands att använda sig av med tanke på bl. a. att elkraftens framställningskostnad i viss utsträckning är direkt beroende av kolpriset. Prisregleringsklausuler, baserade på såväl social- styrelsens lcvnadskostnadsindex som kolpriset, infördes i vattenfallsstyrelsens tariffer år 1920.

Mot slutet av 1920-talet hade penningvärdet på nytt stabiliserats och man bör- jade anse beroendet av levnadskostnadsindex onödigt. I vattenfallsstyrelsens nor- maltariffer av 1930 bibehölls sålunda endast en kolprisklausul, ehuru i ändrad form, som säkerhet mot penningvärdesförsämring. I 1936 års normaltariffer åter- införde styrelsen en indexberoende penningvärdesklausul med tanke på de lång- variga kraftkontrakten och möjligheten av snabba och oförutsedda ändringar i penningvärdet. Koltillägget ersattes sålunda nu med en kombinerad index- och kolklausul.

Under det andra världskriget framkommo farhågor för att en allmän höjning av kraftavgifterna skulle bli behövlig. Dyrtidstilläggen voro nämligen avsedda att kompensera blott de rörliga kostnadernas uppgång men icke stegringen av kapital- kostnaderna för nya kraftstationer och överföringsanläggningar. Vissa skärpningar av 1936 års tariffer genomfördes också på hösten 1942, men själva grundtarifferna ansåg vattenfallsstyrelsen sig kunna bibehålla oförändrade under förutsättning, att någon ytterligare väsentlig uppgång av prisnivån icke inträdde. Någon tid därefter kom det allmänna prisstoppet och därigenom blev nämnda förutsättning till en tid uppfylld. År 1951 genomfördes de tidigare omnämnda ändringarna med 10 resp. 15 % höjning av grundtarifferna. Den kombinerade prisreglerings— klausulen ersatte vattenfallsstyrelsen år 1946 med ett enbart av levnadskostnads— index beroende tillägg —— ren indexklausul hade dock tillämpats redan från år 1941 för några enstaka större leveranser. Ett motiv för övergången till index- klausul var att beroendet av kolpriset framstod som oegentligt för många abon— nenter, när under krigets knapphetsförhållanden endast ringa kvantiteter kol användes för kraftalstring.

Kap. 3. Elkraftförsörjningen i andra länder

Som ytterligare underlag för bedömningen av Sveriges elkraftförsörjning och de åtgärder till förbättringar i olika avseenden, som kunna befinnas erforderliga, har elkraftutredningen funnit en överblick över förhållandena även i andra länder önskvärd. Intresset har därvid koncentrerats till sådana länder, där förutsättningarna ifråga om energitillgångarna, konsumtioncns art och relativa storlek, överföringsförhållandena eller den allmänna tek- niska standarden äro någorlunda lika Våra eller där utvecklingen på senare I 1 l tid lett till mera omfattande statsingripanden. I ovannämnda syfte har el— kraftutredningen genom studier av svensk och utländsk litteratur samt genom kontakter med olika organisationer och enskilda personer i respek-

__ tive land bl. a. sökt få fram ett någorlunda representativt och jämförbart material för grannländerna Danmark, Finland och Norge, för Frankrike, Nederländerna, Schweiz och Storbritannien samt för Kanada och USA. I bilaga 3 lämnas på grundval av detta material en kortfattad redogörelse för hur kraftförsörjningen är ordnad i dessa länder samt för vad som i övrigt bedömes vara av särskilt intresse. I det följande behandlas därjämte över- siktligt några allmänna utvecklingstendenser inom särskilt europeisk el- kraftförsörjning.

Det avbräck i den materiella utvecklingen, som det andra världskriget medförde, avspeglades även i elkraftförbrukningen. År 1945 var denna i flertalet länder i Europa mindre eller lika med förbrukningen omedelbart före kriget. I USA däremot, där kriget ej medfört någon omfattande skade- görelse utan i stället givit upphov till en ofantlig industriell produktion, hade denna period ej medfört någon stagnation utan landets produktions— kapacitet såväl som elkraftförbrukning var vid krigets slut väsentligt ut- ökad. Detsamma var förhållandet med de neutrala europeiska staterna, bl. a. vårt eget land.

Återhämtningen efter kriget gick i flertalet stater mycket snabbt. Fabriker reparerades och nybyggdes i rask takt och behovet av elkraft för såväl in- dustriella som andra ändamål steg hastigt. Denna utveckling fortsatte ungefär fram till år 1951, varefter dock en viss minskning av utvecklings- takten kan förmärkas. En jämförelse mellan elkraftförbrukningen år 1938 och år 1952 visar ett imponerande resultat av återuppbyggnaden i de krig— förande länderna. Elförbrukningen, som i stort sett torde ha utvecklats i takt med industriproduktionen, har i flertalet länder minst fördubblats under denna period, trots stagnationen under krigsåren. Det försprång, som Sverige och andra neutrala stater fått under kriget, har till stor del inhämtats av de krigförande länderna i Europa. I USA har omställning—

en till fredsproduktion under de första efterkrigsåren och den delvis av koreakrisen orsakade förlängningen av högkonjunkturen medfört en myc- ket snabb utveckling av såväl industriproduktion som elförbrukning, var- igenom USA:s försprång framför Västeuropas industriländer sedan för- krigstiden ytterligare förstärkts; elförbrukningen i USA är dock fortfarande i förhållande till folkmängden endast obetydligt större än i Sverige. Även Östeuropas stater ha idag en betydligt starkare industripotential och där- med även betydligt större elkraftbehov och elkraftproduktion än före kriget.

Återuppbyggnaden av kraftverksindustrin ställde stora krav på kapital och arbetskraft i alla de krigshärjade länderna och en angelägenhetsgrade- ring med hänsyn till nationalnyttan för de olika objekten blev nödvändig. Trots de förhållandevis höga kapitalinsatserna voro statsmakterna i allmän- het mycket positivt inställda till kraftverksindustrins utbyggnadsprogram. Begränsningen under de första efterkrigsåren sammanhängde därför vanli— gen ej med bristen på investeringskapital utan med de långa leveranstiderna för all maskinell utrustning. ' De första efterkrigsåren karakteriserades praktiskt taget överallt i värl- ! den av en utpräglad brist på energi. För kraftverksindustrin yttrade sig denna energibrist såväl i kraftigt stegrad efterfrågan på elkraft under en j tid med otillräcklig produktionskapacitet som i svårigheter att täcka värme- ) kraftverkens behov av bränslen. Någon snabb lösning på energiproblemet j kunde ej förutses. Europas läge syntes särskilt bekymmersamt. Visserligen j funnos i några länder stora reserver av kol men brytningen av kolet hade * avsevärt fördyrats sedan förkrigstiden. Det visade sig även svårt att få i tillräcklig arbetskraft till kolgruvorna. Det är naturligt att man mot bak- i grunden av detta förhållande ägnade allt större uppmärksamhet åt bl. a. utnyttjandet av befintliga vattenkraftresurser. I de mera betydande vatten- kraftländerna uppgjordes mycket omfattande program för den fortsatta kraftstationsutbyggnaden. Många stora vattenkraftprojekt ha också full- följts under de senaste åren.

Tillgången på vattenkraft är emellertid begränsad varför även utbygg- naden av ångkraftanläggningar måst fortgå, i olika hög grad i de olika länderna. Ångkrafttekniken har successivt förbättrats resulterande i en ökning av den termiska verkningsgraden och relativ minskning av pro- duktionskostnaderna per lth alstrad elektrisk energi. Det är naturligt j att de stora, högt utvecklade industriländerna med rika kol— eller oljefyn- digheter men med begränsade vattenkrafttillgångar lett denna utveckling. Vid sidan om de senare årens utveckling inom ängkrafttekniken motses för- verkligandet av det första atomkraftverket med största intresse.

Europas stora industriområden, vilka samtidigt utgöra centra för elför- brukningen, ligga i allmänhet i koldistrikten. Den för dessa områden erfor— derliga elproduktionen sker i lokala ångkraftstationer, varigenom transport såväl av bränsle som av elektricitet undvikes. Där elförsörjningen inom

områdena även utanför koldistrikten baseras på ångkraft, har man hittills i allmänhet funnit det mest ekonomiskt att förlägga kraftstationerna i för- brukningscentra och transportera det erforderliga bränslet. Behovet av el- kraftöverföring i de rena ångkraftländerna har härigenom kunnat inskrän- kas till ett minimum och man har klarat sig med måttliga överföringsspän- ningar, upp till 150 kV.

Strävan efter att utnyttja allt sämre kolkvaliteter för elproduktionen och att utbygga allt större ångkraftenheter för att härigenom sänka pro— duktionskostnaderna har höjt transportkostnaderna för bränslet. Samtidigt har möjligheten att använda allt högre spänningar, upp till 400 kV, även möjliggjort elkraftöverföring till allt lägre kostnader. Det är mot bakgrun— den av dessa förändringar som man får se en nuvarande tendens att i ökad utsträckning förlägga ångkraftstationerna till kolfälten och transportera elektriciteten till förbrukningscentra, speciellt när bränslet endast skulle ha kunnat transporteras per järnväg.

Vattenkraftstationerna äro bundna till vattenfallen och elkraften från des— sa stationer måste därför överföras till förbrukarna. De första kraftöver- föringarna byggdes för detta ändamål och även i fortsättningen ha över- föringsbehoven varit väsentligt större i vatten- än i ångkraftländerna. Vårt eget land, där de huvudsakliga vattenkraftresurserna och de viktigaste för- brukningscentra äro vitt åtskilda, har i detta avseende hittills intagit en särställning såväl i Europa som i hela världen. Detta är en av huvudorsa- kerna till att 380 kV kom att först användas för praktisk drift i Sverige. På kontinenten med dess stora befolkningstäthet äro avstånden till för- brukningscentra väsentligt mindre och man har hittills kunnat nöja sig med 220 kV överföringsspänning.

De internationella kraftutbytena i Europa uppgingo under år 1951 endast till 1,6 % av den totala elkraftproduktionen. Den internationella handeln med elkraft är alltså mycket obetydlig i jämförelse med t. ex. förhållandena på kolmarknaden, där ca 15 % av produktionen exporteras. Den främsta orsaken till elkraftens nationella bundenhet äro de förhållandevis höga kraftöverföringskostnaderna, vilka i detta sammanhang vanligen gör det ekonomiskt fördelaktigare att transportera energin i annan form än elekt— ricitet. Politiska faktorer torde emellertid även bidraga, i det inget land önskar vara direkt beroende av andra för en så vital produkt som elkraft.

Detaljdistributionen av elkraft på landsbygden och den elektriska ener— gins användning här för olika ändamål uppvisa stora olikheter vid jämfö- relse de olika länderna emellan. Det torde emellertid vara ett genomgående drag för flertalet kulturländer att kraftiga åtgärder under senare tid vid— tagits för elektrifieringens utbredning även på landsbygden för att möjlig- göra den standardförbättring som en ökad elkraftanvändning medför. Statliga stödåtgärder i detta syfte förekomma i stor utsträckning. Det synes emellertid även vara ett vanligt förhållande att elkraftpriserna äro för låga

för att helt täcka kostnaderna för kraftens produktion och distribution, inberäknat anläggningarnas underhåll och förnyelse. Finansieringssvårig— heter i samband med anläggningarnas upprustning, förstärkning och ut— ökning äro sålunda vanliga. Tendensen synes emellertid numera gå mot en förbättrad anpassning av elkraftpriserna, bl. a. sedan den i många länder förekommande hårda statliga priskontrollen börjat släppa.

Det statliga inflytandet på elkraftförsörjningen varierar i hög grad och tager sig mycket olika uttryck i olika länder. I några fall har utvecklingen under senaste tid lett fram till sådana statsingripanden, att större eller mindre del av respektive lands elkraftförsörjning helt omhändertagits av staten.

Det är uppenbart att andra länders kraftförsörjningsförhållanden i olika avseenden äro värda allt beaktande vid bedömningen av våra egna förhål- landen och behovet av förbättringar och rationaliseringar. Det bör emeller- tid hållas i minnet att de grundläggande förutsättningarna i mångt och mycket ändock äro högst olika.

De i bilaga 3 intagna statistiska uppgifterna lämnas utan större enhet— lighet eller fullständighet och utan att vara av senaste datum närmast för att belysa olika, för respektive land karakteristiska förhållanden. I fråga om mera fullständig, jämförande statistik hänvisas till den numera mycket rika litteratur på detta område, som utarbetas genom Förenta Nationernas försorg.

AVDELNING II

Nuvarande förhållanden

Kap. 4. Utgångspunkter och bedömningsgrunder

Elektricitetens betydelse för näringslivet och levnadsstandarden gör det i till ett väsentligt allmänt intresse, att elkraftförsörjningen ordnas på bästa * sätt. I stort sett kan målet sägas vara att med beaktande av enskild rätt * och inom ramen för de förefintliga naturliga, ekonomiska och tekniska * möjligheterna åstadkomma riklig tillgång till elkraft av god kvalitet för lågt och rätt avvägt pris överallt i vårt land.

I de motioner, som föranledde att elkraftutredningen tillkallades, liksom vid riksdagsbehandlingen av dessa motioner, påpekades brister och fram- fördes önskemål av mer eller mindre omfattande natur beträffande elkraft— försörjningens ordnande. Såväl de vid dessa tillfällen framförda anmärk- ningarna som i andra sammanhang framkommen kritik ha i huvudsak gällt problem, som sammanhänga med detaljdistributionen av elektrisk kraft, speciellt detaljdistributionen på landsbygden. Även andra problem inom elkraftförsörjningen ha emellertid berörts, såsom tillvaratagandet av våra inhemska krafttillgångar, storkraftöverföringen och samkörningen mellan olika storkraftföretag, prisbildningen på elektrisk kraft, ersättningen för skador och intrång m. m. I föreliggande avdelning II belysas sådana för- hållanden inom kraftförsörjningen, som i skilda sammanhang påtalats eller som eljest ansetts böra uppmärksammas. Därvid redogöres för det nuvarande tillståndet, sett ur olika synvinklar, och i anslutning därtill framlägger utredningen sina synpunkter och bedömanden. Elkraftutred- ningen har i sitt arbete icke kunnat upptaga alla problem inom elkraftför- sörjningen till lika ingående behandling eller ens i detta betänkande kunnat beröra dem alla. De förhållanden, som sammanhänga med kraftens detalj— distribution, särskilt på landsbygden, ha enligt direktiven ägnats den största uppmärksamheten.

I tekniskt-ekonomiskt avseende utgör elkraftförsörjningen i realiteten ett kombinerat produktions-, distributions- och konsumtionsproblem. Det kan emellertid också i sig själv sägas utgöra en mindre del av ett än större pro— blem, nämligen frågan om landets totala energiförsörjning, där andra del- problem såsom vårt beroende av importen av sådana bränslen, som för ; närvarande svara för huvuddelen av vår totala energiförsörjning, och våra

möjligheter att för framtiden bättre utnyttja de inhemska energitillgångarna av olika slag — även kunna återverka på elkraftförsörjningen. Vid sin be- handling av detta vidlyftiga ämne har elkraftutredningen ägnat den största uppmärksamheten åt elkraftens produktions- och distributionsfrågor med' utgångspunkt från nu rådande förhållanden inom energiförsörjningen samt nuvarande metoder för kraftalstring. Detta har flera orsaker. För att icke arbetet skulle antaga orimliga proportioner har det varit nödvändigt att begränsa det till en del utav vad som kan anses tillhöra ämnet. De erhållna direktiven lämnade också anvisning om utredningens avsedda begränsning. Parallellt med elkraftutredningen har dessutom bedrivits andra kommitté- och utredningsarbeten, exempelvis av den av chefen för handelsdepartemen— ( tet tillsatta bränsleutredningen 1951, genom vars arbete elkraftens förhål— lande till våra övriga energiförsörjningsproblem torde klarläggas. Slutligen kan det ifråga om elkraftanvändningen, i varje fall den kvantitativa sidan av denna, sägas att den statistik och de prognoser, som regelbundet göras upp av kommerskollegium och Svenska elverksföreningen respektive Cen— trala driftledningen, utgöra ett gott underlag för bedömanden i detta av- seende såväl rörande nuvarande som under den närmaste framtiden vän- tade förhållanden.

| Elkraftproduktionens och —konsumtionens omfattning och inbördes an- l passning äro av grundläggande betydelse för elkraftförsörjningen. Produk— i tionsmöjligheterna äro främst beroende av tillgången på högvärdiga kraft- 7 källor, för Sveriges vidkommande sålunda i första hand vattenkraft, som [ kan utbyggas för rimliga kostnader. Å andra sidan bestämmes elkraft— l konsumtionens omfattning, så länge huvudsakligen tekniskt-ekonomiska : synpunkter läggas på kraftförsäljningen, av den elektriska energins för- . måga att konkurrera med andra energiformer inom olika användnings- ! områden.

För att i någon mån klargöra härmed sammanhängande frågor är det av värde att först få en överblick över den på vattenkraft baserade elkraft- produktionens storlek i förhållande till landets totala energibehov och dess möjligheter att för framtiden svara för större eller mindre del av detsamma samt ekonomiska och andra faktorers inverkan på elkraftens användning.

Olika undersökningar ha gjorts rörande Sveriges energiförsörjning och de olika energikällornas, bl. a. vattenkraftens, andel i energibalansen. En direkt jämförelse mellan de olika energikällornas betydelse för energiför- sörjningen är alltid svår att göra, beroende på att det icke finnes något allmängiltigt relationstal mellan elektrisk energi, alstrad av vattenkraft, och värmeinnehållet i olika slag av bränsle. Detta tal är nämligen helt be- roende av för vilket ändamål energin utnyttjas, såsom för drivkraft, i vilket avseende elkraften har ett högt relationstal, eller för värmeändamål, där elkraften har väsentligt lägre relationstal. Även om det alltså är svårt att lämna ett klart besked om hur stor del av landets totala energibehov, som

för närvarande täckes av vattenkraft, omvandlad till elektrisk energi, kan det dock sägas att storleksordningen därav är 10—30 %, medan 20—30 % av energibehovet täckes genom inhemska bränslen och 45—60 % genom importerade bränslen. Nämnda siffror stöda sig på uppgifter, lämnade av f. d. överdirektören K—G. Ljungdahl i den orientering rörande Sveriges ener- giförsörjning (SOU 1951:32) som föregick bränsleutrcdningen.

Vattenkraftandelen i Sveriges energibalans är alltså ganska ringa och det står klart att så måste bli fallet även i fortsättningen. Av Sveriges utbygg- nadsvärda vattenkrafttillgång är omkring tredjedelen tagen i anspråk och man kan redan nu skönja den tidpunkt, då all högvärdig vattenkraft i landet är utbyggd. Jämsides med den intensiva utvecklingen av elkraftkonsumtio- nen har efterfrågan på energi i form av bränslen (för andra ändamål än elförsörjning) under normala tider ökat även den i mycket hög takt, ehuru dock stora och bestående förskjutningar ha inträffat, särskilt under av- spärrningsperiodcr. Även om man bör räkna med en fortsatt, icke oväsent- lig överflyttning av energiförsörjningen från bränslesektorn till vattenkraft- scktorn under det närmaste decenniet förefaller det, sett på längre sikt, icke möjligt att göra några verkligt betydelsefulla överflyttningar av detta slag.

Efter hand som vi närma oss det stadiet då vår utbyggnadsvärda vatten— kraft är helt utnyttjad, vilket beräknas inträffa mot slutet av detta år- hundrade, komma sannolikt produktionskostnaderna för den elektriska kraften att märkbart stiga. I än högre grad kan detta väntas bli fallet när vi bli hänvisade till att helt tillgodose ökningen i vårt kraftbehov genom värmckraft eller importerad vattenkraft. Det kan dock med fog sägas att tidpunkten härför ännu är så avlägsen, att andra förutsättningar för kraft- försörjningen och energiförsörjningen i sin helhet då kunna föreligga exempelvis möjlighet att utnyttja atomenergi.

Det är vidare ingalunda givet, hur behovet av elkraft kommer att utveckla sig i fortsättningen. Det synes å ena sidan vara osannolikt, att utvecklingen i längden skall fortgå i samma ständigt stigande tempo som under den gångna 40—årsperioden med en fördubbling av behovet vart elfte år. Inom de områden, där elektriciteten är lämplig som kraftkälla, kunna behoven sägas redan ha blivit mer eller mindre täckta. Sådana belastningsökningar av engångsnatur, som uppstå exempelvis vid övergång till elektrisk belys- ning och omställning till elektrisk drift av olika industrier, järnvägar och spårvägar, äro sålunda i väsentlig utsträckning tillgodosedda. Sedan denna grundläggande elektrifiering blivit genomförd måste det ytterligare behovet av elektrisk kraft i fortsättningen bli beroende av den allmänna expansionen och välståndsökningen eller av en för elkraftens användning gynnsam för— skjutning i relationen mellan priset på elenergi och annan energi. Å andra sidan säger oss erfarenheten att nya användningsområden för den elektriska kraften, även högst betydande sådana, kunna uppstå mycket snabbt och ge ny näring åt den progressiva behovsutvecklingen.

l l 1

I 1 | i ! i !

Elkraftens pris och därmed dess konkurrensförmåga gentemot andra energiarter är beroende av formen för kraftens uttagande. Det är emellertid icke endast priset, som är avgörande för elkraftens konkurrensförmåga. Den i högre eller lägre grad ökade bekvämligheten, säkerheten eller kvali— teten vid användning av elektrisk energi i stället för energi av annat slag har också mycket stor betydelse och kan i vissa fall medföra att elenergin, trots att den ställer sig betydligt dyrare än energi av annat slag, ändock ställer sig gynnsammast. Med hänsyn till dessa förhållanden är sålunda el- kraften mer eller mindre fördelaktig inom olika användningsområden eller inom samma användningsområde men på olika platser. Ett par fall av allmänt intresse skola här närmare beröras.

Elektrisk matlagning kan i olika fall ställa sig billigare eller dyrare än mat- lagning med användning av gas eller fasta bränslen. Den elektriska matlagningen är emellertid avsevärt bekvämare än användningen av exempelvis vedspis och anses allmänt vara såväl renligarc som ofarligare än användningen av gasspis. Elkraften har därför på detta område, även där den ställer sig dyrare, förutsätt- ningar att finna allt större användning. Som ett led i hnshållsarhetets rationalise- ring får den elektriska matlagningen betraktas som en värdefull tillgång.

Det kan vara motiverat att i detta sammanhang något närmare studera gasen som konkurrent till elkraften.

Den vid gasverken framställda s. k. lysgasens främsta användningsområde var från början gatubelysningen. Under konkurrens med elektriciteten har emellertid en gradvis förskjutning ägt rum, som markeras av tre stora användningsområden, nämligen i tidsföljd inomhusbelysning, matlagning och användning inom hantverk och industri. Av dessa användningsområden är det endast de båda sistnämnda som fortfarande ha betydelse och endast den sista som är på frammarsch. Sam— tidigt ha de vid gasframställningen uppkommande biprodukterna fått allt större betydelse framför allt vid de största gasverken. Koksen spelar härvid den största rollen men även övriga produkter ha, särskilt under avspärrningsperioder, visat sig vara av stort värde för landets försörjning. Den av gasverken totalt framställda och nyttiggjorda gasen representerar f. n. ett energiinnehåll, som med hänsyn tagen till verkningsgrad motsvarar ca 5 % av vår totala elkraftproduktion.

Gasverkens betydelse i konkurrensen med elektriciteten får icke underskattas. Numera torde man i Sverige ganska allmänt ha kommit till den uppfattningen, att gasverk äro välmotiverade i alla stora städer och höra bibehållas i de medel- stora städcr, där de redan finnas. I de mindre städerna bli däremot enheterna för små och franiställningskostnaden för hög vid nu rådande prisrelationcr. På grund härav har också ett antal av de mindre gasverken nedlagts.

Det kan konstateras. att elkraften fått en väsentligt snabbare utveckling i städer, som ej ha gasverk, exempelvis Borås och Halmstad, vilka intagit en ledande ställ— ning på kökselektrifieringens område. I flertalet städer med både elverk och gas- verk utdragas numera icke gasledningar till nyexploaterade bostadsområden. Det är nämligen klart att anläggningskostnaden för ett elnät, dimensionerat för full- ständig hushållselektrifiering, är väsentligt lägre än sammanlagda anläggnings- kostnaden för ett gasnät och ett elnät, dimensionerat endast för belysning och små- apparater. Detsamma gäller även husinstallationerna. Vid nu rådande framställ- ningskostnader för gas och elkraft blir i allmänhet ej heller årskostnaden vid fullständigare elanvändning högre än vad den skulle bli om även gas tillhanda- hållits. Gasverken söka nu i stället kunder inom hantverk och industri, en strä—

van som i många fall krönts med framgång. I vissa städer omfatta dessa senare leveranser numera över 50 % av totalleveransen.

Även på tariffområdet är det påtagligt, att förefintligheten av ett gasverk har haft ett betydande inflytande. Detta är helt naturligt med tanke på den mindre betydelse som kökselektrifieringen i sådant fall har haft. Att gasverksstäderna i betydande omfattning fortfarande ha kvar ett mellansteg i tariffsystemet med ett energipris av storleksordningen 12 öre/kWh, beror sålunda till stor del härpå.

På senare år har på basis av amerikanska metoder påbörjats distribution av flaskgas med särskilt högt värmevärde. Gasen erhålles som biprodukt vid raffina- derier och skifferoljeverk. På grund av dess lätthanterlighet och de låga köks- installationskostnaderna kan det förutses, att den blir en allvarlig konkurrent till elektriciteten men då i huvudsak endast på de platser, där kostnaderna för elekt- riska anläggningar bli särskilt höga eller där utnyttjningen blir liten (såsom i sommarvillor) men samtidigt transportförhållandena för flaskgasen äro gynn- samma.

Att använda elektrisk energi för permanent rumsuppvärmning ställer sig normalt —— åtminstone vid nuvarande sätt för elkraftens användning vid rumsuppvärm- ning och för byggnadernas värmeisolering samt med våra nuvarande vanor ifråga om ventilation etc. —— avsevärt dyrare än uppvärmning med bränslen. Den perma- nenta elektriska rumsuppvärmningen har därför hittills ej fått någon nämnvärd omfattning i Sverige och det är osannolikt att den kan få det i framtiden, såvida icke någon väsentlig ändring i ovan berörda förhållanden inträffar. Denna upp- fattning bestyrkes ytterligare av det faktum, att det för permanent uppvärmning av en normal bostad under nuvarande förhållanden åtgår en elektrisk energimängd, som är 4 år 8 gånger större än den totala övriga energiförbrukningen, elektrisk mat- lagning inräknad. För fullständig elektrisk rumsuppvärmning för hela landet skulle erfordras ett energibelopp av storleken 20 miljarder kWh per år, vilket är lika med hela den nuvarande elkraftkonsumtionen och ungefär tredjedelen av Sveriges to- tala utbyggnadsvärda vattenkrafttillgång. Ändrade förutsättningar kunna emeller- tid som nämnts inträda, varigenom elektrisk bostadsuppvärmning eventuellt kan ställa sig mera gynnsam och få större betydelse än för närvarande.! Som tillsats- värme och för tillfälliga behov kan redan nu elenergi för rumsuppvärmning med fördel användas. Under övergångsperioderna höst och vår kan fullständig elek- trisk uppvärmning vara konkurrenskraftig, särskilt med hänsyn till att bränsle- eldade centralvärmeanläggningar arbeta med låg verkningsgrad vid låg belast- ning. För speciella uppvärmningsändamål, för vilka billig natt- och söndagskraft kan användas, såsom kyrkouppvärmning, kan elvärme vara lämpligt.

Prognoser för elkraftförbrukningens framtida utveckling i landet, avse— ende den för högvärdiga ändamål nyttiggjorda elkraften, ha vid olika till- fällen utarbetats och framlagts av Centrala driftledningen. De undersök— ningar, som legat till grund för dessa CDL-prognoser, ha som regel varit tämligen ingående med bl. a. direkta kontakter med ett stort antal konsu- menter eller konsumentorganisationer, varför prognoserna kunnat tillmätas stort värde såsom måttstock på den sannolika utvecklingen.

Som regel ha CDL:s prognoser avsett femårsperioder. Åren 1950—1951 utarbetade CDL emellertid en långtidsprognos, vari gjordes ett försök att bedöma belastningstillväxten inom elförsörjningens olika konsumtionsgrup— per under hela 1950-talet. Förutsättningarna i denna prognos voro bl. a. en fortsatt högkonjunktur. Dessutom förutsattes, att några större svårigheter

Allmän farm-mm 100 l I I | ! 1925 50 55 40 45 50 55 60

Bild 8. Detaljföl'brukningen fram till år 1.960. (Enl. CDL:s prognos)

i vår utrikeshandel och beträffande byggnadstillstånd 111. m. ej skola råda samt att de nuvarande prisrelationerna mellan elkraft och andra energifor- mer skola kvarstå någorlunda oförändrade. CDL kom därvid som slutresul- tat till att den årliga ökningen av elkraftbehovet under perioden 1951—1956 skulle utgöra 1 200 milj. kNVh. För perioden 1956—1960 äro resultaten osäkrare, men undersökningen antyder att stegringen härunder skullebli ) avsevärt större, räknat i absoluta tal, eller omkring 1 500 milj. kWh per år. j Utvecklingen under 1950-talet skulle därigenom tämligen väl ansluta sig till * den föregående 40-årsperiodens progressiva utveckling. Elkraftkonsumtio— nen för högvärdiga ändamål har nämligen under denna tid, vilket även framgår av bilderna 3 och 4 i kap. 2, år från år ökat ungefärligen med 6,5 %.

Som belysning av den av CDL väntade utvecklingen fram till år 1960 visas bilderna 8—11, hämtade ur CDL:s årsberättelservför driftåren 1950/51

Pappers— och grafisk [ industri 4

X

7 000 ___. / I I 5 000 f ' I / / _L / I , ? Malmln'ytnjng och / , ' metallindustri , » ' _. I / '” 2 000 M”

XX

m / N N Xl Xl '! lN XX l l

Övriga industri

__ Keltisk-teknisk / , ' A industri / , Z ” _ / /

1000

500 f f / /X/ ' NM 7 ' Jord- och steninduswi 200

/x/

1955 40 45 50 55 60

Bild 9. De större industrigruppernas elkraftförbrukning fram till år 1960. (Enl. CDL:s prognos)

/

100

och 1951/52. Som framgår särskilt av bild 10 uppvisar detaljkonsumtionen vid jämförelse med de övriga konsumtionshuvudgrupperna en synnerligen

stark frammarsch. År 1952 voro de "tre huvudgruppernas procentuella andel av den totala, för högvärdiga ändamål nyttiggjorda elkraften följande.

Industri ........................ 63 % Samfärdsel .................... 9 >> Detalj förbrukning ........ 28 >>

Den genomsnittliga ökningen under 1950-talet bedömes för de tre huvud- gruppcrna bli följande.

Industri ........................ 540 milj. kXVh/år Samfärdsel .................... 50 » Detaljförbrukning ........ 550 »

] Ehuru detaljförbrukningens andel sålunda fortfarande är väsentligt mindre än industrins är dess tillväxt större än industrins, även i absoluta tal räk- nat. En fortgående förskjutning i de relativa talen är sålunda att vänta, innebärande en minskning för industrin och en ökning för detaljförbruk— ; ningen. Samfärdselns andel har kulminerat efter en lång uppgångspcriod

' och är nu på nedgång.

De under 1950-talet hittills gjorda erfarenheterna rörande konsumtions—

* utvecklingen visa god överensstämmelse mellan prognos och verklighet. En kompletterande prognos, utförd av CDL är 1953 och avseende femårsperio- den 1953—1957, ger också som resultat att det f. n. icke finnes någon anled— ning till justering av långtidsprognosen 1951—1960.

behandlats i elkraftutredningens redogörelse nr 1. Det har där bl. a. fram— hållits, att grundläggande för konsumtionspriset äro kraftföretagens årliga sjiilvlcostnader för elkraftens produktion och distribution. Självkostnaderna skola normalt täckas genom konsumenternas kraftavgifter men ekonomiskt stöd från stat eller kommun etc. kan i olika fall vara befogat för att kraft- avgifterna ej skola bli alltför betungande för konsumenterna.

I årskostnaderna ingå bl. a. kapitalkostnader, dvs. ränta och avskriv- ningar på anläggningskapitalet. Avskrivningarna sammanhänga med an- läggningarnas förslitning och höra principiellt betraktas såsom ett uttryck för kostnaderna för anläggningarnas återställande till ursprungligt skick eller med annat ord förnyelse. I stället för avskrivningar kan man sålunda tala om kostnader för anläggningarnas förnyelse, betingade av förslitningen. Ovannämnda ekonomiska stöd från stat eller kommun etc. kan ha formen amorterings- och räntefritt kapitalbiclrag eller formen räntefritt län. Kapi- talbidrag från konsumenterna (engångsavgifter av olika slag) äro icke att betrakta som något stöd i ovannämnda bemärkelse utan utgöra en form av kraftavgifter.

Vid självkostnadsberäkningen bör i princip förnyelsekostnaden baseras på hela anläggningsvärdet, även om anläggningen till större eller mindre del har finansierats genom kapitalbidrag från konsumenterna, stat eller

l l ! De allmänna principerna rörande elkraftens prissättning ha närmare 1 !

'/

100 1920 25 50 55 40 45 50 55 60

Bild. 10. Konsumtionshuvudgruppernas elkraftförbrukning fram till år 1960. (Enl. CDL:s prognos)

kommun etc. Successiv förnyelse erfordras för hela anläggningen och kost- nadstäckningen för denna förnyelse bör om möjligt göras så, att det för

Vett enimaftti llgång under normalår / X.

20 000 ! Färm—Zune [ exkl. ång- generering 3 X . ? ! '/ 1 15 000 /1 I! ) l l ,!', / // 1 |__, /A' i / // ! Enskilda. och JK/ 10 000 kommunala rJ / JJ företag I; / v r—' | / Statens vattenfallsverk

1940 45 50 55 50 Bild 11. Elkraftförbrukningen och vattenkrafttillgången fram till år 1960. (Enl. CDL:s prognos resp. kraftföretagens utbyggnadsprogram)

verksamhetens kontinuerliga bedrivande i oförändrad omfattning princi- piellt icke skall erfordras några nya kapitalhidrag och ej heller — vid oför- ändrat penningvärde och även oförändrade förutsättningar i övrigt någon framtida tariffhöjning. Kapitalhidraget medför sålunda för företaget ingen befrielse i fråga om förnyelsekostnadcr utan endast en mot bidragets stor- lek svarande räntebefrielse. Det kan göras gällande att denna princip är alltför hård gentemot de konsumenter, som genom kapitalbidrag (engångs- avgiftcr) lämnat medel till en anläggnings byggande; genom att dessa kon— sumenter genom de övriga kraftavgifterna få betala för samma anläggnings förnyelse få de i realiteten under anläggningens första livslängdsperiod be- tala den mot bidraget svarande anläggningsdelen två gånger. Fördelen för konsumenterna liksom för kraftföretaget ligger emellertid däri, att elkraft— priset kan påräknas förbli oförändrat och att några nya engångsavgifter icke komma att erfordras trots den ursprungliga anläggningens begränsade livslängd.

Ovannämnda princip leder till att ett eventuellt erforderligt ekonomiskt stöd från det allmänna i första hand bör ges sådan form, att det endast avlastar från räntekostnader i erforderlig grad. Endast i den mån så är nödvändigt för att lämna erforderlig stödverkan bör stödet även avlasta från förnyelsekostnader. Det kan självfallet göras gällande att om ett stöd med en bestämd stödverkan lämnas från det allmänna, är det matematiskt likvärdigt om stödet befriar företaget från den ena eller andra typen eller båda typerna av kostnader. Enligt elkraftutredningens uppfattning är det emellertid av icke oväsentlig psykologisk betydelse att stödet endast om det är nödvändigt får sådan form att det sammanställes med en kapitalför- brukning. En räntebefrielse är därför enligt elkraftutredningen psykologiskt sett mera tilltalande än en befrielse från såväl ränte- som förnyelsekostna— der, även där stödverkan enligt de båda alternativen har samma storlek.

Ovannämnda princip rörande förnyelsekostnadernas täckande kan leda till vissa komplikationer beträffande företagets beskattning. Elkraftutred- ningen förutsätter emellertid att dylika skatteproblem, i likhet med de skatteproblem som beröras nedan, skola kunna lösas på ett för den all— männyttiga elkraftförsörjningen tillfredsställande sätt.

Det har länge varit en omdiskuterad fråga, huruvida beräkningen av förnyelsekostnaderna under tider med växlande penningvärde rätteligen bör baseras på det verkligen investerade anläggningskapitalet eller på åter- anskaffningspriset. Elkraftutredningen önskar i detta sammanhang bedöma nämnda problem endast ur praktiska, kraftförsörjningsmässiga synpunkter.

Elkraftförsörjningen utgör en verksamhet av väsentlig samhällelig bety- delse, som i vårt land liksom i flertalet andra länder vanligen bedrives utan några större vinstmarginaler. Den är dessutom en verksamhet, som normalt är stadd i en fortgående utveckling och i vilken överlåtelser i spekulations- syfte äro sällsynta. Det är enligt elkraftutredningens mening fullt rimligt

att i självkostnaderna för denna verksamhet bl. a. inräknas kostnaderna för anläggningarnas förnyelse, bestämda på grundval av återanskaffningspri- set vid varje tillfälle, även om en dylik metod under särskilda omständig— heter, som sålunda inom elkraftförsörjningen höra till rena undantagen, kan medföra även oberättigade vinster för anläggningsinnehavaren. Genom en dylik förnyelsekostnadsbestämning ernås, att de beräknade självkost- naderna och därigenom även elkraftpriserna göras oberoende av anlägg- ningarnas ålder och av det vid byggandet rådande penningvärdet. Elkraftutredningen utgår sålunda ifrån att avskrivningar, baserade på

, för varje tillfälle rådande återanskaffningspris, äro självkostnadsmässigt i berättigade för alla normala fall. Detta innebär under tider med fallande | penningvärde att de totala avskrivningarna under en livslängdsperiod bli ! större än det ursprungliga anläggningskapitalet utan att dock komma upp : till den totala anläggningens fulla återanskaffningspris. För statliga, kom- : munala och enskilda företag innebär emellertid ovannämnda avskrivnings-

|

l l

l l

metod olika beskattning. Enligt gällande skattelagar måste ett enskilt före- tag betala såväl statlig som kommunal skatt för sådana förnyelseavsätt— ningar, som totalt sett överstiga det investerade anläggningskapitalet. För statliga företag utgår endast kommunalskatt för nämnda avsättningar och för kommunala företag inom den egna kommunen utgår ingen skatt.

Elkraftutredningen anser att det i hög grad skulle främja en sund eko— nomisk utveckling inom kraftförsörjningsverksamheten om sådana änd— ringar i skattelagstiftningen genomfördes, att avskrivning på återanskaff- ningspriset enligt ovannämnda regler kunde ske utan särskild beskattning,

, vare sig för statliga, kommunala eller enskilda företag. Nämnda skatterätts— ] liga fråga behandlas f. n. i ett större sammanhang av företagsbeskattnings— ! kommittén, tillkallad av chefen för finansdepartementet i maj 1952.

I direktiven till nämnda kommitté har statsrådet bl. a. fäst uppmärksam— heten på frågan om underlaget för avskrivningsrätten _ anskaffningsvär— det eller återanskaffningsvärdet —— samt bestämmelserna om investerings- fonder. Statsrådet har också antytt vissa tänkbara lösningar på de problem, som kommittén skulle pröva, och har därvid bl. a. framhållit följande.

Vad angår den fria avskrivningsrätten skulle kunna prövas ett system enligt vilket denna utbytes mot en rätt till avdrag för avsättning till förnyelsefond. Denna fond skulle få uppbringas till högst ett belopp motsvarande anskaffnings- värdet å företagets inventarier, procentuellt uppräknat så att viss hänsyn tages till inventariernas återanskaffningsvärde och, eventuellt, företagets fortsatta utveck- ling. Till en sådan fond skulle avsättning alltid få göras med viss procent av det belopp, vartill fonden högst må uppbringas, vilken procentsats skulle svara mot den genomsnittliga ekonomiska förslitningen på befintliga inventarier.

Att elkraftutredningen i princip förordar det i det föregående framlagda betraktelsesättet beträffande förnyelsekostnadernas täckande sammanhäng- er med utredningens åsikt, att detta gagnar ett sunt ekonomiskt tänkande

bland dem, som ha ansvaret för särskilt de mindre distributionsföretagens skötsel. »Varje är bör bära sina kostnader» och allt »skjutande på framti- den» bör så långt det är möjligt undvikas. Det står emellertid klart för ut— redningen att ett rigoröst fasthållande vid nämnda principer kan leda till konsekvenser, som icke alltid äro till fördel för vare sig kraftföretagen eller konsumenterna. Möjlighet måste därför finnas för dem, som praktiskt skola tillämpa principerna, att göra de avvikelser från dessa som i de enskilda fallen kunna anses erforderliga.

Kap. 5. Statliga bestämmelser, utredningar m. m.

Utvecklingen på kraftförsörjningens område har under det halvsekel, som förflutit sedan elektrifieringens genombrott, fortgått i stort sett utan några ingrepp från statens sida. Den lagstiftning, som efter hand tillkommit, har huvudsakligen syftat till att underlätta vattenkraftens ändamålsenliga till— godogörande, att skapa skydd mot elkraftens skadliga verkningar för liv och egendom, att främja elektrifieringens rationella utbredning och att reg- lera priset för elektrisk ström. i I detta kapitel redogöres för gällande rätt särskilt på de områden, som elkraftutredningen får anledning att i fortsättningen närmare beröra. Till , en början behandlas vissa bestämmelser angående vattenkraftens tillgodo- ? görande och därefter redogöres för stadganden rörande elektriska stark- ] strömsanläggningar och elkraftförsörjningen i allmänhet, omfattande be- : stämmelser om expropriation, koncession, säkerhet och tillsyn, prisregle- * ring, registrering av elektriska anläggningar samt rätt till elektrisk kraft, regler rörande statens bidrags- och låneverksamhet på kraftförsörjnings— området samt bestämmelser om installatörsbehörighet och om elskatt. Bestämmelsernas verkningar för elkraftförsörjningen och bedömanden härav behandlas i allmänhet under följande kapitel i denna avdelning men i några fall, särskilt i redogörelsen för koncessionsbestämmelserna, före- komma bedömanden redan i detta kapitel. I de fall bestämmelserna upptagas till behandling och bedömande i följande kapitel lämnas hänvisning efter redogörelsen för respektive stadgande.

Bestämmelser rörande vattenkraftens tillgodogörande

Den gällande vattenrätten är i stort sett sammanfattad i vattenlagen av den 28 juni 1918.

Vattenlagen fastställer den grundsatsen, att envar äger råda över det vat- ten, som finnes på hans grund (1 kap. 1 5) och inom honom tillhörigt om— råde under markens yta (1 kap. 15 å), i båda fallen dock med vissa inskränk- ningar. Inskränkningarna vila på grundsatsen, att den enskilde vid förfo- gande över sitt vattenområde ej får i vidare mån än vattenlagen tillåter göra intrång i annans enskilda rätt eller förnärma allmänna intressen. Vattenområdets ägare får sålunda i princip icke åstadkomma skada för andra genom åtgärder, som sträcka sina verkningar utanför området, ej heller skada annan, som inom området äger särskilda rättigheter.

Vid avvägning av olika intressen utgår vattenlagen från att vattenområ— den skola bli ur allmän och enskild synpunkt utnyttjade på bästa sätt samti—

digt som skada av vattnet såvitt möjligt avvärjes. I vattenlagen avsedda före- tag skola därför utföras så, att ändamålet vinnes med minsta intrång och olä— genhet för annan (2 kap. 2 m. fl. åå). Vid konkurrens mellan olika företag. som icke kunna utföras vid sidan av varandra, skall företräde givas åt det företag, som ur allmän och enskild synpunkt kan antagas bli till största nytta. Mellan motstående intressen skall såvitt möjligt jämkas så, att ett— vart kan tillgodoses utan väsentligt förfång för annat (2 kap. 38 m. fl. åå).

Vattenlagen utgår alltså från att våra naturtillgångar skola utnyttjas på bästa möjliga sätt. Däri har man även att söka skälet till att Kungl. Maj:t enligt 1 kap. 14 5 har befogenhet att förordna, att strömfall, som icke är på ändamålsenligt sätt utnyttjat, kan mot ersättning tagas i anspråk av annan än ägaren. Denna bestämmelse har till syfte såväl att motverka spekulation i vattenkraft som att främja ett planmässigt tillgodogörande av våra vattenkrafttillgångar. I detta sammanhang må erinras om vissa andra bestämmelser med syfte att hindra en osund stegring av priset på vattenkraft. I kungl. brev den 17 maj 1946 till vattenfallsstyrelsen fram— hölls, att styrelsen vid prövning av ansökningar från kommunala och en- skilda företag om transitering av kraft på stamlinjenätet borde särskilt beakta angelägenheten av att prisuppdrivande eller med en planmässig kraftförsörjning icke förenliga köp av outbyggda vattenfall motverkades. Den 20 oktober 1946 infördes en provisorisk lag, genom vilken mera bety- dande överlåtelser av vattenkraft blevo underkastade kontroll ifråga om priset. Lagen gäller t. o. m. den 30 juni 1955 eller den tidigare dag Kungl. Maj:t bestämmer.

Ägarens dispositionsrätt över vattnet begränsas även därigenom att den, som vill bygga i vallen, som regel har att inhämta vattendomstolens till- stånd (2 kap. 20 å) och vattendomstolen har att i sitt tillståndsbeslut angiva de villkor med hänsyn till allmänna och enskilda intressen, under vilka byggnaden må komma till stånd. Underlåter den byggande att inhämta vat— tendomstolens tillstånd medför detta, att han vid eventuell framtida tvist är bevisningsskyldig rörande vattenförhållandena före byggnadens tillkomst.

Som byggande i vatten betraktas uppförande av alla slags byggnader och anläggningar i vatten eller på land så nära strandbädden, att inverkan kan ske på vattenståndet. Vad som stadgas om byggande i vatten gäller också om bortledande av vatten, grävning och sprängning i vatten samt annan åtgärd som förändrar vattnets djup eller läge (2 kap. 1 5).

Tillstånd till vattenkraftanläggning förutsätter att nyttan av anlägg- ningen efter avdrag av byggnadskostnaderna uppgår till ett värde, mot— svarande tre gånger den skada och det intrång, som göres på åker och äng, samt två gånger skadan och intrånget på annan egendom (2 kap. 3 5). Men även om dessa bestämmelser ej utgöra hinder, får företaget ändå icke kom- ma till stånd, om det medför att ett avsevärt antal personer berövas sina bostäder eller andra skador uppstå, som ur sociala eller andra allmänna

synpunkter anses betänkliga. Kungl. Maj:t kan dock, även om hinder möter i nämnda båda bestämmelser, lämna tillstånd till företag, som anses vara av synnerlig betydelse för näringslivet eller för orten eller eljest ur all- män synpunkt.

Ofta är äganderätten till den vattenkraft, som ur teknisk och ekonomisk synpunkt bör tillgodogöras i en anläggning, fördelad på ett flertal händer. För att trots detta möjliggöra en önskvärd utbyggnad finnes i vattenlagen bestämmelser, som medge en av ägarna att tvångsvis tillgodogöra sig de övrigas vattenkraft. Det erfordras dock, att sökanden äger_eller genom servitutsrätt förfogar över mer än hälften av den vattenkraft, som skall tillgodogöras (2 kap. 5 5). Den byggande kan erhålla rätt att å annans mark utföra och bibehålla damm, vall, väg eller ledning för vattnet, eller att verk- ställa åtgärd för strömbäddens reglerande eller till förebyggande eller minskande av skada (2 kap. 14 å). Likaså kan den byggande erhålla rätt att använda sig av annan tillhörig byggnad i vatten eller att för utmål för kraftstation taga i anspråk annan tillhörig mark (2 kap. 15 och 16 55).

Även vattenregleringar äro att hänföra till byggande i vatten och under- kastade bestämmelserna i 2 kap. vattenlagen. Avser regleringen bättre till— godogörande av vattenkraft, som tillhör två eller flera ägare, eller utföres den förutom för kraftändamål jämväl för torrläggning av mark, gälla dock i första hand bestämmelserna i 3 kap. Lagen ger där rätt för en eller flera ägare av strömfall, som önska genomföra ett regleringsföretag, att påfordra att övriga ägare av strömfall, som ha nytta av regleringen, taga del i kost— naden för denna.

För att tillgodose eventuella framtida intressen finnas i vattenlagen, ut- över bestämmelsen om expropriation av outbyggda strömfall, bestämmelser om nyprövning och om kronans lösningsrätt.

Nyprövningen innebär, att det allmänna eller byggnadens ägare kan på— kalla ny prövning av de villkor, under vilka med hänsyn till allmänna intressen byggnaden må bibehållas och nyttjas. Bestämmelsen äger till— lämpning å såväl större kraftverksföretag som regleringsföretag. Nypröv— ning kan första gången påkallas under det femtiofemte året efter det år, under vilket byggnaden senast skall ha fullbordats, samt därefter vart fyr- tionde år.

Kronans lösningsräll innebär, att staten äger tillösa sig utbyggt strömfall av viss storlek, om det erfordras för tillgodoseende av allmänt behov. Lös— ningsrätten omfattar vattenfall, vattenbyggnader, bostadsbyggnader, maski— ner och utmål, men däremot icke anslutande ledningar. Lösningsrätt förelig— ger första gången under det fyrtionde året efter det år, då byggnaden se- nast skall ha fullbordats, samt därefter vart fyrtionde år.

För att tillgodose det allmänna intresset, att kraft ej bortföres från en bygd i sådan omfattning, att bygden utsättes för risken att bli utan kraft för sina behov, finnas i 4 kap. vattenlagen bestämmelser om bygdekraft.

Enligt dessa är ägare av kraftstation, vid vilken kan vid oreglerat lågvatten uttagas minst 500 turbinhästkrafter, skyldig att för tillgodoseende av kring- liggande bygds behov av kraft för lantbruk, hantverk, småindustri, belys- ning och uppvärmning tillhandahålla intill en tiondel av den i kraftverket uttagbara kraftmängden. Vill någon få tillgång till bygdekraft, skall han ansöka därom hos vattendomstolen, som har att bestämma de villkor, på vilka kraften skall tillhandahållas. Såsom vederlag för kraften har motta- garen att utgiva ersättning med ett belopp motsvarande kraftverksägarens självkostnad för kraften med tillägg av två procent på anläggningskostna— den. '

För skada och intrång, som uppstår genom byggande i vatten, skall den byggande utgiva ersättning i enlighet med de regler, som finnas i 9 kap. vattenlagen. I detta kapitel finnas även bestämmelser om hur ersättning skall utgå för annan tillhörig vattenkraft, som den byggande fått rätt att tillgodogöra i anläggningen.

Det ligger i sakens natur, att även om ersättningar fastställas för ett fler— tal slag av skador och intrång, det alltid _ särskilt vid sjöregleringsföretag med dessas mången gång vidsträckta verkningar _ uppstår skada och olä- genhet av mera allmän natur, som ej kan utgöra grund för skadestånds— anspråk i vanlig mening. Även om det skulle vara möjligt att uppskatta in— trånget i penningar, är det i regel ej möjligt att utdöma ersättningen till någon viss sakägare. Skadan drabbar bygden i dess helhet. För att kompen- sation skall kunna lämnas även för sådana allmänna skador, finnas ifråga om regleringsföretag för kraftändamål bestämmelser om regleringsavgift. Detta är en årlig avgift som utgår med hänsyn till den ökning i vattenkraf— ten som regleringen medför vid de berörda strömfallen. De influtna medlen skola användas dels till förebyggande av eller gottgörelse för sådan skada, för vilken ersättning ej bestämts av vattendomstolen, dels för annat ända- mål till förmån för den bygd, som beröres av företaget, såsom för jord— brukets främjande, elektrifiering eller eljest för befolkningens behov.

För att tillgodose allmänna intressen skall företagaren vid planlägg- ningen av större vattenuppdämningar och vattenregleringar eller andra företag i vatten som äro av betydande omfattning eller ingripande beskaf- fenhet underrätta länsstyrelsen i berörda län samt kammarkollegiet. (Kungl. kungörelse den 24 april 1953 angående förberedelse av vissa företag enligt vattenlagen.) Genom länsstyrelsens försorg skola myndigheter och samman— slutningar, vilka ha till uppgift att bevaka av företaget berörda allmänna in- tressen, beredas tillfälle att framföra önskemål rörande företagets plan- läggning samt om vilka åtgärder, som böra vidtagas till förebyggande eller minskande av skada eller olägenhet. Företagaren bör därvid undersöka vilka större företag som förberedas eller antagas komma till utförande i vattendraget och samråd bör äga rum med företrädarna för de till vatten— draget knutna viktigare intressena i syfte att främja en ur allmän synpunkt

ändamålsenlig planering av olika åtgärder för utnyttjande av vattendraget. Till en närmare behandling av bestämmelserna rörande kraftkällornas tillvaratagande återkommer elkraftutredningen i kap. 6.

Bestämmelser rörande elektriska starkströmsanläggningar och

elkraftförsörjningen i allmänhet

Tillkomsten av gällande bestämmelser

Då elektriska starkströmsledningar på 1890-talet började framdragas i landet funnos endast enstaka statliga föreskrifter, som voro tillämpliga ifråga om sådana ledningar. Förordningen den 14 april 1866 angående jords eller lägenhets avstående för allmänt behov behandlade sålunda bland annat frågan om expropriation för utläggning av elektriska ledningstrådar. Vissa bestämmelser i 1884 års gruvestadga rörande för gruvdriften erforderliga kraftledningar kunde tillämpas även på elektriska ledningar. Vidare hade genom en av Kungl. Maj:t den 20 april 1883 utfärdad kungörelse förordnats, att på kronans mark eller inom område för allmän landsväg eller järnväg enskild person eller bolag icke fick upprätta telegraf-, telefon— eller likartad E förbindelse, såframt Kungl. Maj:t icke lämnat tillstånd därtill. Denna kun— ' görelse ansågs tillämplig även å starkströmsledningar och då dessa i regel ll måste framgå över någon landsväg eller järnväg, föreskrev Kungl. Maj:t ! vid meddelande av tillstånd härtill i övrigt erforderliga bestämmelser. Med 1 l l l

anledning av en riksdagsskrivelse tillkallade Kungl. Maj:t år 1898 sakkun- niga, den s. k. starkströmskommissionen, för att inom finansdepartementet biträda vid utarbetandet av förslag till bestämmelser rörande villkoren för anläggande och begagnande av elektriska ljus- och kraftledningar. I ett sam- ma år avgivet utlåtande framhöll starkströmskommissionen behovet av till civillag hänförliga föreskrifter angående koncessionstvång, expropriations- rätt och fridlysning med avseende på dylika elektriska ledningar. Konces- sionstvång förordades för >>yttre>> ledningar med över 250 volt spänning med hänsyn till deras allmänfarliga verkningar. Förslag till lag förelades 1900 års riksdag. Vid denna riksdag väcktes emellertid en motion om ändrade grunder för ifrågavarande lagstiftning, så att bl. a. enskild person eller bolag skulle erhålla koncession endast för viss tid. Med anledning härav begärde riksdagen nytt förslag och ett sådant framlades för 1902 års riks- dag. I propositionen (nr 9) anfördes farhågor för att en tidsbegränsad kon- cession skulle verka hämmande på elkraftens användande därigenom att tidsbegränsningen skulle komma att försvåra eller omöjliggöra anskaffan- det av erforderligt kapital för dessa oftast dyrbara anläggningar. Det sär- skilda utskott, som behandlade propositionen, ansåg emellertid att det all- männa intresset ej vederbörligen tillgodosågs därest icke koncessionen tids- begränsades och utskottet förordade att koncession skulle meddelas endast

för viss bestämd tid eller högst femtio år. Första kammaren godkände ut- skottets förslag, medan andra kammaren röstade för en koncessionstid av trettio år. Kamrarna enades därefter om ett sammanjämkningsförslag, en- ligt vilket koncessionstiden bestämdes till högst fyrtio år.

I enlighet med riksdagens beslut utfärdades därefter lagen den 27 juni 1902 innefattande vissa bestämmelser om elektriska anläggningar, i det följande benämnd 1902 års lag, vilken efter en del ändringar fortfarande utgör grunden för lagstiftningen på det elektriska starkströmsområdet. Enligt 1902 års lag erfordras med i lagen närmare angivna undantag till- stånd (koncession) för utförande av elektrisk starkströmsledning. Bestäm- melserna om koncession ävensom om expropriation för utförande av stark- strömsanläggning upptagas i 1_3 55. I övrigt innehåller lagen i 4—14 åå bestämmelser om ansvar för skada, orsakad av ström från elektrisk anlägg— ning, och i 15 5 ett allmänt bemyndigande för Konungen att meddela de närmare föreskrifter, vilka må erfordras med avseende å elektriska anlägg— ningars utförande och skötsel.

Kungl. Maj:t har i administrativ ordning utfärdat kompletterande för- fattningar beträffande starkströmsanläggningar nämligen stadgan den 31 december 1902 (nr 137) om elektriska anläggningar för belysning eller arbetsöverföring och kungörelsen den 19 maj 1916 (nr 173) med vissa be- stämmelser rörande elektriska starkströmsledningars anordnande i förhål— lande till trafikleder och svagströmsledningar m. m. Dessa båda författ— ningar ha sedermera ersatts av Kungl. Maj:ts stadga den 5 maj 1939 (nr 200) om elektriska starkströmsanläggningar, i det följande benämnd 1939 års stadga. Huvuddelen av stadgan innehåller säkerhetsföreskrifter rörande starkströmsanläggningar samt bestämmelser om tillsyn över dessas utfö— rande och skötsel. Kungl. Maj:t har vidare utfärdat förordningen den 5 de- cember 1919 (nr 755) angående behörighet att utföra elektriska anlägg— ningar för belysning eller arbetsöverföring m. m., sedermera ersatt av Kungl. Maj:ts kungörelse den 2 juni 1939 angående behörighet att vid elektriska starkströmsanläggningar utföra installationsarbete. Med stöd av Kungl. Maj:ts bemyndigande har vidare kommerskollegium i särskilda kungörelser meddelat ytterligare bestämmelser och säkerhetsföreskrifter, väsentligen av teknisk art, rörande starkströmsanläggningar.

Särskilda frågor på elkraftförsörjningens område ha tidigare varit före- mål för statliga utredningar, av vilka de viktigaste skola omnämnas här.

1907 års riksdag begärde utredning om, på vilket sätt betryggande garan- tier för kontraktsenligt åtnjutande av elektrisk energi kunde genom lag— stiftning eller eljest beredas avnämare av sådan energi. Den kommitté, kraftkommittén, som år 1911 med anledning därav tillsattes av Kungl. Maj:t, erhöll dessutom i uppdrag att utreda, huruvida och på vad sätt priset på elektrisk kraft, som distribuerades till allmänheten, kunde av offentlig myndighet regleras. Kommittén avgav den 16 december 1914 ett omfattande

betänkande med lagförslag, som efter överarhetning framlades för 1920 års riksdag (proposition nr 298) och ledde till utfärdandet av bl. a. lagen den 22 juni 1920 (nr 474) med vissa bestämmelser om registrering av elektriska anläggningar samt om rätt till elektrisk kraft in. 111. Ifråga om prisreglering överlämnade kommittén en inom densamma verkställd utredning och kom— mittén förklarade sig anse att utredningen givit vid handen, att prisregle- ringsbestämmelser icke erfordrades. Revision av 1902 års lag i Vissa andra avseenden syntes kommittémajoriteten visserligen önskvärd men ansågs ligga utanför kommitténs uppdrag.

I anledning av motioner hemställde 1915 och 1917 års riksdagar om utred- ningar angående åtgärder för främjande av landsbygdens elektrifiering. I viss del anförtroddes utredningsuppdraget åt de redan i början av år 1915 inom civildepartementet tillkallade vattenfallssakkunniga, vilka sedermera framlade förslag, som ledde till inrättande av kraftledningslånefonden år 1918 och av vattenkraftslånefonden år 1919. I huvudsak lämnades emeller- tid utredningsuppdraget rörande landsbygdens elektrifiering åt elektrifie- ringskommittén, som år 1917 tillsatts inom jordbruksdepartementet. Kom— mitten avlämnade ett antal tekniska utredningar rörande planmässig elekt— rifiering av landsbygden inom olika län. Kommitténs utredningar föranledde dock icke några lagstiftningsåtgärder.

Efter framställningar från kommerskollegium och ett flertal enskilda sammanslutningar på elkraftområdet tillkallades 1933 sakkunniga för elektriska kontrollväsendet. Deras utredningsarbete redovisades i två tryck— ta betänkanden. Det första av dessa, angående behörighet att utföra elekt— riskt installationsarbete m. In. (SOU 1935: 53), innefattade bl. a. förslag till tillägg till 1902 års lag såsom underlag för en reglering av entreprenörs- väsendet och förslag till installatörskungörelse. Det andra, huvudbetänkan- det, angående kontrollen över elektriska starkströmsanläggningar (SOU 1936: 27), innehöll förslag till ytterligare ändringar i 1902 års lag, till ny stadga om elektriska starkströmsanläggningar samt till omorganisation av tillsynsmyndigheten. Vid sidan av betänkandena framlade de sakkun— niga förslag rörande kontroll av elektrisk materiel och till detalj erade säker- hetsföreskrifter för utförande, skötsel och drift av starkströmsanläggningar. I huvudbetänkandet framlagda förslag rörande koncessionsväsendet över- arhetades inom handelsdepartementet och ledde efter proposition (nr 137) till 1938 års riksdag till utfärdande samma år av lag angående ändrad lydelse av 2 och 3 åå i 1902 års lag. Härigenom infördes i lagen bestämmelse om prövning av koncessionsansökningar med hänsyn till behovet av anlägg— ningen samt dess förenlighet med en planmässig elektrifiering. Vidare skedde en Viss utvidgning av koncessionsskyldigheten beträffande högspän- ningsledningar ävensom lågspänningsledningar för allmän distribution och maximitiden för koncession utsträcktes för särskilda fall till sextio år. Här- jämte infördes bestämmelser rörande statlig reglering av kraftpriserna.

Samtidigt med att lagändringen trädde i kraft utfärdades 1939 års stadga om elektriska starkströmsanläggningar och 1939 års installatörskungörelse.

Efter framställning från vattenfallsstyrelsen beslöt Kungl. Maj:t 1936 utredning av frågan om rationellt utformande av rikets elektriska stam- linjenät. Uppdraget anförtroddes åt generaldirektören A. Granholm, som 1937 överlämnade verkställd utredning i ämnet. Däri framhöll Granholm bl. a. att det för tryggande av den framtida rationella utvecklingen och tillgodogörandet av rikets stamlinjenät erfordrades, att Kungl. Maj:t kunde pröva ansökning om koncession för kraftledning även ur sådan synpunkt. Vid beviljande av koncession måste Kungl. Maj:t även kunna föreskriva villkor för att säkerställa, att ledningen nyttjades på ett rationellt sätt. Kungl. Maj:t borde ha fullt fri prövningsrätt även ifråga om förnyelse av koncession. Utredningen åberopades i ovannämnda proposition (nr 137) till 1938 års riksdag, angående ändringar i 2 och 3 åå av 1902 års lag.

Expropriation

Reglerna om expropriation av mark för elektrisk anläggnings utförande finnas i 1 5 av 1902 års lag samt i lagen den 12 maj 1917 om expropriation. Beträffande vattenkraftstation och andra anläggningar för vattenkraftens tillvaratagande gälla bestämmelserna i vattenlagen.

Mark, som erfordras för en elektrisk anläggning, kan under vissa villkor tagas i anspråk genom expropriation, om anläggningen är avsedd för att förse en ort med elektrisk kraft eller för att bereda kraft till en industriell anläggning av större betydelse för det allmänna eller dylikt. Expropriations— rätt kan jämväl meddelas för ledning, avsedd för att förse fastighet med elektrisk kraft, även om ledningen ej är avsedd för anläggning av större betydelse för det allmänna.

Expropriationen kan endast avse annan än kronan tillhörig fastighet. Inom område, för vilket finnes stadsplan eller byggnadsplan, eller inom fastställt hamnområde kan expropriation av gata, torg, allmän plats eller vattendrag ej utan synnerliga skäl äga rum mot menighets bestridande. För ledning inom område, där stads- eller byggnadsplan icke finnes, gäller dessutom, att expropriationsrätt icke kan mot markägarens bestridande beviljas för mark på mindre avstånd än 150 m från på fastigheten beläget boningshus, tomtplats eller trädgård, såvida ej Kungl. Maj :t finner, att an- nan sträckning medför minst lika stort men som den föreslagna.

Expropriationsrätt meddelas i regel av Kungl. Maj:t, vanligen i samband med beviljande av koncession. Därvid föreskrives, att frågan om expropria— tion inom viss begränsad tid (vanligen ett år) skall fullföljas genom ansökan om stämning till domstol, vid äventyr att expropriationsrätten upphör. Har fastighets ägare förklarat sig villig att upplåta nyttjanderätt eller servituts— rätt för starkströmsledning och medför expropriation därav endast ringa

men, erfordras ej Kungl. Maj:ts tillstånd till expropriationen. Ansökan om expropriation ingives i sådant fall till vederbörande domstol (s. k. proforma- expropriation). Mark, för vilken expropriationsrätt meddelats, kan få tagas i anspråk, sedan stämning utfärdats i expropriationsmålet, om säkerhet för expropriationsersättningen jämte ränta nedsatts hos länsstyrelsen.

I kap. 12 kommer elkraftutredningen att behandla frågan om menighets rätt att hindra framdragande av elektrisk ledning inom planlagt område, den s. k. kommunala vetorätten. De övriga för expropriation gällande be- stämmelserna finner utredningen ändamålsenliga och de upptagas därför icke till närmare behandling i betänkandet.

' Koncession

De allmänna koncessionsbestämmelserna äro intagna i 2 5 i 1902 års lag. Dessutom finnas i 3 5 samma lag bestämmelser om vilka handlingar, som skola åtfölja koncessions- och expropriationsansökningar, samt om i den förberedande behandlingen av sådana ansökningar.

Koncessionsmyndighet är »Konungen eller den Konungen därtill bemyndi- gat». Senast genom kungl. brev den 8 december 1950 har kommerskollegium ' bemyndigats att meddela koncession för starkströmsledningar, dock. med , undantag för ärenden där fråga om expropriationsrätt förekommer, där i olika meningar av väsentlig betydelse uttalats och där fråga är om ledningar i med en spänning av minst 40 kV mellan två ledare ävensom en del ärenden i som angå eeklesiastik mark eller mark under universitetens förvaltning. ! Koncessionsskyldighetens omfattning framgår av 2 5 1—3 mom., vilka ; ha följande lydelse:

1 mom. Vill någon utföra elektrisk starkströmsledning med spänning översti— gande tvåhundrafemtio volt mellan två ledare eller, om jordledning användes, mel- lan en ledare och jord, söke tillstånd av Konungen eller den Konungen bemyndi— gar. Dock vare, med undantag varom i 3 mom. sägs, tillstånd icke erforderligt,

a) om ledningen till hela sin sträckning förlägges inom byggnad eller inhägnad gård;

b) om ledningen till hela sin sträckning förlägges under jordytan;

c) om ledningen utföres på egen mark saint antingen avståndet från ledningen, när densamma skall framdragas ovan jordytan, till boningshus eller annan vid

. gård uppförd byggnad eller tomtplats eller trädgård överstiger tjugo meter eller i ägaren medgivit, att ledningen må framdragas på mindre avstånd än nu är sagt; ' (1) om ledningen under iakttagande av vad i e) sägs rörande avstånd till bonings- hus m. m. utföres på frivilligt upplåten mark såsom avgreningsledning till ledning, för vilken tillstånd enligt denna paragraf meddelats, samt den nya ledningen icke är avsedd för fast industriell anläggning eller för distribution av ström till' fas- tigheter med olika ägare. ' .- Skall inom område, för vilket ej finnes stadsplan eller byggnadsplan, ledning framdragas ovan jordytan på mindre avstånd än tjugo meter från byggnad, som ovan nämnts, eller tomtplats eller trädgård, må där ej anläggningen skall utföras

inom inhägnat järnvägsområde, tillstånd till anläggningen icke mot bestridande av byggnadens, tomtplatsens eller trädgårdens ägare meddelas, utan så är, att annan sträckning, som utan synnerlig olägenhet för anläggaren kan användas, prövas medföra minst lika stort men som den föreslagna.

2 mom. Vill någon i anslutning till viss generator- eller transformatorstation eller inom visst område utföra elektrisk starkströmsledning med lägre spänning än i 1 mom. sägs och avser ledningen distribution av ström till fastigheter med olika ägare, söke tillstånd av Konungen eller den Konungen bemyndigar.

3. mom. Elektrisk starkströmsledning, för vars utförande tillstånd ej erfordras enligt 1 eller 2 mom. må likväl icke utan tillstånd av Konungen eller den Konungen bemyndigar framdragas inom område för allmän väg, vattentrafikled eller järnväg eller, när fråga är om luftledning, på mindre avstånd än 2 500 meter från den i vederbörlig ordning bestämda mittpunkten av staten tillhörigt eller till allmänt bruk godkänt flygfält med en största utsträckning av 2 500 meter eller så att led- ningens höjd över fältets nivå vid gränsen överstiger en femtiondel av avståndet i nämnda plan mellan ledningen och omkretsen av en cirkel med fältets mittpunkt såsom medelpunkt och med 1 500 meters radie. Har flygfältet större utsträckning än nyss sagts, må ledningen icke utan tillstånd av Konungen eller den Konungen bemyndigar framdragas på mindre avstånd än 4 000 meter från fältets mittpunkt eller så att ledningens höjd över fältets nivå vid gränsen överstiger en femtiondel av avståndet i nämnda plan mellan ledningen och omkretsen av en cirkel med fältets mittpunkt såsom medelpunkt och med 3000 meters radie.

Koncessionsskyldigheten gäller själva ledningarna och icke kraft- eller transformatorstationerna. Beträffande högspänningsluftledningar innebär koncessionen rätt att framdraga viss till hela sin sträckning bestämd led- ning. De viktigaste undantagen från koncessionsskyldigheten utgöra hög- spänningsluftledningar på egen mark och högspända jordkablar, som ej be— röra allmän trafikled. Enligt 2 5 i 1939 års stadga om elektriska starkströms- anläggningar skall emellertid beträffande alla icke koncessionspliktiga hög- spänningsledningar, som ej till hela sin sträckning falla inom byggnad eller inhägnad gård, göras anmälan hos kommerskollegium. Vid anmälan skall fogas karta utvisande ledningens sträckning samt teknisk beskrivning över anläggningen.

Genom 1938 års lagstiftning infördes i 1902 års lag skyldighet att söka koncession för lågspänningsledningar1 för allmän distribution (2 mom.). Dessa hade tidigare varit koncessionspliktiga enligt 1902 års stadga endast om de berörde allmän trafikled. Koncession enligt 2 mom. innebär en all- män rätt att inom visst område eller från viss generator- eller transformator- station framdraga lågspänningsledningar (områdeskoncession). Enär det av tekniska skäl är praktiskt omöjligt att från en station draga användbara lågspänningsledningar utöver en viss längd, innebär stadgandet alltid en be- gränsning av områdets storlek. Enligt praxis behöver en koncession att

1 Begreppen lågspänning och högspänning nämnas ej i 1902 års lag, men definitionerna dårå i 1939 års stadga ansluta sig till den i lagen angivna indelningen av starkströms- ledningar från spänningssynpunkt. Spänningen kallas lågspänning, när densamma mätt mellan en ledare och jord, eller vid icke direkt jordat system mellan två ledare, uppgår till högst 250 volt. samt högspänning när densamma mätt under angivna förhållanden överstiger 250 volt.

inom ett sålunda bestämt område framdraga lågspänningsledningar för att- män distribution icke kompletteras med särskilt tillstånd enligt 3 inom. att med ledningarna korsa allmän trafikled. Dylikt tillstånd erfordras endast för sådana ledningar, beträffande vilka koncession eljest icke skulle fordras.

I vissa fall kan även en koncession å högspänningsledningar få karaktär av områdeskoncession. För högspända jordkablar, vilka äro koncessions- pliktiga endast i den mån de beröra allmän trafikled, beviljas nämligen ofta allmänna tillstånd att korsa trafikleder inom helt stads- eller samhälls- område.

Koncessionsskyldighetens omfattning har bestämts av angelägenheten att förekomma fara vid de elektriska anläggningarnas användande samt av in- tresset att förbehålla det allmänna ett väsentligt inflytande på elkraftför- sörjningen. Det kan ifrågasättas om man för att bättre tillgodose dessa intressen skall utsträcka koncessionsskyldigheten till att omfatta även jordkablar och ledningar över egen mark.

Bestämmelserna om koncessionstid och om saklig prövning av ansökning- arna innefattas i 2 5 4 mom. av 1902 års lag, vilket stadgande lyder:

Tillstånd, varom i 1—3 mom. sägs, meddelas för viss tid, ej överstigande fyrtio eller, om särskilda skäl därtill föranleda, sextio år. Vid prövning av ansökan om så— dant tillstånd bör hänsyn jämväl tagas till huruvida behov av anläggningen förefin- nes samt huruvida denna kan anses förenlig med en planmässig elektrifiering. Med- delas det sökta tillståndet, skall tillika föreskrivas, under förbehåll av enskild rätt, på vilket sätt och under vilka villkor anläggningen må utföras och nyttjas.

Därest icke för särskilt fall annat medgives, vare tillstånd, som i 1 inom. avses, förfallet, om anläggningen icke tages i bruk inom tre år från den dag tillståndet meddelades.

Som nämnts var frågan om koncessionstiden redan från början föremål för delade meningar. Införandet i 1902 års lag av bestämmelsen om begräns- ning av koncessionstiden sammanhängde med ovissheten om huru kraft— distributionen i fortsättningen skulle komma att utveckla sig. Med hänsyn framför allt till det allmännas intresse av att framdeles kunna eventuellt inlösa anläggningar eller föreskriva ändrade villkor ansåg riksdagen en tidsbegränsning av koncessionen vara erforderlig. I sitt betänkande (SOU 1936: 27) underströk sakkunniga för elektriska kontrollväsendet betydelsen av det sedan slutet av år 1907 tillämpade koncessionsvillkoret, att inne- havare av elektrisk anläggning skall vara skyldig iakttaga de allmänna be- stämmelser i fråga om leverans av elektrisk kraft från sådan anläggning, vilka framdeles kunna bliva i laga ordning fastställda samt yttrade i an- slutning härtill bl. a. följande.

Föreskrift om särskild koncessionstid synes under sådana omständigheter egent- ligen opåkallad. Till stöd för borttagande av bestämmelsen därom kan bland annat anföras följande. Tidsbegränsningen medför ett osäkerhetsmoment, som verkar besvärande för både distributörer och abonnenter. Detta gör sig särskilt gällande, när koncessionstiden börjar lida mot sitt slut. Kraftdistributören har då svårt

att avsluta ett leveransavtal för längre tid med en abonnent, enär han icke vet, huruvida han kan fullfölja avtalet efter koncessionstidens slut. Han kan vidare fin- na sig nödsakad att tillsvidare undanskjuta vidtagandet av erforderlig utbyggnad eller förstärkning av anläggningen på grund av att kostnaderna därför med nor- mala kraftpriser icke hinna avskrivas under den återstående koncessionstiden. En tidpunkt av 40 år torde visserligen i och för sig vara tillräcklig för amortering av de ursprungliga anläggningskostnadcrna. Men dessa åtföljas senare successivt av mer eller mindre dyrbara kompletteringar. Härtill kommer vidare den om- ständigheten, att koncession å ledningar, som anslutas till tidigare koncessionerad ledning, enligt praxis endast beviljas för den tidsperiod, som då återstår av den 40-åriga koncessionstiden för huvudledningen. Sådana koncessioner kunna där- för ibland komma att gälla endast ett fåtal år. Sammanlagt finnas sålunda starka skäl av ekonomisk natur, som direkt tala emot att begränsa koncessionernas gil- tighet i tiden.

Å andra sidan kan naturligtvis med hänsyn till den rastlösa utveckling, som äger rum på det tekniska området, ej heller nu med bestämdhet överblickas, huru kraftförsörjningsproblemet kommer att te sig i en mera avlägsen framtid. Det kan endast konstateras, att elektrifieringen hittills genomförts på ett i stort sett till- fredsställande sätt samt att, såvitt för närvarande kan bedömas, en fortsatt gynn- sam utveckling på ifrågavarande område är att förvänta.

Om emellertid försiktigheten anses bjuda, att staten även i fortsättningen genom en begränsning av koncessionstiden förbehåller sig rätten att ånyo taga koncessio- nerna under omprövning, är i varje fall nödvändigt, att tiden tillmätes riktigare än förra gången. Sakkunniga hava härutinnan kommit till den uppfattningen, att koncessionstiden icke bör understiga 55 år, motsvarande den tid för vilken enligt gällande bestämmelser utarrendering av kronan tillhörigt, icke bebyggt vattenfall brukar äga rum. För att underlätta erforderliga amorteringar vilja sakkunniga förorda, att maximitiden ytterligare något utökas, och föreslå därför, att konces- sionstiden för framtiden skall avse viss tid, icke överstigande 60 år.

I yttrande över betänkandet anförde domänstyrelsen.

Frågan om koncessionstidens begränsning är uppenbarligen av stor betydelse även för markägarna, vilka genom statligt ingripande tvingas upplåta mark för elektriska ledningars framdragande. Koncessionstidens begränsning medför näm- ligen möjlighet för en markägare att få frågan om ersättning för skada och in- trång genom upplåtelsen upptagen till förnyad prövning. Beträffande krono- egendom har tillstånd till lednings framdragande hittills plågat meddelas i sam- band med koncessionens beviljande och för samma tid, som koncessionen avser. Då åtminstone vad angår egendom, som står under styrelsens förvaltning, ersätt- ningen i regel bestämmes till visst belopp för koncessionstiden, har markägaren tydligen icke möjlighet att bliva delaktig av en under koncessionstiden inträffad värdestegring å den upplåtna marken. Ju längre koncessionstiden är, desto större kunna olägenheterna härav bliva. Med hänsyn till den faktiska utvecklingen av fastighetsbildningen och fastighetsvärdena under de senaste trettio åren samt den framtida utveckling, som kan förväntas, anser styrelsen, att ökning av konces— sionstiden icke bör ske.

I propositionen (nr 137), som föregick 1938 års lagändring, uttalade de- partementschefen att han ansåg det ur allmän synpunkt ofrånkomligt, att koncessionstiden även i fortsättningen var i lag begränsad samt att han, med hänsyn till att den fortsatta utvecklingen på elektrifieringsområdet

åtminstone på längre sikt icke kunde förutses, särskilt med tanke på tek- nikens ofantliga utvecklingsmöjligheter, närmast var höjd för att förorda ett bibehållande av maximitiden fyrtio år. Då emellertid vägande motiv anförts även för en utökning av tiden i vissa fall föreslogs den nu gällande formuleringen av första meningen i 2 5 4 mom. av 1902 års lag.

Förhållandet mellan koncessionstiden och expropriationsrättens giltig- hetstid, som domänstyrelsen ovan berört, har behandlats av departements- chefcn i proposition (nr 317) till 1941 års höstriksdag med förslag till vissa ändringar i 1902 års lag.

Departementsehefen anförde därvid bl. a.

Att anknyta expropriationsrättcns giltighetstid helt till gällande koncession är tydligen av praktiska skäl uteslutet. Om t. ex. tilläggskoneession medgives, kan det vara uppenbarligen avsett, att ledningen skall bestå mycket lång tid, ehuru koncessionen begränsas till återstående tid av förut meddelad koncession. Avser expropriationen äganderätt, kan för övrigt enligt sakens natur någon begräns- ning ej ifrågakomma. Det synes lämpligt att i expropriationstillståndet angives, huru länge den genom expropriationen förvärvade rätten må gälla, om den utgör äganderätt. Härvid synes i regel kunna föreskrivas, att rättigheten skall gälla för all framtid, såvida ledningen i fråga utan längre avbrott alltjämt användes för sitt ändamål.

De i lagen angivna koncessionstiderna äro uttryckligen maximitider och det ankommer sålunda på koncessionsmyndigheten att inom i lagen angiven ram anpassa koncessionstiden efter omständigheterna. Beträffande tillämp— ningen av ifrågavarande bestämmelse gäller att koncession i regel beviljas för fyrtio år från dagen för Kungl. Maj:ts respektive kommerskollegii be- slut, dock att koncession å en ledning, som framdrages från redan kon- cessionerad ledning, endast beviljas för återstoden av koncessionstiden för i huvudledningen. Under senare år har man även sökt avväga koncessions- tiderna för ledningsnät inom samma bygd eller landsända så, att de utlöpa samtidigt även om näten tillhöra olika företag. Avsikten härmed är att underlätta en sammanslagning av flera smärre företag i samband med kon- cessionstidens utgång. Den genom 1938 års lagstiftning införda möjligheten att om särskilda skäl därtill föranleda bevilja koncession för sextio år har ännu icke tillämpats i något fall.

I detta sammanhang kan nämnas, att ledningar med tillstånd gällande tillsvidare ännu förekomma i betydande omfattning. Detta gäller särskilt lågspänningsledningar, som före den 1 juli 1939 framdragits inom område för vattentrafikled, järnväg eller allmän väg, samt högspänningsjordkablar inom dylikt trafikområde.

Elkraftutredningen anser att de nuvarande bestämmelserna om konces- sionstidens längd äro tillfredsställande såväl med hänsyn till det allmännas som koncessionsinnehavarnas intressen.

Före 1938 års lagändring funnos inga uttryckliga bestämmelser om saklig prövning av koncessionsansökningar, bortsett från att det av lagens avfatt-

ning framgick att hänsyn skulle tagas till säkerhetssynpunkter och av an— läggningarna berörda kommuners och fastighetsägares intressen. Enligt praxis blevo till en början koncessionsansökningarna undantagslöst bifallna av Kungl. Maj:t. Däremot förekommo ibland avslag å ansökningar om ex- propriationsrätt för vederbörande anläggningar, när de i lag angivna förut- sättningarna för beviljande av dylik rätt icke ansågos uppfyllda.

Frågan om syftet med och omfattningen av prövningen av koncessions- ansökningarna behandlades såväl vid förarbetena till 1902 års lag som i kraftkommitténs betänkande år 1914, elektrifieringskommitténs slutliga yttrande år 1923 och sakkunnigas för elektriska kontrollväsendets huvud- betänkande år 1936. Sistnämnda sakkunniga anförde beträffande den hit- tills skedda utvecklingen bl. a.

Den i allt större omfattning genomförda elektrifieringen föranledde emellertid, att vid koncessionsbehandlingen ett närmare beaktande av konkurrensförhållan- dena började visa sig ofrånkomligt. Konkurrensen avsåg i första hand gräns- områdena mellan olika distributionsföretag men kunde även gälla större oelektri- fierade områden, beträffande vilka ansökningar om tillstånd att framdraga elekt- riska ledningar inkommo från skilda elektrifieringsförctag. För att i någon mån förhindra tillkomsten av ur rationell elektrifieringssynpunkt icke önskvärda an— läggningar tillgreps till en början en utväg, som alltjämt kommer till användning, nämligen att söka åtadkomma en frivillig överenskommelse mellan konkurrenter- na, framför allt genom förmedling av statsinspektörerna, men i vissa fall genom vederbörande länsstyrelser. Det enda påtryckningsmedel, som i sådant syfte begag- nades, var ett fördröjande av själva koncessionsbehandlingen.

Däremot hystes i det längsta betänkligheter mot att från statens sida ingå på en direkt behovsreglering. Anledningarna därtill torde hava varit dels tvekan, huruvida behovssynpunkter över huvud taget borde anläggas vid tillämpningen av 1902 års lag, dels insikten om att ett övergivande av dittills följd praxis skulle i hög grad komplicera koncessionsbehandlingen. Småningom har emellertid ett positivt ståndpunkttagande i frågan ägt rum. Sålunda förekommer numera, att Kungl. Maj :t efter behovsprövning helt eller delvis avslår ansökningar eller vid bifall uppställer särskilda koncessionsvillkor för att söka förebygga dubbla led- ningar. Besluten hava fattats i huvudsaklig överensstämmelse med vad i inford- rade utlåtanden föreslagits av kommerskollegium. Ifrågavarande av konkurrensför- hållandena framkallade realprövning har hittills tillämpats med stor försiktighet och kommit till direkt uttryck endast i ett fåtal beslut, vilka framför allt fattats un- der de senaste åren. Ytterligare avgöranden av motsvarande natur torde i viss mån hava förekommits därigenom att parterna redan under den förberedande behand- lingen förmåtts träffa överenskommelse med varandra.

Under åberopande av att behovsprövningen dittills förekommit i praxis vid avgörande av ett antal individuella fall och att några erinringar däremot från riksdagens sida icke framkommit utgingo sakkunniga för elektriska kontrollväsendet från att denna väg fortfarande stod öppen för Kungl. Maj :t utan direkt bemyndigande i 1902 års lag. De sakkunniga föreslogo sålunda ingen lagändring i denna fråga.

I propositionen (nr 137) till 1938 års riksdag framhöll departements- chefen, att det framlagda förslaget var avsett att utgöra ett grundläggande

led i en genomgripande modernisering av gällande bestämmelser angående elektriska starkströmsledningar, samt anförde Vidare bl. a.

Beträffande riktlinjerna för ett fortsatt koncessionssystem må till en början framhållas, att en realprövning av ansökningar om tillstånd att utföra starkströms— ledningar, vilken redan nu i viss omfattning äger rum, synes mig nödvändig såväl ur allmän elektrifieringssynpunkt som med hänsyn till de starka intressemotsätt- ningar, som ofta förekomma när olika ledningsnät framdragas i närheten av var- andra. Jag delar även den i de verkställda utredningarna framförda uppfattningen, att behovsprövning av ansökningarna kan väntas för framtiden bliva erforderlig i betydligt större utsträckning än hittills. Ehuru en dylik prövning måste anses tillkomma Kungl. Maj:t utan särskilt stadgande, finner jag önskvärt att ifrågavaran- de princip, som, även om den tillämpas med försiktighet, kan bliva av genomgri- pande betydelse för koncessionsväsendet, kommer till direkt uttryck i lagen. Denna bör jämväl upptaga det villkoret för bifall till koncessionsansökan att anlägg- ningen bör vara förenlig med en planmässig elektrifiering. Det är emellertid av vikt, att bestämmelsen i fråga erhåller en så allmän avfattning, att den icke utgör hinder för Kungl. Maj:t att vid ärendenas avgörande taga hänsyn till övriga om- ständigheter i de särskilda fallen.

Koncessionsmyndigheten har alltså att pröva om behov finnes av en pla- nerad anläggning och om den kan anses förenlig med en planmässig elektri— fiering. Enligt departementschefens uttalande skulle myndigheten vid ären- dets avgörande kunna taga hänsyn även till andra omständigheter i det sär- skilda fallet. Den sålunda lagstadgade realprövningen, vilken förutsattes kunna bli av genomgripande betydelse för koncessionsväsendet, har emel— lertid tillämpats med stor försiktighet.

I praxis sker den sakliga behandlingen hos kommerskollegium så, att i första hand de i remissinstansernas yttranden framlagda anmärkningarna prövas. Dessa kunna exempelvis föranleda att särskilda koncessionsvillkor stadgas till skydd för trafiken vid flygfält, vägar o. d. Vidare undersöker kommerskollegium med ledning av tillgängliga kartor och handlingar, att uppkomsten av dubbla ledningsnät förhindras och att skäliga krav på plan— mässighet bli tillgodosedda. Planmässighetsprövningen går närmast ut på kontroll av att ledningarna ej utsträckas till områden, som lämpligen böra försörjas från annat håll, samt stundom även av att de äro så förlagda, att en fortsatt elektrifiering icke försvåras. Däremot sker ingen mera in- gående prövning av nätets planmässighet i den meningen att dess sträck- ning, omfattning och standard tilläter ett nöjaktigt tillgodoseende av byg- dens elkraftbehov. En prövning härav kan knappast ske enbart på grund- val av koncessionshandlingarna utan skulle förutsätta en mer omfattande undersökning.

Rimligt vore, att vid tillämpningen av den lagstadgade planmässighets- prövningen även undersöktes, om ledningsnätet skulle bli sådant, att det kunde tillgodose alla förutsebara normala behov av elkraft inom ifrågava- rande bygd. Om man vill taga fasta på det förhållandet, att stadgandet i 2 % 4 mom. 1902 års lag vid lagändringen år 1938 erhöll en allmän avfatt-

ning just med tanke på att den icke skulle utgöra hinder för koncessions- myndigheten att vid de särskilda ärendenas avgörande taga hänsyn jämväl till andra omständigheter än behov och planmässighet, borde redan enligt gällande lag koncession kunna vägras så snart det sökande företagets verk— samhet icke kan förväntas fylla alla skäliga anspråk på god kraftförsörj— ning till rimligt pris.

Frågan om förnyelse av koncession har icke blivit föremål för särskild behandling i lagen. I princip skola alltså ansökningar om förnyad konces— sion prövas efter samma grunder som ansökningar, avseende nya anlägg- ningar, men det är naturligt att hänsyn tages till att anläggningen finnes. Realprövningen är icke heller här tillfredsställande. Någon prövning av att ett befintligt lokalt ledningsnät är tillräckligt dimensionerat för att på läng- re sikt tillgodose ortens normala behov av elkraft även för motordrift, elkök etc. sker sålunda icke. Förutsättningen för att en förstärkning av nätet skall uppställas såsom villkor för förnyad koncession är, att nätet icke fyller gällande säkerhetsföreskrifter, därvid ofta % 6 mom. c och 5 72 i kommerskollegii föreskrifter (de 5. k. utlösningsvillkoren) kunna åbero- pas. Någon undersökning av exempelvis spänningsfall i nätets olika delar vid den ökade belastning, som framdeles kan anses sannolik, är däremot ej direkt påkallad ur säkerhetssynpunkt och dylika brister bli därför ej upp- märksammade vid koncessionsprövningen.

Formellt finns enligt nuvarande lag möjlighet att vägra koneessionsför— nyelse om företaget icke kan väntas fylla skäliga anspråk på god kraftför— sörjning till rimligt pris. Enligt elkraftutredningens uppfattning saknas emellertid i stor utsträckning förutsättningar för att utnyttja stadgandet och förutsättningarna härför böra alltså förbättras.

Några bestämmelser om prövning av koncessionssökandens lämplighet att handha distributionsverksamhet finnas ej i lagen. Koncession meddelas för sökanden >>eller hans rättsinnehavare». Vid överlåtelse av koncessions- pliktig starkströmsanläggning fordras enligt 3 5 av 1939 års stadga endast, att anmälan därom göres till kommerskollegium.

De principer för koncessionsväsendet, som infördes genom 1938 års lag- ändring, ha icke blott medfört en ökning av antalet koncessionsärenden utan även ställt större krav på själva prövningen av ärendena. Sakkunniga för elektriska kontrollväsendet, som räknade med detta, diskuterade inrättandet av ett permanent koncessionsråd, anknutet till kommerskollegium. Majori— teten ställde sig avvaktande i denna fråga, medan ordföranden med hänvis- ning till nödvändigheten av att skapa garantier för att koncessionsfrågorna bleve auktoritativt förberedda, i reservation föreslog, att kommerskollegium skulle utrustas med ett dylikt råd. I propositionen till 1938 års riksdag anför- de departementschefen, att ett konstant rådgivande organ icke syntes erfor— derligt. I varje fall borde med åtgärd i sådant syfte anstå i avvaktan på erfa- renheter rörande verkningarna av de nya bestämmelserna. Han hänvisade

till att såväl departementet som kommerskollegium torde vara i tillfälle att vid behov anlita biträde av utomstående sakkunniga personer.

Särskilda författningsbestämmelser om rätt respektive skyldighet för sta- ten att inlösa elektrisk anläggning ha icke ansetts erforderliga. Därest för- nyelse av koncession skulle vägras, torde detta som regel bero på att kon- cession anses böra lämnas åt annat företag inom det berörda området. Där- vid föreligger möjlighet att, såsom villkor för den nya koncessionsrätten, intaga föreskrift om skyldighet för den nye koncessionshavaren, vare sig i det gäller staten i egenskap av kraftdistributör eller enskilt företag, att in— ! lösa den befintliga anläggningen.

! |

Föreligga särskilda skäl för att arbete med koncessionspliktig ledning ut- föres redan innan koncession beviljats kan koncessionsmyndigheten enligt 2 5 5 inom. 1902 års lag förklara hinder icke möta härför (förhandstill- stånd). Anläggning får icke tagas i bruk förrän drifttillständ utfärdats av vederbörande tillsyningsman, dvs. i regel överinspektören i distriktet, och drifttillständ kan erhållas först sedan koncession eller förhandstillstånd beviljats. I sistnämnda fall förutsättes att koncessionsansökan är ingiven. ; l koncessionen skall föreskrivas på vilket sätt och på vilka villkor anlägg- ningen må utföras och nyttjas. Sedan slutet av år 1907 torde i samtliga kon— l cessioner ha intagits ett villkor, som sedermera såsom allmän bestämmelse upptogs först i 1916 års kungörelse och sedan i 25 5 av 1939 års stadga. » Enligt nämnda bestämmelse är innehavare av koncessionspliktig anlägg- , ning skyldig att iakttaga de allmänna bestämmelser i fråga om leverans

av elektrisk kraft från sådan anläggning, vilka framdeles kunna bli i laga l ordning fastställda. I koncessioner rörande ledningar för 200 kV eller högre * spänning ävensom för sådana ledningar för 130 kV, som kunna tänkas bli utnyttjade för andra ändamål än sökandens egna, föreskrives skyldighet för koncessionshavaren att iakttaga de föreskrifter om samkörning med andra ledningar som kunna komma att utfärdas av Kungl. Maj:t samt att deltaga i kostnaden för samkörningen.

De gällande koncessionsbestämmelserna komma att upptagas till ytter- ligare behandling och bedömande på ett flertal ställen i de under denna avdelning följande kapitlen. Den formella handläggningen behandlas så- lunda i kap. 13, behovsprövningen delvis i kap. 7 och frågor om distribu— tionsskyldighet i kap. 12.

; Säkerhet och tillsyn

Huvudbestämmelserna om starkströmsanläggningars utförande och sköt- sel samt tillsynen däröver finnas i 1939 års stadga. Med starkströmsanlägg— ningar förstås enligt stadgan sådana anläggningar och däri ingående sär— skilda föremål, i vilka alstras, omformas, överföres. eller nyttjas elektrisk kraft med sådan spänning eller strömstyrka, att fara för person eller egen-

dom därav kan förorsakas. Det är sålunda faromomentet som är avgörande för säkerhetsföreskrifternas tillämpning.

Stadgan innehåller bestämmelser om hur starkströmsledningar skola an— ordnas i förhållande till allmän väg, vattentrafikled, järnväg och svag— strömsledningar samt om starkströmsledningar inom tätare bebyggt område och inom kronoegendom, bestämmelser om anmälningsskyldighet, om drif- ten och om tillsynen över elektriska anläggningar.

Bestämmelserna om hur starkströmsledningarna skola vara beskaffade vid korsning med trafikleder och svagströmsledningar samt inom tätare bebyggt område äro till största delen av teknisk beskaffenhet. Bestämmel- serna om starkströmsledningars framdragande inom kronoegendom äro mest av administrativ natur. Dessa bestämmelser äro föremål för omarbet- ning inom kommerskollegium och elkraftutredningen finner icke anledning att närmare gå in på desamma.

Bland driftsbestämmelserna i 1939 års stadga ingår i 12 5 ett stadgande om att innehavare av starkströmsanläggningar skall tillse, att till anlägg- ningens drift hörande arbeten utföras av personer, som äga nödig sakkun— skap ävensom kännedom om för sådana arbeten gällande bestämmelser, Några särskilda kompetenskrav för driftledare finnas emellertid ej fast- ställda. I sina kommentarer till 12 å i stadgan anförde sakkunniga för elektriska kontrollväsendet följande.

De sakkunniga hava haft under övervägande införandet av särskilda kompe- tenskrav på sådana personer, som skola hava ansvaret för driften av elektriska distributionsanläggningar. Sådana bestämmelser hava utfärdats bland annat i våra grannländer Norge, Danmark och Finland. Vissa skäl särskilt de primitiva förhållandena vid en del smärre distributionsföretag på landsbygden _ torde kunna anföras, som tala för behovet av dylika bestämmelser även hos oss. Å andra sidan skulle, just på grund av den allmänna förekomsten av smärre distributions- företag på landsbygden, införandet av kompetenskrav på driftledarna otvivelak- tigt leda till praktiska och ekonomiska svårigheter för dessa företag, åtminstone om dessa krav skulle, såsom på sina håll ifrågasättes, även avse teoretisk facklit- bildning. De sakkunniga hava icke heller ansett sig böra förorda en så ingripande åtgärd utan hava inskränkt sig till att föreslå en allmänt hållen bestämmelse om skyldighet för anläggnings innehavare att tillse, att driftarbeten utföras av per- soner, som äga nödig sakkunskap ävensom kännedom om för sådana arbeten gällande bestämmelser.

Frågan om företagens behov av och tillgång till teknisk sakkunskap he- handlas närmare i kap. 11.

Skall arbete utföras å starkströmsledning i farlig närhet av annan dylik ledning är innehavaren av den sistnämnda ledningen enligt 13 5 skyldig att försätta sin ledning ur drift så länge arbetet pågår.

Bestämmelserna om statlig tillsyn över starkströmsanläggningarnas ut- förande och skötsel återfinnas i 14—24 55 i stadgan. Tillsynen utövas huvudsakligen av fyra överinspektörer, envar med särskilt distrikt men med Stockholm som förläggningsort. Innan arbete med koncessionspliktig an-

läggning påbörjas skall anmälan ske till kommerskollegium, varpå vederbö— rande inspektör har att utöva tillsyn över anläggningarnas utförande. Anlägg— ningen får icke tagas i bruk förrän tillsyningsmannen utfärdat drifttillstånd. För att drifttillstånd skall kunna utfärdas fordras att anläggningen blivit av tillsyningsmannen »avsynad och godkänd eller denne eljest funnit hin- der ur säkerhetssynpunkt icke föreligga mot anläggningens brukande».

Besiktning av anläggningar som äro i bruk skall ske så ofta kommers- kollegium därom förordnar eller tillsyningsmannen finner erforderligt. Be— siktning kan också påkallas av väg— och vattenbyggnadsstyrelsen, järnvägs- styrelsen, telestyrelsen eller vederbörande länsstyrelse. Tillsyningsman- nen har att meddela de föreskrifter som erfordras till förekommande av fara i följd av anläggningens drift. Nu anförda bestämmelser gälla koncessions- pliktiga anläggningar men även andra starkströmsanläggningar må besik— tigas på liknande sätt i den omfattning kommerskollegium eller överinspek- tör finner erforderligt.

I stadgan framhålles att tillsyningsman vid utövandet av tillsynen bör tillvägagå med varsamhet samt tillse, att erforderligt skydd vid starkströms— anläggningarna vinnes med minsta olägenhet för deras ägare.

Om tillsyningsman beslutat, att viss åtgärd i avseende å starkströms- anläggning skall vidtagas eller att sådan anläggning skall sättas ur bruk intill dess föreskriven åtgärd blivit vidtagen, skall ägaren eller arbetsföre- ståndaren erhålla skriftligt meddelande därom. Där så anses nödigt kan tillsyningsmannen göra framställning hos polismyndigheten om på den an- kommande åtgärd i anledning av beslutet. Den som är missnöjd med beslut kan föra talan däröver hos kommerskollegium.

Enligt 4 & i stadgan skall anmälan till kommerskollegium ske om olycks— fall och driftstörningar som inträffa vid koncessionspliktiga anläggningar.

För underlåtenhet att efterkomma bestämmelserna i stadgan eller av kom- merskollegium eller tillsyningsman med stöd av densamma meddelade före- skrifter stadgas bötesstraff. Dylik förseelse står under allmänt åtal.

Kommerskollegium har med stöd av bemyndigande i 1939 års stadga år 1939 utfärdat säkerhetsföreskrifter för elektriska starkströmsanläggningar. Enligt dessa skall periodisk kontroll av vissa anläggningsdelar utan anma- ning ske genom vederbörande driftlednings försorg åtminstone en gång vart tredje år, för vissa anläggningsdelar varje år. Besiktningen kan utföras av person, som är anställd vid det företag som äger anläggningen, under förut— sättning att han har erfarenhet och kompetens att bedöma om anläggningen är utförd enligt de föreskrifter, som gälla för densamma. Resultatet av be- siktningar och mätningar skall hållas tillgängligt för kontroll. Denna pe— riodiska besiktningsverksamhet eftersättes emellertid f. n. i stor utsträck— ning, och elkraftutredningen anser det angeläget att man skapar garantier för att den verkställes av företagen enligt gällande föreskrifter.

Statlig tillsyn över elektriska anläggningar utövas även jämlikt arbetar-

skyddslagen den 3 januari 1949. I arbetarskyddslagen föreskrives bl. a. att sådana åtgärder skola vidtagas, att fara för skada genom elektrisk ström i möjligaste mån undgås. Tillsyn av lagens efterlevnad utövas av arbetar— skyddsstyrelsen samt, under dess överinseende och ledning, av yrkesinspek- tienens befattningshavare, kommunala tillsyningsmän och specialinspektö— rer. Enligt Kungl. Maj:ts kungörelse den 17 december 1948 (nr 825) skall den tillsyn, som åligger yrkesinspektör i vad angår skydd mot olycksfall genom inverkan av elektrisk ström vid elektriska starkströmsanläggningar, utövas av överinspektörerna i egenskap av specialinspektörer inom yrkes— inspektionen.

Statliga föreskrifter om besiktning, som även avse elektriska anlägg— ningar, inrymmas i ett flertal olika specialförfattningar, exempelvis i brand- stadgan den 15 juli 1944, stadgan den 8 juni 1917 angående hotell- och pensionatrörelse och förordningen den 3 juni 1932 med vissa bestämmel- ser angående biografer och filmförevisning.

Den statliga besiktningsverksamheten upptages till närmare behandling 1 kap. 13.

Anläggningar som icke äro föremål för närmare tillsyn från statens sida. dvs. företrädesvis konsumentanläggningar, besiktigas i viss utsträckning genom enskilda organ. Här kan nämnas de större elverkens besiktningar av nytillkomna abonnentanläggningar samt den periodiska revisionsbesikt- ningen av vissa elektriska konsumentanläggningar, som normalt uppställes såsom brandförsäkringsvillkor och som övervakas av Svenska brand- skyddsföreningens elektriska nämnd.

Revisionsbesiktning brukar fordras beträffande elektriska anläggningar som finnas inom eller ingå i byggnader och lokaler av olika slag. Bland dessa kunna nämnas fabriks- eller hantverksrörelser och varulager, under förutsättning att försäkringssumman uppgår till visst minimibelopp, vidare generatorer och trans— formatorer, kyrkor, biografer, hotell eller pensionat med flera än 25 resanderum, samt ekonomibyggnader vid lantgårdar, såvida inom byggnaden finnes elektrisk motor, motorkontakt eller flera än 10 ljuspunkter och den odlade jorden översti- ger 20 hektar. Av uppräkningen framgår, att bostadshus och dylikt fortfarande icke äro föremål för revisionsbesiktning. Revisionsbesiktning skall äga rum minst vart tredje kalenderår med undantag för särskilt uppräknade anläggningar, som skola besiktigas minst en gång varje kalenderår med en mellantid av högst 18 månader mellan varje besiktning.

Stor betydelse ur säkerhetssynpunkt ha även bestämmelserna om kontroll av viss elektrisk materiel. Kungl. kungörelse härom har utfärdats den 26 april 1935. Enligt denna äger kommerskollegium meddela föreskrift att installa- tionsmateriel eller bruksföremål, som vid elektriska starkströmsanlägg— ningar nyttjas företrädesvis inomhus, skola vara godkända av materiel— kontrollanstalt. Materiel, som fanns i bruk innan föreskriften meddelades, får dock fortfarande användas men får icke försäljas sedan föreskriften trätt i kraft.

Genom lagstiftningen år 1938 infördes i 2 & 6 mom. av 1902 års lag bestämmelser om reglering av priset å elektrisk ström. Frågan om reglering av elkraftpriset hade tidigare behandlats bl. a. av den år 1911 tillsatta kraftkommittén, men icke föranlett några åtgärder. Anledningen till att prisregleringsinstitutet infördes 1938 var framför allt att man ville hindra missbruk av den starkare ställning, som företagen kunde erhålla genom be- stämmelsen om behovsprövning av koncessionsansökningarna.

Innehavare av koncessionerad starkströmsanläggning är nu skyldig att underkasta sig reglering av priset för strömmens tillhandahållande. Statens taxor ävensom pris, som fastställts av kommunal myndighet att gälla inom ) kommunen, äro undantagna från prisreglering. Begäran om prisreglering kan göras av den som nyttjar elektrisk ström från anläggningen eller öns- kar komma i åtnjutande därav. Ansökan om ändring i eller upphävande av beslutad prisreglering kan göras även av anläggningens innehavare. Pris— regleringen verkställes av statens prisregleringsnämnd för elektrisk ström.

Framställning om prisreglering ingives till kommerskollegium, som efter förberedande handläggning kan besluta att antingen avvisa framställningen ' såsom uppenbart ogrundad eller vidarebefordra den till prisregleringsnämn- l den. Då framställningen från kommerskollegium överlämnats till nämnden, : åligger det nämnden i första hand att söka åstadkomma frivillig uppgörelse | mellan parterna. Nämnden har att i sådant syfte hänvisa parterna att un- . derställa tvistefrågan Svenska elverksföreningens tariffkommission. Kom- l mer förlikning icke härvid till stånd, må prisreglering likväl ej av nämnden ' verkställas, förrän möjligheterna att förlikningsvis i annan ordning bilägga tvisten blivit av nämnden undersökta. Skäligheten av priset å ström- leverans skall av nämnden bedömas med hänsyn till de förhållanden, under vilka strömmen i det särskilda fallet levereras. Prisreglering kan ske även för det fall att prisöverenskommelse redan föreligger mellan parterna och avtal stridande mot nämndens beslut är utan verkan. Över kommerskollegii eller prisregleringsnämndens beslut må talan ej föras. Någon påföljd vid överträdelse av prisregleringsnämndens beslut finnes icke föreskriven.

Erfarenheten hittills har visat, att flertalet av de till kommerskollegium inkomna klagomålen rörande elkraftpriser icke behövt hänskjutas till nämnden; ett klarläggande av förhållandena under den förberedande be— handlingen inom kommerskollegium har ofta medfört, att beslut icke på- kallats. Under åren 1939—1952 ha omkring 400 ärenden inkommit till kommerskollegium och av dessa ha sammanlagt 50 ärenden hänskjutits till prisregleringsnämnden. I flertalet av dessa har förlikning åstadkommits genom tariffkommissionens försorg och prisregleringsnämndens avgörande har påkallats i endast 11 fall. En tendens till ökning av antalet prisregle- ringsärenden har emellertid under senare tid förmärkts.

Frågan om utvidgning av prisregleringsnämndens behörighet upptages till behandling i kapitel 12.

Registrering av elektriska anläggningar och rätt till elektrisk kraft

Genom det år 1914 av kraftkommittén avgivna betänkandet framlades förslag till lag innefattande bestämmelser i syfte att trygga rätt till elektrisk kraft. Förslaget omarbetades inom justitiedepartementet och ledde till ut— färdande av lagen den 22 juni 1920 med bestämmelser om registrering av elektriska anläggningar samt om rätt till elektrisk kraft m. m.

Med lagstiftningen avsågs att bereda ökad möjlighet att i kreditsyftc utnyttja elektrisk anläggning och att trygga abonnents rätt att erhålla elekt- risk kraft.

Ledning eller understation, som tillhör ägaren av den fastighet, å vilken finnes elektrisk station, kan genom registrering å den fastighet, varå den elektriska stationen (huvudstationen) är belägen, sammanföras till en rättslig enhet med sistnämnda fastighet (huvudstationsfastigheten) (2 5). Med station förstås generator—, transformator-, omformare—, ackumulator- och kopplingsstation; såsom station anses jämväl stolpe, försedd med an- ordning för transformering av elektrisk kraft. Genom registreringen anses ledningen eller understationen höra till den fastighet varå huvudstationen är belägen och de komma således ej längre att höra till den fastighet, varå de äro belägna. Härigenom åstadkommes, att huvudstationsfastigheten på grund av sitt ökade värde kan av anläggningens ägare användas såsom kreditobjekt i väsentligt högre grad än eljest skulle vara förhållandet. Så- lunda kan exempelvis en elektrisk distributionsförening genom registrering av sina elektriska anläggningar å en föreningen tillhörig, å dess mark be- lägen transformatorstation få sina belåningsmöjligheter betydligt ökade. Genom registrering vinnes också den fördelen, att vid utmätning eller kon- kurs huvudstationsfastigheten och ledningar respektive understationer icke komma att säljas var för sig med de olägenheter som detta kan med— föra för kraftleveranserna. Registreringsmyndighet är kommerskollegium.

Har till någon upplåtits rätt till kraft kan enligt 14 5 i 1920 års lag till säkerhet för denna rätt erhållas inteckning i huvudstationsfastigheten jäm- te därå registrerade ledningar och understationer. (Lagen omfattar icke er- sättningskraft enligt vattenlagen). Förutsättningen för inteckning är, att rätten till elektrisk kraft upplåtits genom skriftlig handling och att ägaren av huvudstationsfastigheten lämnat skriftligt medgivande till att inteckning får ske. Genom denna förutsättning har emellertid från inteckningsrätt ute- slutits praktiskt taget alla mindre abonnenter, ty inteckning torde i regel endast komma att medgivas de större abonnenterna såsom kommuner och industriföretag. Överlåtes fastighet, varifrån elektrisk kraft tillhandahål- les, gäller emellertid avtalet även utan inteckning mot nye ägaren om det

är skriftligen upprättat. Är avtalet blott muntligt, går abonnenten genom överlåtelsen förlustig sin rätt, såvida ej vid överlåtelsen skett förbehåll om rättens bestånd. Även i fråga om försäljning å exekutiv auktion gäller, att rätten går förlorad såvida försäljningen ej sker med förbehåll om rättens bestånd.

Om elektrisk anläggnings ägare underlåter att fullgöra honom enligt avtal eller eljest åliggande skyldighet att tillhandahålla elektrisk kraft, kan överexekutor enligt 24 & förelägga ägaren vid vite att fullgöra skyldig- heten. Finnes anledning antaga, att skyldighetens fullgörande icke kan er- nås omedelbart genom föreläggande av vite samt underlåtenhet att tillhan- dahålla kraft kan medföra betydande skada eller olägenhet, äger överexe- ; kutor på ansökan förordna om särskild förvaltning av anläggningen. Frågan om avhjälpande av vissa brister i de nuvarande bestämmelserna 3 om registrering av elektriska anläggningar upptages till behandling 1 kap. 13.

Statens låne- och bidragsverksamhet

tades år 1918 en statlig lånefond, förvaltad av statskontoret och benämnd Icraftledningslånefonden. I enlighet med vissa av riksdagen godkända huvud-

grunder utfärdades kungörelse den 13 september 1918 (nr 718) angående . allmänna bestämmelser för lån från fonden. Enligt denna kungörelse med » däri gjorda ändringar gäller för närvarande följande lånegrunder.

!

I

| För att befrämja elektriska distributionsföreningars verksamhet inrät— |

|

|

| Lånen beviljas av kommerskollegium och lantbruksstyrelsen gemensamt. De skola användas till anläggande av elektriska distributionsnät på lands— bygden och utgå i första hand till ekonomiska föreningar men även till andra företag om dessa befinnas lämpligt organiserade och icke äro rena affärsföretag. Lån må icke beviljas med mindre företagets rätt att få erfor- derlig elektrisk energi är säkerställd samt företaget är i ekonomiskt och tekniskt hänseende grundat på rationella förutsättningar. Lån kan beviljas till hela anläggningskostnaden. Kommerskollegium och lantbruksstyrelsen äga meddela de särskilda villkor och föreskrifter i fråga om anläggningens utförande och skötsel, som kunna anses erforderliga för de med lånet av- sedda ändamålen. Lånen utlämnas av statskontoret, sedan låntagaren av- lämnat skuldförbindelse och säkerhet för förbindelsens behöriga fullgö— rande samt bevis att koncession för anläggningen meddelats. Lånet är amor- , teringsfritt under de två första åren och skall därefter återbetalas under » vart och ett av följande högst aderton, eller om särskilda skäl föreligga tjuguåtta år, med lika annuitet. Låntagaren har dock rätt att före lånetidens utgång på en gång inbetala ogulden del av länet. Låntagaren är skyldig att vidkännas den höjning av räntan, som Kungl. Maj:t med hänsyn till den effektiva medelräntan för statens upplåning kan finna gott bestämma; rän- tan är f. n. fyra procent. Därest statskontoret under lånetiden skulle finna

den ställda säkerheten icke vidare vara nöjaktig, skall låninnehavaren inom två månader efter erhållet föreläggande avlämna nya säkerhetshand- lingar, som av statskontoret godkännas. Det åligger kommerskollegium att ombesörja fortlöpande teknisk och ekonomisk kontroll av de företag, vartill lån lämnats, samt underrätta statskontoret om vad därvid förekommit. Lån- innehavaren skall vara skyldig underkasta sig dylik kontroll samt årligen till kommerskollegium avgiva redogörelse för företagets drift och ekono- miska ställning.

Hur kraftledningslånefonden utnyttjats framgår av följande uppställ— ning.

År Beviljade lån, kronor Låncränta, % 1920—_l92-l 12 200 000 5 1925—1929 5 535 000 5 1930 1934 3 633 000 4,5—5 1935——1939 1 789 000 4 —4,.'. 1940—1944 3 872 500 4 1945—1949 1 136 660 4 1950—1952 306 700 4

De för ytterligare utlåning disponibla medlen uppgingo den 1 juli 1953 till 3 745 000 kronor.

Som framgår av uppställningen har fonden icke utnyttjats i den omfatt— ning som varit möjlig. Orsakerna härtill kan man finna i att fondlåneräntan i allmänhet varit högre än normal bankränta och att fordringarna på så- kerhet varit större än vid banklån.

År 1919 inrättades en annan lånefond benämnd vattenkraftslånefonden. Kungörelse med allmänna bestämmelser för lån från fonden utfärdades den 19 december 1919 (nr 787). Län kan beviljas menigheter, bolag, föreningar eller enskilda dels till företag för utbyggande av statens vattenfalleller tillgo— dogörande av enskilda tillhöriga vattenfall, när tillgodogörandet är av mera allmänt intresse, dels till vissa mindre, lokala vattenkraftsanläggningar för distribution inom orten av elektrisk energi, dels ock till vattenregle- ringsföretag, då dessa äro av allmännare betydelse. Lån från fonden kan beviljas även till redan utförd anläggning, men det skall iakttagas, att lån i främsta rummet skall avse tillgodogörande av förut ej utnyttjade kraft— källor.

Lån beviljas av Kungl. Maj:t efter utlåtande från kommerskollegium samt väg- och vattenbyggnadsstyrelsen och kan uppgå till två tredjedelar av den beräknade anläggningskostnaden. De tre första åren äro amorterings— fria och återbetalning skall ske med lika annuitet under vart och ett av därpå följande fyrtio år. I övrigt gälla i tillämpliga delar likartade bestäm- melser som vid lån från kraftledningslånefonden.

.-.... _........._._..-.

Hur vattenkraftslånefonden utnyttjats framgår av följande uppställning.

År Beviljade län, kronor Lånerånta, % 1920—1924 6 268 000 5 —6 1925—1929 4 790 000 5 1930—1934 1 482 000 4,5—5 1935—-—1939 1 025 000 4 —4,5 1940—1944 2 734 000 4 1945—1949 1950—1952 2 372 300 4

De för ytterligare utlåning disponibla medlen uppgingo den 1 juli 1953 till i 2 723 000 kronor. ' Denna lånefond har liksom kraftledningslånefonden icke utnyttjats i den * omfattning som varit möjlig. Orsakerna härtill torde vara desamma som ; ifråga om kraftledningslånefonden.

Genom den av andra världskriget minskade tillförseln av bensin samt . lys- och brännoljor aktualiserades frågan om statliga åtgärder för lands- » bygdens fortsatta elektrifiering. Redan före krigsutbrottet hade statliga bi- | drag lämnats till särskilda elektrifieringsprojekt. Vidare beviljades av 1939 ' och 1940 års riksdagar anslag på tillsammans 100 000 kronor för under-

sökning rörande landsbygdens elektrifiering. Dessa anslag användes för i undersökningar inom vissa delar av landet, huvudsakligen i Gotlands, Göte- borgs och Bohus, Västernorrlands, Jämtlands, Västerbottens och Norrbot- tens län. Vid 1940 års urtima riksdag beviljades ett anslag av 5 milj. kronor för befrämjande av landsbygdens elektrifiering och i fortsättningen ha anslag för detta ändamål utgått så att sammanlagda anslagsbeloppet den 1 juli 1953 uppgick till 65 milj. kronor.

I den proposition, vari ovannämnda anslag på 5 milj. kronor begärdes, uttalades att anslaget borde användas för statsbidrag till elektrifierings- företag, vilka befunnos vara särskilt förtjänta och i behov av hjälp. Under- stöd borde lämnas endast åt sådana företag, för vilka kostnaderna över- stego vad som kunde anses såsom normala kostnader. Statsbidrag borde kunna erhållas som engångsbidrag av sådan omfattning, att företaget blev ekonomiskt självbärande. Man borde vidare icke bortse ifrån befolkningens 1 ekonomiska bärkraft i de trakter, där elektrifiering skulle ske. Några mera bestämda allmängiltiga regler rörande statsbidragens storlek eller de förut— ? sättningar, som borde gälla för bidragen, ansågs knappast kunna uppstäl— * las. Det fick ankomma på Kungl. Maj:t att bestämma därom från fall till fall "under beaktande av de föreliggande särskilda förhållandena. I samband med detta uttalande framhöll departementschefen, atti en utredning, som pågick inom statens bränslekommission, vissa riktlinjer för administratio- nen av den statliga stödverksamheten skulle komma att uppdragas.

Nämnda utredning innefattades i en av dåvarande förste byråingenjören J. Fletcher på uppdrag av bränslekommissionen utarbetad promemoria den 8 oktober 1940 angående statliga stödåtgärder för den fortsatta landsbygds- elektrifieringen.

I promemorian gjordes inledningsvis en undersökning av elektrifieringens omfattning år 1940 varvid konstaterades att ca 72 % av alla hushåll på landsbygden (exkl. köpingar och municipalsamhållen) voro elektrifierade. I de återstående 28 % oelektrifierade hushåll ingingo då även de hushåll, som voro att hänföra till icke elektrifierbara områden, vilka beräknades ut- göra 5 a 6 %. Uppskattningsvis beräknades kostnaderna för den återstående elektrifieringen med undantag för de oelektrifierbara områdena till följande ungefärliga belopp:

Bygdenäten ............................................ 25 milj. ki Ortsnäten ................................................ 165 >> » Installationerna ........................................ 85 >> »

Summa 275 milj. kr.

Fletcher anförde härefter bland annat följande.

Man kan tänka sig att möjligheten att erhålla statsbidrag skulle minska be- folkningens egna ansträngningar. Denna risk kunde dock motverkas om man hade en siffermässigt fastlagd subventionsnorm, enligt vilken vederbörande i varje särskilt fall kunde avgöra om statsbidrag vore att påräkna eller ej. En svårighet vore därvid att man måste avstå från att taga hänsyn till befolkningens egen ekonomiska bärkraft, som givetvis växlar från fall till fall. Ett projekt, avseende elektrifiering av ett område med relativt stor ekonomisk bärkraft, skulle kunna bli subventionsberättigat, oaktat det hade varit genomförbart utan stöd, medan ett annat projekt, avseende elektrifiering av ett område med relativt liten bärkraft, icke blev subventionsberättigat, oaktat stöd hade behövts.

Två olika beräkningssätt vid tillskjutande av statsbidrag kunna tänkas. Bidraget kan antingen beräknas så, att den resterande anläggningskostnaden blir av önskad och fastställd storlek, eller så, att den resterande årskostnaden nedbringas till skäligt värde. Årskostnadsberäkningen skulle i och för sig medföra större bidrags- belopp men då subventionsplanen lär komma att uppläggas så, att ett visst pen- ningbelopp ställes till förfogande för [fördelning bland de bidragssökande före— tagen torde det vara likgiltigt vilken av de båda metoderna som väljes. Anlägg- 11ingsk-ostnadsberäkningen är emellertid enklare och synes därför böra föredragas.

Det skulle ligga närmast till hands att tänka sig statsbidrag utan återbetalnings- skyldighet. Det bör då observeras att anslutningen i regel växer utan att anlägg- ningskostnaden stiger i samma proportion. Härvid minskas kostnaden per tariff- enhet. Det kan därför icke anses skäligt att bidraget från början nedsätter kost- naderna till det önskade >>normala» värdet. Alternativt kan man tänka sig bidrag med återbetalningsskyldighet vid växande anslutning. Bidraget bör då från början nedsätta anläggningskostnaden till det önskade värdet men företaget får återbetala bidraget allteftersom anslutningen växer.

Den första metoden är administrativt enklare men den kommer att verka ojämnt på grund av de växlande tillväxtmöjligheterna. Framförallt måste emellertid beaktas att den inbjuder till framläggande av ofullständiga projekt för områden,

vilkas elektrifiering vid fullständigare anslutning hade varit möjlig utan subven- tion. Metoden med återbetalningsskyldighet synes därför vara att föredraga.

Vid antagande att en fullt riktig behovsprövning skulle kunna göras i varje särskilt fall, skulle man komma till det resultatet, att 40 a 50 % av den återstående elektrifieringen borde vara möjlig utan statsbidrag. För återstoden skulle bidrag få lämnas som svarade mot skillnaden mellan verklig kostnad och i varje särskilt fall uppskattad bärkraft. Det totala subventionsbeloppet beräknas under dessa för- utsättningar till 35 a 40 miljoner kronor.

I verkligheten är det naturligtvis icke möjligt att genomföra en fullt riktig be- hovsprövning. Om man antager, att subvention utan hänsynstagande till bärkraften skulle utgå, då anläggningskostnaden överskrider en viss fixerad gräns i kronor per tariffenhet, skulle vissa projekt bli subventionsberättigade, trots att de tack vare tillräcklig bärkraft skulle kunna genomföras utan subvention medan andra , projekt skulle bli ogenomförbara därför att bärkraften ej skulle räcka ens upp till

subventionsgränsen. Även det maximala subventionsbeloppet i kronor per tariff- enhet kommer givetvis att påverka resultatet. Vid ett visst maximalt belopp och ökande subventionsgräns kommer det totalt erforderliga statsbidraget att sjunka. _ Samtidigt kommer givetvis även det totala antalet elektrifierbara tariffenheter att , sjunka, ehuru i något långsammare takt. Utbytet av subventionen kommer således * att öka. Om man å andra sidan tänker sig en viss subventionsgräns och ökande maximalt subventionsbelopp per tariffenhet, så skulle det totala statsbidraget komma att öka liksom även det totala antalet elektrifierbara tariffenheter. Dessa senare skulle dock öka i något långsammare takt, varför utbytet av subventionen skulle avtaga. Det är emellertid tydligt att man med en lämpligt vald subventions- gräns och ett i förhållande till denna lämpligt avpassat maximibelopp per tariff- enhet skulle kunna uppnå ett visst åsyftat resultat. Därvid skulle ett i stort sett entydigt samband föreligga mellan å ena sidan det totala bidrags'beloppet och å , andra sidan antalet elektrifierbara tariffenheter. Detta samband framgår av nedan— ! stående tabell.

Totalt bidrag Elektrifiering möjlig för milj. kr. nedanstående procent av elcktrifierbara områden 20 65 30 70 a 75 40 75 50 80 år 85

Någon anledning synes ej föreligga att tillsvidare inrikta sig på ett större belopp än 25 miljoner kronor, varmed i runt tal % av den återstående elektrifieringen skulle möjliggöras. Detta arbete kommer nämligen att taga så lång tid, att man icke rimligen bör uppgöra subventionsplanen på längre sikt än som motsvarar sagda belopp. Det gäller att avgöra hur detta belopp lämpligen bör användas. Om man väljer en låg subventionsgräns och en låg övre bidragsgräns skulle de elektrifie- ringar möjliggöras, som vore relativt billiga. En mycket stor del av statsbidraget skulle emellertid gå till projekt, som hade varit genomförbara utan stöd. Relativt höga gränser skulle därför leda till ett mera rationellt resultat. Man skulle even- tuellt sedermera kunna sänka subventionsgränsen, om så befunnes lämpligt. Under tiden skulle de självbärande projekten hunnit till rätt stor del genomföras utan subvention. Kalkylerna visa att den tills vidare lämpligaste kombinationen bör vara 90 kronor per tariffenhet såsom subventionsgräns och samma belopp såsom maximal subvention.

Vid en relativt hög subventionsgräns kan man förutsätta, att svårigheter i

vissa fall komma att uppträda för konsumenterna att erlägga den kvarstående normala kostnaden. På grund därav bör en särskild lånefond inrättas, förslagsvis benämnd statens elektrifieringslånefond. Statsbidrag bör icke lämnas till instal- lationerna, eftersom dessa icke äro beroende av de geografiska förhållandena. Lån för installationer bör emellertid efter behovsprövning kunna lämnas ur elektrifieringslånefonden.

Ansökningar om statsbidrag böra bearbetas och återbetalningsskyldigheten över- vakas av en central instans. Såsom sådan synes endast kommerskollegium kunna ifrågakomma. Yttranden om ansökningarna böra lämnas av en för ändamålet tillsatt prövningsnämnd. I denna bör ingå representanter för kommerskollegium, lantbruksstyrelsen och vattenfallsstyrelsen samt bränslekommissionen, så länge denna sistnämnda existerar.

I brev till statskontoret den 24 oktober 1941 förordnade Kungl. Maj:t fyra sakkunniga, eIektrifieringsberedningen, att verkställa de tekniska ut- redningar, som kunde vara erforderliga för bedömande av ansökningar 0111 statsbidrag till landsbygdens elektrifiering m. m., och att avgiva utlåtanden i frågor rörande sådant statsbidrag. Från och med den 15 januari 1948 har elektrifieringsberedningen även i uppdrag att avgöra statsbidragsansök— ningar.

Vid bidragsgivningen före år 1948 följdes i stort sett de inom bränslekom- missionen utarbetade riktlinjerna, innebärande bl. a. att, såvida ej särskilda omständigheter till annat föranledde, bidrag för elektrifieringsprojekt endast utgick för den del av anläggningskostnaden, som översteg 90 kronor per centralblocksenhet (CB-enhet), samt att bidragsbeloppet i regel begränsades till 90 kronor per CB—enhet. Subventionsgränsen och subventionsbeloppet har sedan 1948 successivt höjts. År 1951 infördes den ändringen att värdena skulle grundas på normaltariffenheter (Nte) i stället för CB-enheter.

De senaste grunderna för utdelande av statsbidrag ha fastställts av Kungl. Maj:t den 31 oktober 1952. Statsbidrag kan nu utgå för den del av anläggningskostnaden, som överstiger 150 kronor per Nte (motsvarande ungefär 120 kronor per CB-enhet), dock i regel med högst 225 kronor per Nte (motsvarande ungefär 180 kronor per CB-enhet). Genom 1952 års änd— ringar avsågs i första hand att åstadkomma en höjning av det maximala bidraget så att detta skulle stå i bättre överensstämmelse med de stegrade elektrifieringskostnaderna. Den specifika medelkostnaden för nyelektrifie- ringar, för vilka statsbidrag utlämnats, hade nämligen under tiden 1940— 1951 stigit från 190 kronor per Nte (= 150 kronor per CB—enhet) till 320 kronor per Nte och beräknades under år 1952 överstiga 400 kronor per Nte medan det maximala statsbidraget under samma period ökat från 115 kronor per Nte (= 90 kronor per CB-enhet) till 150 kronor per Nte. Härvid bortses från bidrag för s. k. specialelektrifieringar, socken-, fjällbygds— och skärgårdselektrifieringar, vilka genom ändring av bidragsgrunderna år 1951 skola prövas från fall till fall och för vilka inga särskilda maximigränser gälla. Orsakerna till kostnadsökningarna ha i första hand varit den all- männa prishöjningen samt det förhållandet, att elektrifieringen i större om-

fattning än tidigare avsett glesbebyggda områden. I samband med höjningen av det maximala bidraget beslöts även en höjning av lokalintressets insats, dvs. en höjning av den undre bidragsgränsen, till 150 kronor. Detta inne- bar icke ett fullständigt återställande av de ursprungliga proportionerna mellan lokalintressets insats och statsbidraget. Det ansågs nämligen moti- verat med en viss realsänkning av lokalintressets insats med hänsyn till att nyclektrifieringarnas ekonomi blir allt besvärligare ju högre den specifika kostnaden är.

I 1952 års statsverkspropOSition, under nionde huvudtiteln p. 116, begär- des anslag även för understödjande av nätförbättringar i samband med ny- elektrifieringar. l jordbruksutskottets utlåtande nr 32 den 6 maj 1952 till- , styrktes detta för särskilda fall i avvaktan på elkraftutredningens special- ; utredning angående upprustningsstöd. Kungl. Maj:t har i skrivelse den 5 i juni 1953 till statskontoret erinrat om vad jordbruksutskottet anfört om möjligheten för Kungl. Maj:t att för särskilda fall bevilja bidrag för upp- , rustning av befintliga distributionsnät.

I enlighet med förslag av bränslekommissionen i samband med överläm— nandet av Fletchers ovan refererade promemoria inrättades en ny lånefond, elektrifieringslånefonden, varom finnes bestämmelser i kungörelse den 2 maj 1941 (nr 297).

Lån från elektrifieringslånefonden kan av kommerskollegium beviljas in- nehavare av fastighet för framdragande av elektrisk starkströmsledning till fastigheten för anslutning till befintlig distributionsanläggning samt, om synnerliga skäl föreligga, jämväl för den inre elektrifieringen av dylik fastighet. Lån må beviljas endast om sökande icke äger annan möjlighet att anskaffa erforderliga medel för ändamålet. Kollegium kan eftergiva kra— vet på säkerhet. Lånet är amorteringsfritt under ett år från lyftningsdagen och skall därefter återbetalas med en åttondedel årligen. Räntan är f. n. fyra procent.

I Fletchers promemoria anfördes beträffande inrättandet av ifrågavarande lånefond bland annat följande.

Den huvudsakliga planen för lämnande av statsbidrag från anslaget till be- främjande av landsbygdens elektrifiering kan sägas gå ut på att de blivande konsumenterna genom sina inträdesavgifter till föreningarna täcka anläggnings- kostnaderna upp till det »normala» värdet, som angives av subventionsgränsen, medan det statliga bidraget täcker den del av kostnaderna, som överskjuter detta >>normala» värde. Som det emellertid befunnits rationellt att sätta subventions- gränsen relativt högt, komma svårigheter i vissa fall att uppträda för konsumen— terna att erlägga den >>normala» inträdesavgiften.

När de nu befintliga föreningarna bildades, skedde inbetalningen av inträdes- avgifterna i stor omfattning genom avlämnande av reverser, som sedan belånades av föreningarna. För närvarande föreligger åtminstone på vissa håll en tendens hos föreningarna att kräva kontant erläggande av inträdesavgifterna.

Vid finansieringen av föreningsbildandet respektive utvidgningen av en be-

fintlig förening skulle därför en statlig lånefond för ändamålet, förslagsvis be- nämnd statens elektrifieringslånefond, vara av stor nytta.

Det bör framhållas, att åtgärder äro erforderliga för förhindrande av dubbel- belåning, så att icke en förening och dess medlemmar var för sig upptaga lån för utbyggande av ett och samma ortsnät.

Huru elektrifieringslånefonden utnyttjats framgår av följande uppställ- ning.

Beviljade lån Avslagna och avförda Budgetår Antal Belopp ansökningar 1941/1942 25 43 250 13 1942/1943 22 19 020 9 1943/1944 5 11 690 — 1944/1945 2 5 450 1 1945/1946 _ —— 2 1946/1947 —— — 1947/1948 — —— 2 1948/1949 — 1 1949/1950 1 2 358 1950/1951 — —— — 1951/1952 _ _ — 1952/1953

De för ytterligare utlåning disponibla medlen uppgingo den 1 juli 1953 till 311 000 kronor. Det kan konstateras att elektrifieringslånefonden ej utnytt- jats i förutsedd omfattning.

Av ovan lämnade redogörelse framgår att statligt stöd åt landsbygds- elektrifieringen sker under olika former. I kap. 11 kommer elkraftutred- ningen att ingå på frågan om dessa statliga lån och bidrag visat sig ända- målsenliga och tillräckliga eller om man framdeles bör införa andra stöd- former.

Installatörsbehörighet

Under den starkt forcerade elektrifiering, som första världskriget framkal- lade, tillkommo särskilt på landsbygden bristfälliga installationer i betydan- de omfattning, beroende bl. a. därpå, att personer utan erfarenhet på områ- det åtogo sig installationsarbete. Med anledning härav infördes statliga kom- petensvillkor för installatörer genom förordningen den 5 december 1919 an- gående behörighet att utföra elektriska anläggningar för belysning eller arbetsöverföring m. m. Förordningen har sedermera ersatts av kungörelsen den 2 juni 1939 angående behörighet att vid elektriska starkströmsanlägg- ningar utföra installationsarbete.

Med installationsarbete avses i 1939 års kungörelse utförande, förändring eller reparation inomhus eller utomhus av elektriska starkströmsanlägg—

mur—...... ....n..-

.fi—am..

ningar för belysning, drivkraft eller uppvärmning, med undantag av anlägg- ningar å fartyg och fordon samt, i den omfattning kommerskollegium före- skriver, inom laboratorier och därmed jämförliga inrättningar. Huvudregel är att installationsarbete får utföras endast av den, som av kommerskolle- gium förklarats såsom behörig installatör, eller av yrkesman, vilken är an- ställd hos behörig installatör, under förutsättning att yrkesmannen utför arbetet under kontroll av den behörige installatören. Från denna regel gälla två undantag. Det ena avser underhåll av anordningar vid lågspännings— anläggning och utbyte av dessa mot andra likartade m. m. dylikt. Sådant arbete får efter tillstånd av vederbörande strömleverantör självständigt verkställas av yrkesman, som fyllt 40 år och kan styrka, att han under minst 8 år på väl vitsordat sätt utfört installationsarbete under ledning av behörig installatör. Det andra undantaget gäller utbyte av lamphållare, strömställare, uttagsorgan och andra likartade apparater ävensom proppar och smältstycken till säkringar samt jämförlig förbrukningsmateriel, vilket

_ får utföras av envar, som äger nödig kännedom om sådant arbete.

Allt efter kompetens indelas installatörerna i tre klasser A, B och C. För innebörden av denna indelning och för hur den i praktiken har tilläm- pats redogöres närmare i samband med behandlingen av tillgången till tek- nisk sakkunskap hos landsbygdsföretagen (s. 219).

När skäl därtill föreligga kan kommerskollegium förklara behörigheten förverkad för viss tid eller för alltid eller inskränka meddelad behörighet.

Genom 1939 års installatörskungörelse infördes vissa regler beträffande det av strömleverantörer i stor utsträckning tillämpade entreprenörsyste— met. Detta system innebar, att vissa installatörer eller installationsföretag av vederbörande strömleverantör auktoriserades såsom entreprenörer för utförande av de elektriska installationerna inom leverantörens distribu— tionsområde, varjämte leverantören såsom villkor för anslutning av abon- nentanläggningar till distributionsnätet uppställde, att av leverantören auk- toriserad entreprenör anlitats för installationsarbetet. Om en leverantör vägrade att bevilja en installatör entreprenörsrätt förhindrades denne i sin yrkesutövning, trots att han erhållit statligt behörighetsbevis avseende visst större eller mindre område. Bl. a. för att undanröja dessa verkningar av

' entreprenörsystemet intogs i 1939 års installatörskungörelse bestämmelser

om att en var som fyller de krav, vilka angivas i kungörelsen eller i bestäm— melser som meddelats med stöd av denna, fritt må utöva installatörsyrket. Entreprenörsrätt må enligt kungörelsen icke vägras installatör som fö- ' reter bevis om att firma inregistrerats för honom själv eller installations-

företag där han är anställd, styrker att han själv eller företag vid vilket han är anställd äger tillräcklig ekonomisk vederhäftighet för drivande av in— stallationsrörelse samt förbinder sig att i sin verksamhet ställa s'rg till efterrättelse den instruktion för entreprenörer, som strömleverantören må utfärda.

Instruktion för entreprenörer skall underställas kommerskollegium för fastställelse. Om strömleverantören vägrar att meddela entreprenörsrätt åt installatör skall beslutet härom av leverantören delgivas kommerskollegium. Kollegium kan emellertid icke upphäva beslutet eller utdöma skadestånd utan härom får installatören föra talan antingen kommunala besvärsvägen beträffande kommunala elverk eller vid allmän domstol.

Elkraftutredningen återkommer till installatörsfrågan i kap. 11.

Elskatt

Genom förordning den 1 juni 1951 infördes bestämmelser om skatt å elektrisk kraft. Elskatt skulle enligt förordningen utgå för elektrisk kraft, som framställdes inom riket av producent, vilken antingen förfogade öven en installerad generatoreffekt av sammanlagt minst 100 kilowatt eller dist- ribuerade kraften över distributionsnät med anslutning till minst tio för- brukare eller erhöll tillskottskraft från annan producent, ävensom för elekt- risk kraft, som överfördes hit till riket från annat land. I vissa fall skulle elskatt icke utgå. Undantagen var bl. a. kraft, som framställdes och förbru— kades inom Gotlands län, och kraft som nyttiggjordes inom rörelse för pro— duktion och distribution av elektrisk kraft. Elskatten utgick för lågspänd kraft, som uppmättes, med 1 öre för kilowattimme och för annan lågspänd kraft ävensom för högspänd kraft med tio procent av kraftens beskattnings- värde, dvs. summan av de avgifter som betalades för den elektriska kraften. Skattskyldigheten åvilade förbrukaren, som i samband med erläggande av kraftavgifterna i övrigt betalade elskatten till distributören. Denne i sin tur hade att såsom skatteredovisande distributör debitera elskatten och inleve- rera den till statsverket.

I maj 1952 ändrades förordningen och fick sin nuvarande lydelse. Elskatt skall nu endast erläggas av den som driver industriell rörelse med en elekt- risk förbrukning av mer än 40 000 kWh per år. Skatten utgår med tio pro- cent av kraftens beskattningsvärde.

Skattemyndighet är kontrollstyrelsen. Kungl. Maj:t eller, efter Kungl- Maj:ts bemyndigande, kontrollstyrelsen äger medgiva de avvikelser från reglerna angående skattens bestämmande, som med hänsyn till särskilda omständigheter må finnas påkallade. Vid sidan av kontrollstyrelsen finnes en rådgivande nämnd, elskattenämnden, med uppgift att till styrelsen av- giva yttranden och förslag i ärenden rörande elskatt.

Elkraftutredningens synpunkter på spörsmålet om elkraften som skatte— objekt upptagas till behandling i kap. 15.

N...;- ...—d_n...»

Kap. 6. Kraftkällornas tillvaratagande

Vattenkrafttillgång och utbyggd vattenkraft

Frågan om tillvaratagandet av vår vattenkraft har varit föremål för ut— redningar, senast genom 1947 års kommitté för åtgärder mot spekulation i vattenkraft. Kommittén har i sitt betänkande (SOU 1947: 81) bl. a. gjort följande uppskattningar. Av den totalt utbyggnadsvärda vattenkrafttill- gången —— enligt uppskattning 50 000 milj. kWh/år —- beräknades vid 1950- talets mitt i runt tal 30 000 milj. kWh/år återstå outbyggda. All högvärdig kraft dvs. sådan kraft, som vid oförändrat penningvärde medför en spe- cifik utbyggnadskostnad icke mera väsentligt överstigande utbyggnadskost- naden vid de redan utbyggda fallen beräknades kunna vara utbyggd om- kring år 1980; all lågvärdig, dvs. övrig utbyggnadsvärd kraft bortemot år 2000.

Elkraftutredningen finner icke anledning att närmare ingå på dessa upp- ? skattningar. Det må emellertid konstateras att redan den vid årsskiftet 1952 -—1953 utbyggda vattenkraften motsvarade en normalproduktion av 20 300 milj. kWh/år. Utbyggnaden av vattenkraft, anpassad efter belastningstill- växten, har under en lång följd av år motsvarat i genomsnitt 6,5 % årlig ökning av produktionskapaciteten. Med en fortsatt utbyggnad i denna takt skulle den enligt ovan uppskattade, utbyggnadsvärda vattenkrafttillgången vara utbyggd redan före år 1970. Utbyggnadstakten torde emellertid komma att avtaga efterhand som de värdefullare kraftresurserna tagits i anspråk och kostnaderna för den nytillkommande vattenkraften sålunda börjat ställa sig allt högre jämförd med värmekraft eller kraft framställd på annat sätt. Tillväxten av konsumtionen på elvärmesidan kommer härvid i första hand att dämpas. Det är också högst sannolikt att gränsen för den utbyggnads- värda vattenkraften kommer att ytterligare pressas uppåt såväl på grund av förbättrade utbyggnadsmetoder och regleringsmöjligheter som stegrad prisnivå för elkraft och därigenom förhöjt relativt värde på vattenkraft. Redan nu anses gränsen för de utbyggnadsvärda tillgångarna kunna sättas till 70 000 milj. kW'h/'år1. Det bör i detta sammanhang påpekas att de totala vattenkrafttillgångarna i landet motsvara omkring 125 000 milj. kWh/år. Det är, som redan framhållits i kap. 4, ytterst vanskligt att göra några bestämda förutsägelser i ovannämnda avseenden för så förhållandevis lång tidsperiod, som det här är fråga om, enär åtskilliga faktorer, om vilka man för närvarande icke vet tillräckligt, sannolikt komma att inverka.

1 Enligt beräkningar våren 1954 äro de utbyggnadsvärda tillgångarna 80000 milj. kWh/år.

Kraftproduktionen i Sverige är under nu rådande förhållanden och un- der förutsättning av normal vattenföring till ungefär 95 % baserad på vat- tenkraft. År 1952 utgjorde den statliga andelen av den genom vattenkraft producerade elektriska energin 44 % medan kommunala och enskilda kraft— stationer tillsammans svarade för 56 %.

Vid årsskiftet 1950—1951 funnos i Sverige 999 vattenkraftstationer om vardera minst 74 kW (100 hkr) nominell turbineffekt. Deras sammanlagda effekt uppgick till 3,15 milj. kW. Siffrorna avse endast hydroelektrisk ef— fekt; turbiner avsedda för direktdrift äro sålunda icke medräknade. Vatten- kraftstationerna kunna efter äganderätten uppdelas enligt tabell 1.

Tabell 1. De hydroelektriska stationer-nas fördelning på ägare vid års- skiftet 1950—1951

Å Antal Antal Total effekt

gare företag stationer kw %

Staten ........................... 4 41 1 132 400 36 Kommuner ..................... 46 81 303 500 10

Kraftaktiebolag 119 214 830 600 26 Industrier ............ 286 533 882 300 27 Föreningar ............ 53 58 11 500 0,5 Enskilda personer ............ 66 72 12 100 0,5

Summa 574 999 3 152 400 100

Anledningen till den stora skillnaden i de ovan redovisade siffrorna över statens andel av energiproduktionen respektive av den installerade turbineffekten (44 respektive 36 %) är dels den att siffrorna avse olika är — under mellanliggande period har den statliga andelen av kraftproduktionen ökat mera än den icke- statliga _ dels den att utnyttjningstiden för de statliga stationerna är högre, genomsnittligt sett, än för de icke-statliga.

Staten är i tabell 1 representerad genom vattenfallsverket jämte ett mind- re antal dotterföretag i bolagsform samt domänverket, som äger ett fåtal kraftstationer av mycket liten effekt. Även den statliga andelen i de före- tag, där staten har delägarskap, är medräknad i effektkolumnerna. På sam— ma sätt inräknas bland kommunerna förutom rent kommunala elverk även helt kommunägda aktiebolag. Aktiebolag där kommuner äro delägare äro emellertid av särskilda skäl som regel i sin helhet medtagna bland kraft- aktiebolagen.

Gruppen kraftaktiebolag har en tämligen heterogen sammansättning, ehu- ru det för samtliga företag gäller att den producerade kraften huvudsakli— gen distribueras till och konsumeras av andra än det egna företaget.

Hit räknas

dels 8 företag med 34 stationer och en total effekt av 260 900 kW, vilka i övervägande eller betydelsefull grad genom äganderätten tillgodose en eller flera kommuners intressen;

X

_ xxx

Icke-stat liga

”0 xxx K ,,." - & xå

X / % ...— Xxxx/

Xxxx sz//

001 02 051 2 5 10 20 100 200400 Enhetsstorlek i 1 000 kW

/// , &va

Bild 12. Vattenkraftstationernas fördelning på sitorleksgrupper efter nominell turbineffekt vid slutet av år 1950

dels 17 företag med 59 stationer och en total effekt av 493 700 kW, vilka i övervägande grad ägas av industriföretag;

dels 94 företag med 121 stationer och en total effekt av 76 000 kW utgö— rande som regel förhållandevis små företag för ren distributionsverksamhet och med blandat delägarskap.

Gruppen industrier omfattar sådana företag, som producera kraft i egna anläggningar ursprungligen och huvudsakligen för eget, industriellt behov. I de flesta fall ha dessa företag därjämte åtagit sig en —— i många fall rätt omfattande —— distribution av elkraft inom sitt grannskap eller sin intresse- sfär. För samtliga inom denna grupp utgör emellertid kraftproduktionen en relativt underordnad del av verksamheten.

Till gruppen föreningar räknas ett antal distributionsföreningar med i

regel vardera endast en liten kraftstation, kring vilken distributionsnätet ursprungligen byggts upp. Den största stationen är på 950 kW och ingen av föreningarna har en total effekt av mer än 1 000 kXV.

Till den sista gruppen har hänförts personer, som äga och driva vatten- kraftstationer för att sälja kraft över eget eller annans distributionsnät.

I bild 12 visas schematiskt hur Sveriges statliga respektive icke-statliga vattenkraftstationer fördelades på storleksgrupper efter installerad nominell turbineffekt i kW vid slutet av år 1950.

Spekulation i vattenkraft

Av den outbyggda men utbyggnadsvärda vattenkraften ansåg ovannämn— da 1947 års kommitté att endast inemot 5 % befann sig på spekulativ hand. Risk för spekulation syntes endast föreligga ifråga om strömfall i Norrland och Kopparbergs län.

År 1945 infördes i vattenlagen viss expropriationsrätt för att hindra spe- kulation i vattenkraft. Rätten omfattade emellertid endast utbyggnads- mogna strömfall och för expropriationsrättens bestånd krävdes omedelbar utbyggnad av fallen. Dessa begränsningar av expropriationsrätten bortföllo genom de ändringar i vattenlagen, som enligt 1947 års kommittés förslag genomfördes år 1948. Såsom förutsättning för rätt att expropriera visst strömfall gäller nu enligt 1 kap. 14 % vattenlagen, att det från allmän syn- punkt för tillgodoseende av kraftförsörjningens planmässiga utveckling fin- nes nödigt, att strömfallet tages i anspråk. Expropriationsrätt kan meddelas förutom stat och kommun även enskilda. I kommittébetänkandet framhålles dock, att det vid den praktiska tillämpningen med all sannolikhet kommer att visa sig, att expropriationsmedgivande i regel kommer att lämnas, för- utom stat och kommun, endast sådant enskilt företag, vari stat eller kom- mun äger ett väsentligt intresse. Om det kan förutsättas, att den som råder över vattenkraften i strömfallet kommer att utan uppskov själv ändamåls- enligt utbygga detta, finner elkraftutredningen det som regel icke erfor- derligt att expropriation medgives. _

Jämsides med och som komplettering av vattenlagens expropriations— bestämmelser infördes genom lag den 20 december 1946 bestämmelser om kontroll å överlåtelse av vattenkraft m. m. Enligt dessa är i den mån Ko- nungen förordnar därom den som mot vederlag förvärvar rätt till vatten— kraft i strömfall över viss storlek skyldig att för kontroll av vederlagets skälighet omedelbart göra anmälan om förvärvet hos Konungen. Prövas vederlaget ej vara skäligt äger Konungen föreskriva den nedsättning, som kan anses påkallad.

Genom dessa bestämmelser i vattenlagen och i 1946 års kontrollag synes behovet av åtgärder mot spekulation i vattenkraft vara tillgodosett.

Vattenkraftens utnyttjande

Ovannämnda bestämmelser i vattenlagen syfta även till att möjliggöra ett planmässigt utnyttjande av vattenkrafttillgångarna. De förtjäna därför beaktande även vid elkraftutredningens bedömande av frågorna om vatten- kraftutbyggnadernas omfattning, utbyggnadstakten och ordningen för ut- byggnad av olika objekt. Vid följande översikt av dessa och därmed sain- manhängande frågor bortses tills vidare från värmekraftalstringen och dess inverkan på hithörande problem.

I ett senare kapitel, kap. 14, behandlas ytterligare en del med vattenkraf- tens utnyttjande sammanhängande problem av särskild betydelse för Norr— land.

Vattenregleringar

Den stora skillnaden i vattenföringen under olika är och årstider samt växlingarna i kraftbehovet under året, veckan och dygnet gör det angeläget att genom vattenregleringar söka anpassa vattentillförseln efter kraftbehovet och därmed så långt det är möjligt skapa en ekonomiskt fördelaktig ut— nyttjning av vattenkraftverken. Förutsättningarna för regleringar i måttlig omfattning äro gynnsamma i de svenska vattendragen tack vare riklig före- ' komst av sjöar. Värdefulla vattenmagasin finnas i flera av de större vatten- dragen, främst Göta älv, Dalälven, Indalsälven, Ångermanälven, Skellefte älv och Lule älv. De hittills redan utförda regleringsmagasinen i landet beräknas kunna rymma omkring 30 000 milj. m3 vatten, motsvarande ett energiinnehåll av omkring 6 000 milj. kWh. Genom tillvaratagandet av ännu icke utnyttjade regleringsmöjligheter kan enligt gjorda överslagsberäk- ningar skapas ytterligare vattenmagasin med en rymd motsvarande minst 10 000 milj. kWh. Man kan dock ej ens tillnärmelsevis ernå en för landet i dess helhet fullständig anpassning av vattentillförseln. Variationerna i vattenföring mellan vattenrika och vattenfattiga år äro alltför betydande och kräva för utjämning alltför stora magasinsutrymmen. Vattenregleringar för kraftändamål medföra ofta konflikter med jordbruks-. fiske-, flott- nings- och farledsintressen, stundom även med sanitära och estetiska in- tressen. Dessa i vattenlagen behandlade spörsmål har elkraftutredningen icke funnit anledning upptaga till närmare behandling. Rent allmänt kan emellertid framhållas, att god tillgång på vattenmagasin medger ett bättre utnyttjande av landets vattenkrafttillgångar. Elkraftutredningen finner det därför angeläget att föreliggande vattenregleringsmöjligheter utnyttjas i den utsträckning som ur ekonomisk, teknisk och allmän synpunkt kan anses skälig.

Utbyggnadsmarginal och utbyggnadsordning

Vid olika tidpunkter har anmärkts på att den för tillfället utbyggda vat- tenkraften varit otillräcklig, och att därigenom en eftersläpning uppkom-

rnit i kraftproduktionen i förhållande till den ökade belastningen. De om- fattande utbyggnadsarhetena taga lång tid i anspråk och fordra därför plan- läggning flcra år i förväg. Vid en kraftig och långvarig ökning av efterfrå— gan, som icke i tid kunnat förutses, kan det lätt inträffa, att den planerade utbyggnadstakten icke är tillräckligt snabb. Det har därför ifrågasatts, att en bredare säkerhetsmarginal än den hittillsvarande borde tillämpas för utbyggnadsprogrammet, även om de ekonomiska riskerna för de utbyggan- de företagen därigenom ökas. Rent allmänt sett skulle detta innebära, att utbyggnadstakten så långt det är möjligt rättas efter de behov, som maxi- malt kunna påräknas under perioden, och att nedskärning av programmet sker först om den konstaterade efterfrågan stadigvarande understiger den uppgjorda maximiprognosen.

Innan en bedömning av denna fråga göres må tilläggas, att det för när— varande aktuella utbyggnadsprogrammet för såväl statliga, kommunala som enskilda produktionsanläggningar avser anläggningar, som beräknas komma i drift under perioden fram till slutet av år 1959, även om programmet be- träffande de sista två åren av perioden anses mera preliminärt. Genom dessa under byggnad varande eller planerade anläggningar utökas vår totala produktionskapacitet av vattenkraft, jämförd med värdet vid årsskiftet 1952—53 med över 60 % Då det är av värde att i detta sammanhang få en överblick över utbyggnadsprogrammet lämnas som bilaga !; en inom CDL uppgjord redogörelse för detsamma. Dessutom erinras om de i kap. 4 redo- visade prognoserna för belastningstillväxten. Bilderna 4 och 11 (s. 84 och 121) ge en uppfattning om hur marginalen mellan å ena sidan den utbyggda vattenkraften under förutsättning av normal vattenföring och å andra sidan kraftförbrukningen förhållit sig sedan år 1928 samt vilken marginal man räknar med för den närmaste framtiden.

Tillskottet av nyutbyggd vattenkraft under perioden 1945—1948 blev alltför begränsat, huvudsakligen beroende på det uppskov i utbyggnads- initiativet, som inföll under andra världskrigets senare år, verkstadsstrej- ken år 1945 samt bristen på arbetskraft och material. De kraftverksbyggen, som därefter genomfördes, inneburo emellertid en kraftig ansats till åter- hämtning, även om en oundviklig eftersläpning i förhållande till belast- ningsutvecklingen fanns kvar i ett flertal år. För närvarande råder balans mellan tillgång och efterfrågan på kraft under förutsättning av normal vattenföring. De pågående och planerade utbyggnaderna äro av den omfatt— ningen att balans efter programmets genomförande sannolikt kommer att råda även under 5. k. torrår, d. v. s. är med sådan vattenbrist, som man enligt erfarenhet får räkna som mera regelbundet återkommande. För 5. k. exceptionellt torrår kan balans dock icke uppnås härigenom.

Det är ytterst vanskligt att avgöra, hur stor marginal av utbyggd vatten— kraft, som i varje situation bör hållas för landet som helhet. Ett för långt gående utbyggnadsprogram blir ekonomiskt betungande. Detta spörsmål

. ..... :Hå—A—w...»

hänger nära samman med frågan om avvägningen mellan vatten- och vår— mekraftproduktion, vilken längre fram skall närmare beröras.

Det bör vara en skyldighet för varje kraftproducent, som har tillgång till utbyggnadsmogna vattenfall, att hålla en tillräcklig reserv av utbyggd kraft för tillgodoseende av behovet inom det egna försörjningsområdet ej blott under normala tider utan även under mera regelbundna vattenbristperio— der.1 En större reserv av utbyggd kraft för att tillgodose behovet även vid exceptionella torrperioder eller vid bristperioder, föranledda av sådana för- ! hållanden som maskin]everansförseningar och dylikt, är i den mån kraftföre— . tagen själva ej äro beredda att ansvara för den snarast ett intresse av ren

samhällsnatur, som det bör åligga det allmänna att tillgodose. Finnes ingen , sådan reserv tvingas man att vid sådana tillfällen tillgripa en allmän kraft— 4 ransonering. Enligt gällande instruktion för vattenfallsstyrelsen tillkommer det styrelsen bl. a. att föreslå samt efter Kungl. Maj:ts därtill lämnade be- myndigande vidtaga åtgärder, ägnade att främja tillgodogörandet av vatten- kraften inom landet, ävensom att föreslå och i mån av befogenhet vidtaga åtgärder för åstadkommande av en rationell tillförsel av elektrisk kraft till sådana delar av landet, där statens ingripande i detta avseende prövas lämp- ligt. Oavsett vilken betydelse man vill tillägga denna bestämmelse i instruk— tionen kan statens medverkan under vissa förhållanden bli påkallad även då det gäller utbyggnad av vattenfall i enskild ägo. Det kan nämligen tänkas att ett enskilt företag bedömer konjunkturerna såsom olämpliga för utbygg- nad och icke vill påtaga sig de ekonomiska riskerna härför, även om utbygg- naden ur allmän synpunkt borde ske. I en sådan situation har staten möj- lighet att med stöd av 1 kap. 14 5 vattenlagen expropriera vattenfallet.

Enligt elkraftutredningens uppfattning innebär risken för expropriation en ej obetydlig garanti för att utbyggnadstakten blir tillräckligt snabb och för att en lämplig beredskapsmarginal av utbyggd vattenkraft finnes till- gänglig hos de enskilda kraftföretagen. Det finnes icke tillräckliga skäl för att sträva efter en större relativ marginal i utbyggd vattenkraft än den, som enligt principen för det nu aktuella utbyggnadsprogrammet är avsedd att skapas och som tar hänsyn till de mera regelbundet återkommande vatten- bristperioderna samt till möjligheterna att under perioder med god vatten— tillgång finna avsättning för överskottskraft.

Ur nationalekonomisk synvinkel är det ett givet intresse, att de högvär— digaste vattenfallen i första hand utbyggas och icke ligga outnyttjade me- dan lågvärdig vattenkraft i stället tillvaratages. Allt efter som tillgången på högvärdig kraft blir knappare och samtidigt är fördelad på flera olika ägare i proportioner, som icke motsvara behoven inom deras respektive av- sättningsområden, kan anledning uppkomma att särskilt tillse att vatten-

1 En motsvarande skyldighet för de kraftleverantörer, som ej ha egna råkraftkällor utan inköpa kraften, borde vara att se till att råkraftabonnemangen innehålla en mar- ginal, som är tillräcklig för det maximalt motsedda behovet.

fallen utbyggas i den ur landets synpunkt lämpligaste ordningen. Expro- priationsrätten enligt 1 kap. 14 % vattenlagen har givit staten möjlighet att därvid åstadkomma att de högvärdigaste fallen i första hand utbyggas.

Det har stundom förekommit att vattenfall med alltför ringa produk— tionsförmåga utbyggts till oproportionerligt höga kostnader. Denna utveck- ling tillhör dock en förgången tid. Några särskilda åtgärder för att förhindra tillkomsten av nya utbyggnader i alltför små vattendrag torde nu icke vara erforderliga. Av de bestående små kraftstationerna kunna en del med eko- nomisk fördel drivas för komplettering av den kraft, som ägaren inköper från annat håll. Många småstationer ha en betydelsefull uppgift ur produk- tionssynpunkt därigenom att de, om än mången gång på ett bristfälligt sätt, tillhandahålla elkraft inom avlägsna bygder, som ännu ej anslutits eller kunna beräknas bli anslutna till riksnätet. De olägenheter som ur ekono- misk synpunkt och ur konsumentsynpunkt kunna vara förbundna med fri- stående små kraftverk behandlas vidare längre fram i samband med gransk- ningen av distributionsföretagens kraftanskaffning.

Någon fast organisation för samordning av planer för utbyggnad av nya kraftanläggningar finnes icke. Varje företag, som disponerar över outbyggda krafttillgångar, söker genom prognoser för sin kraftavsättning bestämma lämplig tidpunkt för nyutbyggnad. Samråd mellan företagen sker dock i viss utsträckning i varje fall områdesvis, bland annat i samband med under- handlingar om inbördes kraftförsäljningar på kort eller lång sikt. När det gäller utbyggnader inom ett visst flodsystem tjäna regleringsföreningar som kontaktorgan vid den gemensamma planeringen av utbyggnadsprogrammet. I praktiken är det så att man väl känner till varandras utbyggnadsplaner, icke minst genom samverkan inom Centrala driftledningen (CDL) och eljest genom personliga kontakter.

Även om någon organisation av enhetlig och bestående karaktär för ut— byggnadsplanernas samordnande sålunda icke finnes, äro dock för närva- rande vissa förhållanden på ifrågavarande område underkastade regle- ringar. För att. sätta igång ett utbyggnadsföretag erfordras byggnadstill— stånd av arbetsmarknadsstyrelsen eller för större företag av Kungl. Maj:t. Före frågans avgörande brukar yttrande inhämtas från CDL. Genom den i kap. 5 (s. 128) omnämnda kungörelsen den 24 april 1953 skall ett kraftföre— tag underrätta länsstyrelsen i berörda län angående planläggning av bl. a. utbyggnaden av kraftanläggningar och skola kommunala organ, myndig- heter och sammanslutningar, vilka ha till uppgift att bevaka av utbyggna— den berörda allmänna intressen, beredas tillfälle att framlägga önskemål redan vid planläggningen. Kungörelsen förutsätter att samråd äger rum med samtliga de till det ifrågavarande vattendraget knutna viktigare intres- sena. Frågan om vilka av flera samtidigt föreliggande utbyggnadsprojekt som böra äga företräde har under en period under senare tid, känneteck— nad av svårigheter att tillgodose behoven av elektrisk materiel, varit under :

kontroll ur allmän synpunkt även inom den s. k. generatorberedningen (se s. 182). Denna, som består av representanter för CDL, vattenfallsstyrel- sen, elverksföreningen, vattenkraftföreningen, industriförbundet, statens järnvägar och ASEA, föreslog efter behovsprövning lämplig ordning för leverans av stora generatorer från ASEA.

Utöver vad som redan tidigare nämnts ha betydelse för vattenkraftens ut- byggande må här tilläggas att staten genom den ordning som nu tillämpas angående byggande och drift av överföringsledningar med 200 kV eller högre spänning, för vilket skall redogöras senare, (kap. 7), indirekt erhållit i medel att förhindra utbyggnad av mera avsevärd vattenkraft, som ur allmän

synpunkt icke är utbyggnadsmogen. Möjlighet att minska risken för sådan utbyggnad föreligger även genom 1902 års lag om koncessionstvång för elektriska ledningar.

Förutsättningarna för det allmänna att påverka den ordning, i vilken vattenfallen utbyggas, ha sålunda under senare är avsevärt ökats, ehuru man dock ej kan påstå att någon ur allmän synpunkt olämplig utbyggnad av betydelse hittills har förekommit.

Man kan fråga, huruvida åtgärder böra vidtagas för ett forcerat utnytt- jande av våra återstående vattenkrafttillgångar, så att snarast en så stor del som möjligt av vårt energibehov tillgodoses med inhemska energikällor — exempelvis åtgärder för att stimulera till användning av elektrisk rumsupp— värmning i större skala. Å andra sidan kan man, med tanke på begränsning- en i de inhemska energitillgångarna, också ställa frågan huruvida utveck- lingen mot dyrare elkraft bör fördröjas därigenom, att man redan nu söker fastställa vilka konsumtionsändamål, som i första hand böra för framtiden tillgodoses vid utnyttjandet av våra återstående vattenkrafttillgångar. I bå- da fallen ifrågasättes ingrepp i den naturliga utvecklingen, syftande åt var sitt håll. Elkraftutredningen kan icke finna att det i nuvarande utvecklings- skede är motiverat med några ingrepp i energimarknadens frihet i syfte att dirigera elkraftens användning, bortsett från att särskilda åtgärder kunna påkallas under en exceptionell vattenbrist eller andra exceptionella förhål— landen. Genom taxor så avvägda, att täckning av självkostnaden för kraf- tens produktion och distribution erhålles, har man för normala förhållan- den tillräcklig garanti för en nationalekonomiskt lämplig utveckling. Bort- sett från de inflytanden, som politiska och militära förhållanden kunna ha på denna fråga må fastställas, att en forcerad utbyggnad av vattenkraften, med åsidosättande av vad som är nationalekonomiskt berättigat, ej är mo- tiverad liksom ej heller någon inskränkning i utbyggnadsplanerna med hän- , syn till begränsningen i vattenkrafttillgångarna.

Överskottskraft överskottskraft användes främst inom industrin. En stor del därav går till elektriska ångpannor i industrier, som normalt framställa den för fabri-

kationen behövliga ångan i bränsleeldade pannor. Överskottskraft avsättes dessutom i viss utsträckning till sådana företag, vilka äro i behov av billig kraft och som utan större olägenhet kunna nedlägga större eller mindre del av driften en kortare period vid inträffad vattenbrist. Erfarenheten har emellertid visat, att en följd av år med normal eller riklig vattentillgång kan förleda sådana industrier att inrätta sig för en mera stadigvarande verksamhet med användning av överskottskraft, dvs. till viss spekulation i överskottskraftens låga pris. När vattenbrist sedan inträffar kan den kontraktsenliga avkopplingsrätten ibland icke tillgripas av sociala skäl eller med hänsyn till landets försörjning. Leveransen av överskottskraft kan då nödvändiggöra ett mot kraftpriset ej svarande tillskott av värmekraft eller medverka till uppkomst eller skärpning av en allmän elkraftransonering. I båda fallen tillskansar sig köparen av överskottskraften förmåner på öv— riga kraftförbrukares bekostnad.

Det har ifrågasatts att överskottskraft i större utsträckning än som nu sker skulle exporteras till Danmark, där elkraftförsörjningen praktiskt taget helt vilar på värmekraft. Samtidigt som ett tillskott av svensk över— skottskraft skulle medföra minskning av Danmarks bränsleimport, skulle exporten för Sveriges del innebära minskade svårigheter att vid eventuell överutbyggnad avsätta överskottskraften utan risk för missriktad elkon— sumtion. En väsentlig ökning av möjligheterna till dylikt, för båda parter gynnsamt, kraftutbyte har under senaste tid åstadkommits genom en för- stärkning av kabelförbindelsen under Öresund. Värdet av denna förbindelse ökar ytterligare genom den pågående utbyggnaden av 380 kV stamlinjenätet till sydligaste Sverige.

Elkraftutredningen anser att det ligger i det allmännas intresse, att över- skottskraften tillvaratages men tillika förbehålles därför speciellt lämpad. under alla förhållanden lätt avställbar förbrukning, så att i en bristsituation ogynnsamma återverkningar på förbrukningen för högvärdiga behov und- vikas. Någon anledning till särskilda åtgärder från statens sida synes dock icke föreligga nu.

Utbyggnadsförsening genom domstolsbehandlingen

En omständighet, som ofta i påtaglig grad verkar hämmande på utbygg- nadstakten, är den långa tid som åtgår för domstolsbehandlingen av frågor om tillstånd till nya kraftverks- och regleringsföretag. Denna fråga har va- rit föremål för särskild utredning och genom lag den 9 maj 1952 har i vat- tenlagen införts nya bestämmelser om deldom, om rätt att medgiva proviso— riska åtgärder och om förordnande om omedelbar verkställighet av vatten- domstols beslut. Härigenom möjliggöres ett snabbare och smidigare förfa— rande i stora kraftverks- och regleringsmål. Med hänsyn till angelägenheten av att i vissa situationer skyndsamt kunna genomföra föreliggande utbygg- nadsprogram vill elkraftutredningen erinra om vikten av att man i största

möjliga mån undanröjer de hinder härför, som fortfarande kunna uppstå genom ett alltför omständligt och tidsödande domstolsförfarande eller otill— räcklig domstolsorganisation. Dessa frågor äro emellertid av den natur att elkraftutredningen icke ansett sig böra närmare ingå på dem.

Värmekraftens betydelse

I det föregående har huvudsakligen behandlats frågor som direkt beröra utnyttjandet av våra vattenkraftkällor. Vid bedömandet av elkraftproduk— tionens problem måste emellertid också hänsyn tagas till värmekraftalst— ringen.

Sveriges tillgång på vattenkraft har gjort det naturligt, att produktionen av elkraft så gott som helt är baserad på vattenkraft. Medan världsproduk- tionen av elkraft till endast omkring 35 % torde ske medelst vattenkraft, täcker Sverige normalt, som tidigare omnämnts, omkring 95 % av sitt kraft- behov på detta sätt. Produktionen av elkraft medelst värmekraftmaskiner utgjorde under åren före andra världskriget i medeltal omkring 10 % av den totala kraftproduktionen, men inskränktes under kriget till 2 ä 3 %.

Det har gjorts gällande, att värmekraftens andel i den totala kraftproduk— tionen skulle för vårt lands vidkommande vara för hög och att det ej kunde anses överensstämma med god nationalekonomi att låta de rikliga vatten— flödena i våra älvar rinna bort till ingen nytta, samtidigt som bränsle impor— terades för produktion av elektrisk kraft. Utom att importen inverkade oför— månligt på vår handelsbalans kunde det i en avspärrningssituation medföra vådor att basera även en ringa del av vår elkraftförsörjning på utländskt bränsle. Kostnaden per framställd kWh bleve dessutom i regel högre vid användning av värmekraft.

En stor del av värmekraften utgöres normalt av mottryckskraft, dvs. el— kraft alstrad med ånga i mottrycksanläggningar vid exempelvis industrier, vilka för sin fabrikation behöva stora mängder lågtrycksånga. Principerna för mottrycksdriften ha behandlats i kap. 1. Det är uppenbart, att den el— kraft som framställes på detta sätt, det må vara inom industrier eller inom städer i kombination med fjärrvärmedistribution, under givna förutsätt— ningar nationalekonomiskt sett är att jämställa med vattenkraft, då bränsle- behovet (som dessutom ofta täckes genom avfallsbränsle) och framställ- ningskostnaden äro förhållandevis ringa. Det måste emellertid i detta sam- manhang betonas att de med mottrycksdriften vid fjärrvärmedistributionen förenade speciella frågorna rörande reservhållning av bränsle i händelse av importbegränsning samt maskinreserv för kraftproduktionen, måste få en tillfredsställande lösning innan denna form av elkraftproduktion i större skala kan bli av fullt värde. Dessa frågor torde komma att behandlas av bränsleutredningen, varför elkraftutredningen saknar anledning att närmare ingå på desamma.

500 i 1 000 kVA _ l Statens 200 Icke-statliga /// x / Mottrycks // // m m xs /”/ Fy Kondenslcrai't m.m. % 0 [ . . | / ( / 4 / ( / /

0 0,1 0,2 0,5 1 2 5 10 20 50 100 200 500 Enhetsstorlek i 1 000 kVA

Bild. 13. Värmekraftstalionernas fördelning på storleksgrupper efter nominell generatoreffekl vid slutet av år 1950

Medan elkraft från mottrycksanläggningar kan sägas vara en biprodukt vid produktion av annan nyttighet, så är produktionen av kondenskraft en- bart inriktad på elkraftbehovet. Kondenskraftverkens huvuduppgift är att tillhandahålla erforderlig fyllnadskraft under tider, när vatten- och mot- trycksanläggningarna icke förmå ensamma tillgodose behovet. De använ- das sålunda dels för toppkraftproduktion under högbelastningstimmar, dels för mera kontinuerlig kraftalstring under vattenbristtider och dels för in- matning aV reservkraft vid driftstörningar. Många av de större kraftföre- tagen, bland dem ett flertal stadselverk, ha kondenskraftverk.

Kostnaden för anläggandet av ett kondenskraftverk är normalt lägre än motsvarande kostnad för ett vattenkraftverk av samma storlek, om hänsyn tages till att överföringskostnaden oftast är lägre för kondenskraftverket genom att detta kan läggas närmare belastningscentrum än vattenkraftver- ket. Däremot äro till följd av bränslekostnaderna och de höga drift- och "underhållskostnaderna kondensverkens rörliga kostnader avsevärt högre än vattenkraftverkens. Kondenskraften är därför per kW räknat billigare, me— dan den per kWh räknat ställer sig dyrare än vattenkraften. Ett kraftbehov med lång utnyttjningstid täckes därför billigast med vattenkraft medan det ställer sig billigare med ångkraft om utnyttjningstiden är kort. Vid sam- arbete mellan ångkraft och vattenkraft kan ett ekonomiskt optimum ernås.

Vad här sagts om kondenskraft äger tillämpning även på dieselkraft, vil- ken särskilt tidigare användes av industrier och stadselverk för reserv- och toppkraftalstring.

Hur den statliga och de icke-statliga värmekraftstationerna fördela sig på

olika storleksgrupper, räknat i nominell generatoreffekt, samt på mottrycks- respektive kondens- och andra värmekraftverk framgår av bild 13, vilken grundar sig på förhållandena vid slutet av år 1950.

Det är uppenbart att vår kraftförsörjning såsom hittills i första hand bör baseras på vattenkraft. Som nämnts finnes emellertid icke möjlighet till sådan utjämning mellan olika år av vattenföringen i landets vattendrag, att man ens tillnärmelsevis kan anpassa denna efter behovet av mera hög- värdig kraft. Om landets elkraftförsörjning baserades enbart på vattenkraft, skulle den disponibla effekten i vattenkraftstationer få hållas så hög att en alltför stor del av den producerbara vattenkraften icke kunde tillgodogöras för högvärdiga ändamål. Den rena vattenkraften skulle därigenom bli dyrare än vattenkraft kompletterad med viss kondens- eller annan värmekraft. Det står därför klart, att sådan kombination är att föredraga.

Den bästa proportionen mellan vattenkraft och värmekraft ernås då lan- dets sammanlagda kostnad för högvärdig kraft efter avdrag av värdet på den lågvärdiga överskottskraften blir så låg som möjligt. En mindre för- skjutning åt ena eller andra hållet medför emellertid endast en obetydlig ökning av kraftkostnaderna. För att kunna möta den situation, som uppstår om tillförseln av utländskt bränsle ånyo skulle helt eller delvis spärras, kan det därför vara berättigat att något förskjuta proportionen till förmån för vattenkraften. Därvid bör man dock, trots önskemålet att minska vår import av fossilt bränsle, söka undvika att gå så långt, att därav följer märkbart ökat elkraftpris och därmed ökade kostnader bland annat för våra kraftför- brukande exportindustrier.

Ovanstående uttalanden hänföra sig i första hand till nuvarande förhål- landen och gälla, så länge våra vattenkraftresurser räcka till för en fortsatt utbyggnad i samma progressiva tempo, som hittills kunnat hållas. I och med att utbyggnadskostnaderna för den återstående outnyttjade vattenkraften börja stiga väsentligt i förhållande till kostnaderna för produktion av el- kraft på annat sätt ha förutsättningarna för vårt handlande ifråga om pro- duktionsanläggningarnas fortsatta utbyggnad ändrats väsentligt. Det är självklart att vi i det läget äro hänvisade till att tillgodose det ökande elkraft- behovet i allt högre grad på annat sätt än genom inhemsk vattenkraft.

Utöver här anförda skäl för begränsad värmekraftproduktion under nu- varande förhållanden må framhållas de fördelar av driftsteknisk natur, som vinnas genom att utrustningen i ett värmekraftverk i ändpunkten av en lång överföringslinje kan användas för faskompensering samt som reserv vid fel på exempelvis linjesystemet.

Det synes elkraftutredningen att de riktlinjer, som man hittills följt'i vårt land vid avvägning mellan vattenkraft och värmekraft, i stort sett ha lett till gott resultat. Åtskilligt talar dock för att den för närvarande utbyggda värmekrafteffekten snarare är för liten än för stor i förhållande till den utbyggda vattenkrafteffekten.

Kap. 7. Elkraftöverföringen till förbrukningsområdena

Stamlinjenätet

Stamlinjenätet, med vars hjälp stora kraftmängder kunna överföras mel- lan olika landsdelar och samkörning mellan alla produktionsanläggningar av betydelse kan ske, är väl utvecklat i vårt land. Det utgöres för närvarande av ett 200 kV nät med en total linjelängd av 4 000 km, i huvudsak omfat- tande sex linjer från mellersta Norrland —— Ljungans, Indalsälvens och Ångermanälvens flodområden —— till Mellansverige och Sydsverige, samt ett 380 kV nät med en total linjelängd av 1 500 km, vilket nu består av två linjer från övre och mellersta Norrland till Mellansverige. Nätet för 380 kV står under stark utveckling och beräknas år 1956 omfatta över 2 700 km. fördelade på tre nord-sydgående linjer inklusive tvärförbindelser, medan 200 kV nätet icke torde utbyggas vidare för storkraftöverföring från Norr— land till landets sydligare delar men väl för uppsamling respektive fördel— ning av kraften inom de olika landsdelarna. Av 200 kV nätet äges 60 % av staten och 40 % av Stockholms stad, Krångede aktiebolag och Sydsvenska kraftaktiebolaget. Fyra av de sex 200 kV stamlinjerna från Norrland till Mellansverige äro statliga. Nätet för 380 kV är helt statligt.

Utvecklingen har medfört att det numera får anses vara en förutsättning för en planmässig utformning och drift av stamlinjenätet, att detta ligger under gemensam ledning. En möjlighet att tillgodose detta hade varit en sammanslutning t. ex. i bolagsform mellan stamlinjenätets olika ägare. För— slag till bildande av ett dylikt stamlinjebolag framlades av vattenfallssty- relsen i skrivelse till Kungl. Maj:t den 27 april 1945. Förslaget gjordes emel- lertid icke till föremål för någon proposition. Chefen för kommunikations— departementet förklarade i 1946 års statsverksproposition, att samtliga nya kraftledningar för 200 kV eller högre spänning lämpligen borde ägas av staten, och riksdagen lämnade detta uttalande utan erinran. Elkraftutred- ningen anser sig med stöd härav kunna utgå från att ansvaret för ett ratio— nellt ordnande av storkraftöverföringen kommer att ligga i statens hand.

Användningen av de icke-statliga och de statliga 200 kV stamlinjerna är f. n. samordnad enligt en från och med år 1950 gällande överenskommelse mellan vattenfallsverket och övriga stamlinjeägare. Redan dessförinnan an- vändes de olika delarna av stamlinjenätet för 200 kV för samkörning. De besparingar genom minskade kraftförluster, som denna parallelldrift innebar, delades lika mellan vattenfallsverket å ena sidan och de övriga företagen å andra. Förhållandena reglerades genom de s. k. stamlinjeavta- len, vilka upphävts i samband med den nu gällande överenskommelsen.

Denna överenskommelse utgår ifrån att de icke-statliga stamlinjerna visser- ligen även i fortsättningen skola ägas och underhållas av nuvarande ägare, men att användningen och driftledningen skola ligga i vattenfallsverkets hand. Ägarna ha rätt till kraftöverföring på stamlinjenätet motsvarande de icke-statliga stamlinjernas överföringsförmåga utan särskild kostnad. Före— tag oavsett om de äro stamlinjeägare eller icke —— som önska kraftöver— föring (transitering) på stamlinjenätet, skola i så god tid anmäla sina önske— mål i fråga om effekt samt inmatnings- och uttagningspunkt, att vattenfalls- verket hinner färdigställa eventuellt erforderliga nyanläggningar. Företaget skall vidare lämna de upplysningar som erfordras för att verket skall kunna bedöma Skäligheten av framställningen om transitering. Bifalles framställ— ningen skall i varje särskilt fall avtal om överföringen upprättas mellan vattenfallsstyrelsen och företaget, varvid avgiften skall beräknas efter vat— tenfallsverkets självkostnader på det sättet, att årskostnaderna för led— ningarna fördelas i proportion till företagens abonnerade överföringar. De totala kraftförlusterna skola fördelas nled ledning av de vid varje tnlfäne i verkligheten överförda kraftmängderna så att kraftföretagen så rättvist som möjligt få bära sin andel. Bestämmelserna nödvändiggöra ett relativt invecklat avräkningsförfarande.

Frågor berörande det samkörande stamlinjenätet behandlas av en stam- linjenämnd. För att belysa dennas sammansättning och uppgifter må föl- jande citeras ur vattenfallsstyrelsens Allmänna bestämmelser för transi- tering av elektrisk kraft på det samkörande stamlinjenätet:

1. — _— _—

Stamlinjenämnden skall bestå av sju ordinarie ledamöter. Av dessa utses tre av vattenfallsstyrelsen och en av vart och ett av de tre företag, som förutom vatten- fallsstyrelsen taga i anspråk de tre med hänsyn till de föreliggande överförings- abonnemangen största anparterna av det hopmaskade nätet. Vid förfall för någon av de sex sålunda utsedda ordinarie ledamöterna har vederbörande företag rätt att utse annan person att tillfälligtvis representera företaget i nämnden. Den sjunde ordinarie ledamoten skall vara en i tekniska och ekonomiska värv erfaren person, som utses av Kungl. Maj:t, sedan de i stamlinjenämnden representerade företagen beretts tillfälle att uttala sig. Denne ledamot skall såsom opartisk ord- förande leda stamlinjenämndens förhandlingar. Vid förfall för honom skall såsom ordförande tjänstgöra en enligt enahanda bestämmelser av Kungl. Maj:t utsedd person.

2. Stamlinjenämndens uppgifter skola vara:

a) att följa den tekniska och ekonomiska utvecklingen av det samkörande stamlinjenätet, driften av detsamma, skydds- och säkerhetsåtgärder, installering och utnyttjning av anordningar för högfrekvensöverföring, handhavandet av på- gående transiteringar med tillhörande avräkning etc.,

11) att på eget initiativ eller på begäran av Kungl. Maj:t eller något företag avgiva förslag och yttranden i de under a) angivna frågorna,

c) att med i punkt 4 angivna undantag utgöra skiljenämnd i tvistefrågor rörande tillämpning och tolkning av

dels transiteringskontrakt, dels med överföringen på det samkörande stamlinjenätet sammanhängande sär-

skilda avtal och överenskommelser,

dels dessa allmänna bestämmelser. Om icke enhällighet föreligger inom stamlinjenämnden vid avgivande av för- slag, yttrande eller skiljedom, skola de inom nämnden anmälda skiljaktiga me- ningarna redovisas.

3. Skiljedom av stamlinjenämnden enligt 0) i punkt 2 kan av därav berört företag, som icke åtnöjer sig med avgörandet, underställas domstols prövning, såvida detta sker inom 30 dagar efter det företaget erhållit del av stamlinjenämn- dens utslag. Har intet av skiljedomen berört företag instämt saken till domstol inom den angivna tiden, är stamlinjen-ämndens avgörande bindande för de be- rörda företagen.

4. Från behandlingen av stamlinjenämnden som skiljenämnd enligt e) i punkt 2 äro undantagna

a) alla frågor, som icke beröra redan uppgjorda transiteringskontraki eller redan uppgjorda, med överföringen på det samkörande stamlinjenätet samman- hängande särskilda avtal och överenskommelser, såsom medgivande om ny transi- tering enligt — — — eller ökning av pågående sådan enligt — —— — liksom härför uppställda villkor, utformning och utförande av anläggningar hörande till det samkörande stamlinjenätet eller betingade av kraftöverföringen på nämnda nät;

b) alla fastställanden av storheter m. m., som enligt dessa allmänna bestäm- melser influera på den ekonomiska ersättningen till vattenfallsstyrelsen för de av transitering för andra företag betingade prestationerna samt ändring enligt —— _ av väsentliga villkor för kontrakterad transitering.

Rörande vattenfallsstyrelsens avgöranden i de under a) och b) angivna frågorna kunna besvär anföras hos Kungl. Maj:t, såvida detta sker inom 30 dagar efter det vederbörande erhållit del av beslutet.

Ovan har sålunda konstaterats, att det rationella ordnandet av storkraft- överföringen i praktiken nu åvilar staten därigenom att vattenfallsverket ansvarar för driftledningen och den vidare utbyggnaden av stamlinjenätet. Ett överförande i statens ägo av de nuvarande stamlinjer, som äges av kommunala och enskilda kraftföretag, synes åtminstone för närvarande ej erforderligt. Om staten skulle bli ägare till samtliga stamlinjer skulle vis— serligen en del praktiska olägenheter, särskilt ifråga om avräkningsförfa- randet, som äro förenade med stamlinjernas uppdelning på olika ägare, kunna reduceras, men betydelsen härav för konsumenterna skulle vara ringa. Efter hand som överföringsbehoven och stamlinjenätet växa till allt större storlek är det emellertid icke otänkbart att denna fråga kan komma i ett annat läge. Det synes önskvärt att samtliga de med stamlinjenätet och storkraftöverföringen sammanhängande frågorna kontinuerligt följas med stor uppmärksamhet. Elkraftutredningen vill i detta sammanhang även peka på betydelsen av att stamlinjenätet i ett kommande skede icke över— dimensioneras, eftersom ju behovet av kraftöverföring från norr till söder så småningom måste kulminera för att därefter minska — när det ökande kraftbehovet i södra Sverige måste täckas alltmera med värmekraft och i norra Sverige med en ökande anpart av den där producerade vattenkraften.

Enligt kommunikationsdepartementets skrivelse till vattenfallsstyrelsen den 17 maj 1946 bör styrelsen vid prövning av transiteringsansökningar särskilt beakta angelägenheten av att prisuppdrivande eller med en plan— mässig kraftförsörjning icke förenliga köp av outbyggda vattenfall motver— kas. Där tvekan kan råda, huruvida transitering bör medgivas, skall frågan underställas Kungl. Maj:ts prövning.

En principiell ensamrätt för staten till byggande av stamlinjer för 200 kV eller högre spänning, förenad med rätt att vägra transitering av kraft, när sådan transitering ur allmän synpunkt anses obehövlig eller olämplig, inne- bär möjlighet att motverka sådan utbyggnad av vattenkraft, som ur det allmännas synpunkt icke är utbyggnadsmogen. Ensamrätten kan emeller- tid tänkas innebära risk för att enskilda kraftföretag, i stället för att an- vända sig av stamlinjenätets överföringsmöjligheter, utbygga ett ur allmän synpunkt icke önskvärt ledningsnät för lägre spänning än 200 kV. Denna risk bör beaktas vid prövning av ansökningar om ledningskoncessioner. En- samrätten bör dock icke utgöra hinder för enskild att själv bygga och driva ledning för 200 kV eller högre spänning om ledningen erfordras en- bart för överföring av hans eget kraftbehov och ledningen icke kan tänkas komma att ingå som del i det samkörande stamlinjenätet.

F ördelningsnäten

Fördelningsnäten, till vilka i detta sammanhang räknas landslinjenäten för 50—130 kV spänning samt bygdenäten för normalt 20—40 kV spänning jämte tillhörande landslinje- och bygdestationer (se 5. 57), äro i stort sett väl utbyggda över hela landet. Ännu återstår emellertid framdragande av högspänningslinjer till vissa glesbygder. De därmed sammanhängande spörs- målen skola närmare beröras i samband med landsbygdselektrifieringens andra problem.

Utbyggnaden av fördelningsnäten planlägges och utföres i regel av stor- kraftföretagen, vart inom sitt område. Med sin kännedom om kraftbehoven inom området ha storkraftföretagen visat sig väl ägnade att handha denna uppgift. Det kan möjligen göras gällande att det nu rådande förhållandet, att fördelningsnäten ägas av flera företagare representerande skilda intres- sen — industrier, städer, enskilda kraftbolag m. fl. _, kan leda till en viss planlöshet vid utbyggnaden. Även om erfarenheten hittills i stort sett icke givit stöd för att så skulle vara förhållandet, så saknas dock ej exempel på fördelningsledningar, vilkas utbyggnad ur nationalekonomisk synvinkel från början ha varit eller senare visat sig bli mindre lämplig. Visserligen skall enligt den sedan 1939 gällande lagtexten vid koncessionsprövningen tillses att anläggning, för vilken koncession sökes, ingår såsom ett led i en rationell elektrifiering men en dylik prövning har ansetts möta särskilda svårigheter då det gäller fördelningsledningar. De är 1933 tillkallade sak-

kunniga för elektriska kontrollväsendet ha sålunda i sitt huvudbetänkande (SOU 1936: 27, s. 66—67) vid behandlingen av spörsmålet om behovspröv— ning framhållit bl. a. följande.

Om de sakkunniga sålunda anse, att ingripande i koncessionsväg bör äga rum beträffande de lokala distri'butionsnäten i huvudsakligt syfte att förebygga upp— komsten av dubbla dylika ledningsnät, ställa de sig däremot mera tveksamma beträffande lämpligheten och möjligheten att medelst koncessionsförfarande regle- ra tillkomsten av sådana ledningar, vilka ha till huvudsaklig uppgift att överföra kraft från en kraftkälla till en viss punkt, t. ex. ett industriföretag eller ett distributionscentrum. En realprövning beträffande dylika linjer, vilka ofta i form av stamlinjer eller bygdelinjer ingå såsom viktiga led i landets elektrifierings- system, torde i de flesta fall vara förenad med utomordentliga svårigheter, under det att en sådan prövning beträffande de lokala ledningsnäten är en mera enkel uppgift, som utan större svårigheter bör kunna handhas av de myndigheter, på vilka tillämpningen av koncessionsförfarandet vilar och vilka äro väl förtrogna med de lokala förhållandena. Såsom förut har framhållits, kan hänsyn till statens egna intressen ävensom hänsyn till säkerhet, ordning och trevnad anföras såsom skäl för att staten håller en reglerande hand över de lokala distributionsnäten, under det att dylika skäl knappast kunna göras gällande beträffande de egentliga överföringslinjerna, för vilka huvudsakligen ekonomiska och näringspolitiska syn- punkter bliva avgörande. Erfarenheten ger dessutom vid handen, att missförhål- landen huvudsakligen kunna anses föreligga beträffande den lokala distributionen, varest på åtskilliga orter dubbeldistribution kommit till stånd, under det att elektrifieringen i övrigt kan anses hava utvecklats efter i stort sett sunda och rationella linjer. Denna uppfattning torde vara allmän inom sakkunniga kretsar.

De sakkunniga önska emellertid understryka, att en bestämd rågång mellan de olika slagen av anläggningar — lokala distributionsnät å ena sidan, överförings- linjer å andra sidan —— icke alltid kan dragas. Det torde därför varken vara lämpligt eller möjligt att i författningsbestämmelser angiva, när en realprövning bör ifrågakomma. Detta torde böra ankomma på de prövande myndigheterna att bedöma och en av förhållandena och utvecklingen betingad praxis torde så små— ningom komma att växa fram. De sakkunniga vilja framhålla, att därest det skulle visa sig önskvärt att ingå i realprövning av andra än de mera lokalt betonade anläggningarna, så torde det i enstaka fall vara värdefullt, om en förstärkt sak— kunskap kunde ställas till de prövande myndigheternas förfogande. De sakkunniga anse emellertid, att anlitandet av dylik sakkunskap bör äga rum endast, därest sådana förhållanden skulle uppstå, att behovet därav vore uppenbart. Det kan visserligen göras gällande, att dylika särskilda sakkunniga skulle kunna hava en uppgift att fylla, även vid prövningen av ansökningar, avseende lokala distribu— tionsnät, och att sålunda, därest en realprövning över huvud skall fortfarande äga rum., ett permanent koncessionsråd redan nu borde komma till stånd. De sakkunniga önska emellertid understryka, att prövning av sådana ansökningar, varom här är fråga, förekommer i relativt stor omfattning och sålunda är förenad med förhållandevis mycket arbete. Det torde även vara nödvändigt, att rådsleda- möterna skaffa sig detaljerad kännedom om de lokala förhållandena i varje sär- skilt fall. De kvalifikationer, som ledamöterna av ett dylikt råd borde besitta, ävensom lämpligt medlemsantal, torde sålunda i mycket vara beroende av arten och omfattningen av de koncessionsärenden, med vilka rådet skulle taga befatt— ning. Det möter därför svårigheter att på förhand angiva de grunder, efter viIka detta borde sammansättas. Man har anledning befara, att ett sådant råd skulle

komma att tynga och fördröja ärendenas behandling utan att göra motsvarande gagn. De sakkunniga anse sig därför böra tillrätta, att man i denna fråga tills- vidare ställer sig avvaktande.

Sedan numera genom 1939 års lagändring stadgats att behovsprövning bör ske och därvid ingen åtskillnad gjorts beträffande ledningarnas karaktär av detaljdistributions- eller fördelningsledningar synes det angeläget att skapa bättre förutsättningar för en allsidig bedömning av planmässigheten vid ut- byggnad av fördelningsnäten.

Kap. 8. Driften av produktionsanläggningar,

stamlinje- och fördelningsnät l

Driften av produktions— och överföringsanläggningar är en angelägenhet,1 som i första hand åvilar respektive ägare. Ett undantag utgör som förutj nämnts driftledningen av det samkörande stamlinjenätet, för vilken staten, genom vattenfallsstyrelsen svarar oavsett äganderättsförhållanden. Även om varje kraftföretag sålunda svarar för det omedelbara handhavandet ochi utnyttjandet av de egna anläggningarna förefinnes ett väl utvecklat sam-j arbete mellan de olika företagen, varigenom ett rationellt utnyttjande av de l totala kraftresurserna och kraftanläggningarna är möjliggjort.

Innan en bedömning av nuvarande förhållanden göres skall, som kom— plettering av den översiktliga behandlingen av dessa frågor i kap. 1, enl redogörelse lämnas för huru vissa för det allmänna viktigare driftfrågorj för närvarande skötas. En uppdelning göres därvid i frågor, som behandlas ; vid varje kraftföretag för sig, samt frågor, som beröra samarbetet mellan; företagen och därför inordnas under rubrikerna riksdriften och den centrala j driftledningen. Enär samkörningen får anses utgöra en av grundförutsättq ningarna för en god elkraftförsörjning, lägges stor vikt vid de problem,j som sammanhänga med denna. , i Driften inom varje kraftföretag Driftledning

Större företag, som disponera över ett flertal kraftstationer och relativt förgrenade överföringsnät, ha som regel en för de olika anläggningarnaå gemensam driftledning, vars uppgift är att planera kraftproduktionen och* nätets användning samt att beordra driftomläggningar ävensom att på annat sätt fungera som teknisk ledning för de olika driftställena. Driftledningens organisation och arbetssätt variera med företagens storlek och driftens karaktär men äro i princip ungefär desamma vid alla företag. Som exempel må beröras förhållandena inom det största kraftföretaget, statens vatten- fallsverk.

Inom vattenfallsverkets nät handhas stordriften inklusive samkörningen av ett särskilt driftkontor vid styrelsens driftbyrå, medan den lokala driften för de olika kraftverksområdena skötes av lokala driftkontor. Det centrala driftkontoret är bemannat dygnet runt med minst en vakthavande ingenjör.

Till de viktigaste hjälpmedel, som denna vakthavande ingenjör har till sitt förfogande, hör en riklig telefonutrustning, ansluten till såväl rikstele— fonnätet som högfrekvensförbindelser över kraftledningarna, med vilkens

l i

. A.,-.. ..... w_-

hjälp omedelbar kontakt kan erhållas med de viktigaste driftställena. Driftkontoret är vidare utrustat med instrument för bl. a. övervakning av produktionen i viktigare kraftstationer samt belastningen på viktigare linjer.

Varje dag uppgöres en körplan för kraftstationerna, vilken sedan justeras i den mån läget ändras. Körplanen går i princip ut på att konsumtionen skall täckas på mest ekonomiska sätt, varvid kraftens värde i de olika kraftstationerna beräknas med hänsyn tagen till den för tillfället rådande vattentillgången. Enligt körplanen beordras vissa stationer att köra kon- tinuerligt med en viss produktion. Andra stationer, de 5. k. schemakörande stationerna, beordras koncentrera sin produktion till högbelastningstiderna enligt ett särskilt angivet schema. För dessa stationer krävas sålunda möj- ligheter att korttidsreglera, exempelvis per dygn eller vecka. En tredje grupp av stationer kallas frekvensreglerande. Dessa stationer taga hand om de upp— trädande smärre variationerna i belastningen samt icke förutsedda större växlingar i denna. Lämpade för dessa uppgifter äro endast vissa större kraftstationer med bl. a. rikliga möjligheter att snabbt variera vattentapp— ningen. (Vid ökad belastning på nätet ökas tappningen och produktionen, varigenom pcriodtalet hindras sjunka, och vice versa).

Förutom den dagliga körplanen erfordras planer på längre sikt. Dessa bli med nödvändighet mindre detaljerade och mera osäkra på grund av de ökade osäkerhetsmomenten i bedömningen. De begagnas som underlag för bl. a. tappningsplaner för regleringsmagasinen och beräkningar av bränsle- behovet för ångkraft.

Planerna uppgöras med hjälp av en omfattande driftstatistik. Varje mor— gon intelefoneras rapporter om föregående dygns produktionsvärden timme för timme, vissa viktiga vattenföringar och vattenstånd m. III. De rappor— terade värdena sammanställas omedelbart på förmiddagen för att vara vakt— havande ingenjören tillhanda i hans arbete så fort som möjligt. Vidare insändas varje vecka rapporter om belastningsvärdena i alla större trans— formatorstationer, vilka värden bl. a. ligga till grund för speciella bedöman- den i samband med arbeten på kraftledningar och i stationer.

Spänningsreglering

Spänningsregleringen i ett kraftnät har huvudsakligen tre uppgifter näm- ligen att tillgodose konsumenternas önskemål om jämn spänning, att ned— , bringa överföringsförlusterna samt att höja överföringsförmågan. En god spänningsreglering förutsätter att näten äro tillräckligt kraftigt dimensione— rade med hänsyn till de överförda effekterna och att lämpliga reglerings- organ finnas.

Emedan lägsta överföringskostnad — såväl vid stamlinje— och fördel- ningsnät, som det nu närmast är fråga om, som vid andra nättyper er- hålles vid förhållandevis kraftigt dimensionerade ledningar och även

driftstörningsriskerna sjunka med ökande ledningsdimensioner ligger det i kraftföretagens eget intresse att, oberoende av spänningsregleringen, gå tämligen långt ifråga om nätens dimensionering. Materialsvårigheterna un- der krigstiden medförde emellertid att även stamlinje- och fördelningsnätens förstärkning på flertalet håll icke kunde ske i den takt, som hade varit önskvärd med hänsyn till den kraftiga belastningsökningen, varigenom så- lunda även en försämring i spänningsförhållandena inträdde. Under senaste tiden torde förseningen i förstärkningsarbetena vad beträffar dessa nättyper i stort sett ha inhämtats.

Spänningsregleringen är för närvarande till stor del automatiserad. Med de tekniska hjälpmedel, som stå till förfogande, kan spänningen på lämp— ligt dimensionerade nät utan större svårigheter hållas på önskad nivå. På de nättyper det här är fråga om innebär det i allmänhet god ekonomi för kraftföretagen att begagna sig av dessa hjälpmedel, varför spänningshåll- ningen, när de tidigare nämnda förutsättningarna äro uppfyllda, som regel också är god.

Driftsäkerhet

För att upprätthålla en god driftsäkerhet inom stamlinj e- och fördelnings— näten vidtager man dels åtgärder i förebyggande syfte och dels åtgärder för ett snabbt återupptagande av driften vid störningar. Bland de förebyggande åtgärderna intaga hållandet av hög kvalitet på de olika anläggningsdelarna och materielen samt utnyttjandet av pålitlig och välutbildad personal främs- ta rummet. För ett snabbt återupptagande av driften vid störningar erford- ras främst en god organisation för felsökning och återinkoppling, en hög reparationsberedskap samt en god reservhållning även i form av reserv- matningsmöjligheter.

Hög driftsäkerhet ställer stora anspråk på kraftföretagen. Å andra sidan få dessa vidkännas betydande kostnader och minskning av kraftinkomsterna vid driftstörningar på anläggningar av de typer det här är fråga om och därtill komma de kostnader och olägenheter, som driftavbrotten medföra för konsumenterna. Det är därför motiverat att gå ganska långt ifråga om åtgärder för driftsäkerhetens höjande. Kravet på hög driftsäkerhet inom stamlinje- och fördelningsnäten får f. n. som regel anses vara uppfyllt så långt detta är tekniskt—ekonomiskt möjligt. Givet är att möjligheterna äro mera begränsade vid anläggningar med låg utnyttjning, vilket medför att konsumenter, som erhålla kraft via sämre utnyttjade fördelningsnät, i regel få vidkännas flera driftstörningar än genomsnittligt. Enär det övervägande antalet driftavbrott för konsumenterna åtminstone på landsbygden beror på störningar inom detaljdistributionsnäten äro emellertid variationerna i driftsäkerheten hos olika fördelningsnät av relativt liten betydelse.

Riksdriften

Riksdriften, varmed här menas den landsomfattande samkörningen mel- lan alla kraftföretag av betydelse, är ett resultat av en samverkan mellan de olika kraftföretagen, Vilken ytterst bygger på företagens ekonomiska in— tressen. Då en god överblick över fördelar och nackdelar med samkörning i större skala är en nödvändig förutsättning för ett riktigt bedömande av riksdriftens betydelse och lämpligheten av dess nuvarande organisation, skall en uppställning av nämnda för- och nackdelar här göras.

1. Kraftöverskott inom ett område kan överföras till områden med kraft— brist. Detta möjliggör förbättrad utnyttjning av vattenkraften inom de om— råden, där ett varaktigt eller tillfälligt kraftöverskott finnes, samtidigt som områden med varaktigt eller tillfälligt vattenkraftunderskott kunna utnyttja den billigare överskottskraften från andra landsdelar i stället för dyrare ångkrafttillsats.

2. Kraftkonsumtionen inom olika landsdelar kan alltid tillgodoses genom den kraft, som för tillfället ställer sig billigast, den må vara producerad inom det egna området eller tillförd från andra landsdelar. Vattenhushåll- ningen kan sålunda, tack vare samkörningen, för varje område (varje kraftföretag) skötas på det för respektive företag mest ekonomiska sättet, vilket samtidigt medför ett ekonomiskt optimum för landet i sin helhet. Kraftöverskott inom ett område betingar ett relativt lågt pris enär det, om det icke kommer till användning, är värdelöst och det ställer sig sålunda billigare än kraft, producerad inom ett annat område där magasinerings- möjligheter finnas. Saken kan kortare uttryckas så, att tack vare samkör- lningen och på grund av företagens ekonomiska intressen blir den kraft, som representerar lägsta värdet, vid varje tillfälle i första hand utnyttjad och överskottskraft magasinerad i de magasin, där den är av största Värde.

3. Behovet av reservaggregat minskar, eftersom de samkörande statio— nerna respektive företagen i Viss utsträckning utgöra ömsesidig reserv för varandra. Detta medför i sin tur även ökad driftsäkerhet.

4. Nybyggda kraftstationer bli snabbt rationellt utnyttjade, enär de kun- na tagas i anspråk för de ökade kraftbehoven inom hela det samkörande nätet. Motsvarande är förhållandet beträffande nya kraftledningar.

5. Belastningen sammanlagras, vilket gör att den sammanlagda toppbe- lastningen minskar och därmed även behovet av generatoreffekt och över- föringslinjer.

6. Driftstörningar kunna sprida sig från nät till nåt. Med de tekniska hjälpmedel, som för närvarande stå till förfogande, främst kraftiga och snabba strömbrytare samt ändamålsenliga reläskydd, har dock risken här— för minskats avsevärt.

7. Vid samkörning mellan nät med olika ägare uppstår alltid ett visst extraarbete i form av ett mer eller'mindre omfattande avräkningsförfa— rande.

Fördelarna av samkörningen enligt ovanstående punkter 1—5 äro uppen— barligen av såväl företagsekonomisk som nationalekonomisk karaktär. Den ökade driftsäkerheten är av värde för såväl kraftföretagen som konsumen- terna. Nackdelen enligt punkt 6 är av driftteknisk art och är icke större än att driftsäkerheten som helhet förbättrats genom samkörningen. Nackdelen enligt punkt 7 sammanhänger med kraftanläggningarnas ägoförhållanden. Det bör dock anmärkas, att redan övervakningen av att samkörningen mel— lan ett och samma företags egna kraftstationer sker på mest ekonomiska sätt kräver en statistik, som — om än med en mera begränsad omfattning — motsvarar avräkningen mellan de skilda kraftföretagen. Särskilt med hän— syn till de rent affärsmässiga fördelarna enligt punkterna 1 och 2 finnes det ingen anledning förmoda, att under normala förhållanden samkörningen mellan företagen skall upphöra annat än tillfälligt under perioder, då den icke är ekonomiskt eller driftmässigt motiverad varken för företagen, kon- sumenterna eller landet.

Riksdriftens handhavande

Riksdriften under fredstid ombesörjes sålunda genom ett kontinuerligt samarbete mellan de olika kraftföretagen. Av praktiskt organisatoriska skäl ligger därvid det huvudsakliga samarbetet på två jämnstora organisationer nämligen å ena sidan statens vattenfallsverk och å andra sidan en grupp enskilda respektive kommunala kraftföretag. Dessa senare äro främst Krångede aktiebolag, Hammarforsens kraftaktiebolag, Stockholms elverk och Sydsvenska kraftaktiebolaget. Vardera av de två organisationerna före— träder i runt tal 40 % av landets totala kraftproduktion. Den resterande - delen omhänderhas av vissa självständiga företag, vilka närmast samordnas med statens vattenfallsverk, samt det ännu så länge isolerade Gotlands kraftaktiebolag.

Arbetsmetoden för samkörningen är den att de båda organisationerna, företrädda av vattenfallsstyrelsens respektive Krångede aktiebolags i Stock— holm belägna driftkontor, per telefon kontinuerligt överenskomma med varandra om försäljning och köp av kraft efter de Växlande priser, som kraften betingar för de olika företagen. Normalt brukar vattenfallsstyrelsen hålla de övriga kraftföretagen underrättade om de priser för tillfälligt kraftutbyte, som för vattenfallsstyrelsens del gälla för inköpt eller försåld * kraft och som kunna variera inom vida gränser från en tid till en annan allt efter kraftlägets ändringar. På samma sätt sker kontinuerliga under- handlingar mellan vattenfallsstyrelsens driftkontor och övriga fristående kraftföretag angående utväxling av kraft utöver de eventuellt förefintliga fasta kraftabonnemangen. De i Krångedegruppen ingående företagen ha en— ligt gemensam överenskommelse överlåtit åt Krångede aktiebolags driftkon- tor att ombesörja kraftutväxlingen mellan de olika i gruppen ingående före-

tagen (utöver de fasta kraftabonnemangen) på det för samtliga ekonomiskt riktigaste sättet. Därvid ha emellertid de enskilda företagen förbehållit sig rätten att genom sina respektive driftkontor följa samkörningens arbete såväl i fråga om de utväxlade kraftbeloppens storlek som prissättningen.

Några kontraktsmässigt fastställda regler för samkörningen mellan de större företagen finnas vanligtvis icke eftersom förutsättningarna äro så växlande.

I förtydligande syfte bör här nämnas, att den s. k. riksdriftbyrån (se kap. 1 s. 73) i fredstid icke har anledning att ingripa i den dagliga riks- driften, sådan den skildrats ovan. Riksdriftbyrån tjänstgör då som ett sam- ordnande och övervakande organ när det gäller krafthushållningen.

Samkörningsavräkning

Den ekonomiska avräkningen mellan de samkörande kraftföretagen sker i efterhand. Med ledning av mätaravläsningar timme för timme och de över— enskommelser, som under hand träffats, göres en sammanställning av kraftutbytet. En del kraft är försåld eller inköpt. Denna avräknas och debi- teras eller krediteras. En del av kraftutbytet kan även salderas. Härmed avses t. ex. att den inmatning, som ett företag gjort till ett annat, anteck- nas och sedan får det första företaget vid ett annat likvärdigt tillfälle ta ut motsvarande kraftkvantitet från det andra företaget. Eftersom kraftvärdet per kth är högst olika under olika tider och för olika kraftslag, måste man vid avräkningen sortera kraftbeloppen i grupper, allt efter de tider de förekomma och det pris de betinga. Det är icke ovanligt, att man vid sam- körning mellan två företag får använda sig av inemot tio olika priser. Då därtill kommer att ett och samma företag ofta har samkörning med ett fler— tal andra, har avräkningen blivit ganska omfattande och kräver kvalifice- rad personal. Transiteringen på stamlinjenätet förutsätter, som tidigare nämnts, ett särskilt avräkningsförfarande.

Den centrala driftledningen

Enligt direktiven har elkraftutredningen att pröva, huruvida det bör givas fastare former än hittills åt den samverkan vid kraftproduktionen, som redan nu upprätthålles mellan statliga och enskilda kraftintressenter. I kap. 1 s. 72 har lämnats en redogörelse för det samarbetsorgan —- Centrala drift- ledningen, i dagligt tal benämnd CDL —— som övervakar att krafthushåll- ningen blir den bästa för landet i dess helhet. Här skall närmare beröras CDL:s uppgifter med huvudvikten lagd på den fredsmässiga sidan av verk- samheten. Därefter diskuteras i vad mån en fastare form för samarbetet inom ramen för CDL skulle kunna anses erforderlig eller önskvärd.

CDL skall i första hand utgöra en beredskapsorganisation, som skall an-

svara för att kraftförsörjningen på bästa sätt upprätthålles under krig eller därav föranlett krisläge för försörjningen. Därvid måste självfallet extra- ordinära ingripanden kunna göras. Under krigsåren avgjorde sålunda CDL i vilken omfattning å ena sidan ångkraft fick produceras med användande av stenkol och å andra sidan eventuellt förekommande överskottskraft fick användas för alstrande av ånga i elektriska ångpannor. Dessa ingripanden kunde göras enligt ett bemyndigande av bränslekommissionen, vilket i sin tur grundade sig på då gällande krisförfattningar. För närvarande finnes härvidlag endast en tillfällig beredskapslag, gällande till den 1 juli 1954, som ger Kungl. Maj:t möjlighet att t. ex. vid svår vattenbrist föranstalta om erforderlig kraftransonering eller dylikt, varvid verkställandet får upp- dragas åt lämpligt organ.

Numera har sålunda CDL icke något bemyndigande att tvångsvis ingripa i krafthushållningen. Sannolikt skulle icke heller något väsentligt stå att vinna med ett dylikt bemyndigande under fredsförhållanden. Man kan näm— ligen utgå ifrån att en god hushållning med kraftresurserna ligger i veder- börande kraftföretags egna ekonomiska intressen. Det Väsentliga är att man har möjlighet att överblicka läget inom landets samtliga områden och denna möjlighet föreligger genom den riksdriftplan, som på grundval av uppgifter till riksdriftbyrån uppgöres varje vecka. Riksdriftplanen innehåller »— med redovisning såväl blockvis som totalt för hela landet _ uppgift över det verkliga resultatet (producerad vattenkraft och ångkraft, förbrukad kraft för normala ändamål, överskottskraft för elektriska ångpannor eller export samt kraftutbytet mellan blocken) under närmast föregående vecka, även- som en motsvarande prognos för närmast följande vecka. CDL kan sålunda övervaka att kraftproduktionen och kraftutbytet sker på bästa sätt. I den mån ingripanden erfordras från riksdriftbyråns sida förutsättes att därav föranlett kraftutbyte ordnas som en affärsmässigt riktig transaktion mel— lan vederbörande företag, vilken förutsättning icke behöver innebära någon begränsning av det eftersträvade resultatet beträffande krafthushållningen.

Under efterkrigsåren inträdde stora svårigheter att tillgodose behoven av framför allt generatorer och transformatorer för de pågående och planerade utbyggnaderna av kraftstationer och kraftnät. Genom en frivillig samverkan mellan tillverkare och beställare av dylik utrustning tillsatte CDL två ut- skott generatorberedningen (se 5. 165) och transformatorberedningen _ som fingo till uppgift att i CDL:s regi efter behovsprövning föreslå tillver— karna den leveransordning, som gav bästa resultat för den gemensamma kraftförsörjningen med beaktande av de skilda företagens egna behov. Ge— nom underhandlingar med olika företag ha även omläggningar av tidigare gjorda beställningar kunnat ske, varigenom den samlade tillgången på kraft betydligt ökats. Eftersom läget beträffande leverans av generatorer och transformatorer förbättrats numera, kunna de båda utskotten i stort sett anses ha slutfört sin uppgift. Genom dessa åtgärder, som tillgripits när

läget så påkallade men som avvecklats, så snart de ej längre erfordrats, och som givit ett synnerligen gott resultat, har CDL visat sig vara skickat att på ett effektivt sätt tillgodose kraftföretagens och landets intresse även i detta avseende.

Genom generatorberedningen erhölls en samlad överblick över utbygg- nadsplanerna, vilken varit till nytta för myndigheterna när det gällt t. ex. byggnadsregleringen. Den har även varit till nytta för kraftföretagen själva, vilka därigenom fått bättre möjligheter att bedöma lämpligheten att igång- sätta nya utbyggnader. För att såvitt möjligt garantera att produktions— anläggningar utbyggas tillräckligt snabbt men att å andra sidan försörj— ningsapparaten inklusive erforderlig utvecklingsmarginal icke blir över- dimensionerad är det nödvändigt, att en dylik översikt över utbyggnads— verksamheten bibehålles allt framgent. Den erhålles f. n. genom ett sam- arbete i detta avseende mellan vattenfallsstyrelsen och Svenska vattenkraft- föreningen.

I avsikt att om möjligt undvika tvångsmässig begränsning av kraftför- brukningen eller i varje fall minska eventuellt erforderlig begränsning har CDL vid några tillfällen vidtagit åtgärder för mobilisering av praktiskt taget alla förefintliga reservkraftresurser. Elblockcheferna ha därvid haft att till- se, att outnyttjade effektreserver t. ex. i form av enskilda små värmekraft— verk —— även om dessa under normala förhållanden äro oekonomiska —— kunde ställas till gemensamt förfogande genom att tillfälliga avtal träffades mellan företag, som skulle avstå från kraft, och företag, som skulle tillgodo- göra sig densamma. Detta är en uppgift som alltid kan ha stor betydelse vid vattenbrist. På grund av kraftproduktionens uppdelning på ett flertal större eller mindre företag är det nödvändigt att en dylik, enhetligt ledd mobilise- ring av kraftresurser snabbt och effektivt kan genomföras.

Inom riksdriftbyrån verkställas omfattande utredningar i syfte att bedö- ma kraftbalanslägets sannolika utveckling vid det utbyggnadsprogram, som föreligger. Undersökningarna äro dels kortfristiga, t. ex. med sikte på en innevarande belastningssäsong, dels långfristiga för att öka möjligheterna till en bedömning av utbyggnadsbehovet som fortsättning på nämnda pro- gram. Som grund för dessa beräkningar erfordras såväl den ovan nämnda översikten av de planerade utbyggnaderna som särskilda undersökningar om de väntade kraftbehoven. Detta utredningsarbete, som har en väsentlig nationalekonomisk betydelse, bör även i fortsättningen bedrivas.

Frågan om CDL:s fortbestånd och funktion under fredstid har berörts av Ekonomiska försvarsberedskapsutredningen i dess är 1946 avgivna betän- kande med förslag rörande försvarsberedskapens framtida organisation (SOU 1946:19). Utredningen understryker vikten av att förberedelser vid- tagas för att kraftförsörjningen även under en kris skall tillgodoses. I an- slutning till en redogörelse för bränslekommissionens och CDL:s uppgifter rörande kraftförsörjningen under kriget anför utredningen bl. a. följande.

Medan centrala driftledningens uppgift sålunda legat på produktions- och distri- butionssidan, har den erforderliga övervakningen och regleringen av konsumtio- nen däremot helt handhafts av bränslekommissionen.

Centrala driftledningsorganisationen är, såsom av det anförda torde framgå, egentligen tänkt att utgöra en krisorganisation. Emellertid är ett rationaliserings- och samordningsarbete på kraftförsörjningsområdet även under normala förhål- landen givetvis av största betydelse, och utredningen kan därför icke finna annat än att det skulle vara av värde att, såsom meningen torde vara, även framgent åtminstone i viss utsträckning bibehålla organisationen i fråga, som både prövats och befunnits lämplig. Åt denna organisation bör då också anförtros att i samråd med det centrala beredskapsorganet handha de beredskapsuppgifter på kraftför- sörjningsområdet som avse produktion och distribution. Förberedelserna för en reglering av konsumtionen torde däremot böra ankomma på sistnämnda central- organ, vilket därför skulle komma att överta bränslekommissionens hittillsvarande roll härutinnan. Såsom ersättare i centrala driftsledningen för bränslekommissio- nens representant bör i enlighet härmed, när denna kommission upphör, en re- presentant för centralorganet ingå.

Enligt vad av det anförda framgår, är det alltså utredningens mening, att cen- trala driftledningen i fortsättningen bör bestå och att beredskapsfrågorna på ifrågavarande område böra fördelas på denna organisation och centralorganet för ekonomisk försvarsberedskap på sätt nu nämnts. Denna fördelning av uppgifterna innebär givetvis icke något åsidosättande av centralorganets uppgift att över huvud taget svara för beredskapssynpunkternas tillgodoseende.

Det framgår av denna redogörelse för olika grenar av CDL:s verksamhet, att CDL utövar för kraftförsörjningen Viktiga funktioner av mera fredsmäs- sig karaktär, som vid bibehållande av nuvarande system med ett antal kom- munala och enskilda kraftföretag vid sidan av det statliga böra kunna om- besörjas av CDL även framdeles. I frågan huruvida fastare former böra givas åt det rådande samarbetet mellan kraftintressenterna kan följande anföras.

Vissa fördelar kunde måhända vinnas genom att omändra CDL till en statlig myndighet, som utrustades med lämpliga befogenheter att ingripa i de kommunala och enskilda kraftföretagens drift, eventuellt med skyldig— het för dessa företag att vara anslutna till CDL och att medverka till en god krafthushållning genom samkörning etc. Inrättandet av en dylik myn- dighet skulle medföra en mängd organisatoriska, tekniska och ekonomiska problem, som här icke närmare utredas. Möjligtvis skulle därvid kunna åberopas det koncessionsvillkor, som sedan ett tiotal år tillbaka tillämpats för alla 200 kV linjer och i regel för 130 kV linjer, nämligen att koncessions- innehavare skall vara skyldig att iakttaga de bestämmelser angående led- ningens samkörning med andra ledningar, som Kungl. Maj:t kan komma att föreskriva, samt att deltaga i kostnaderna för samkörning med skäligt belopp. Å andra sidan torde denna omständighet samt de olika företagens egna ekonomiska intressen utgöra en garanti för att en lämplig samkörning även i fortsättningen kommer att upprätthållas. Så länge detta är fallet torde ej några praktiska olägenheter behöva uppstå av att CDL är grundat

på ett frivilligt samarbete. Det är tvärtom sannolikt, att denna samarbets- form bidragit till det smidiga arbetssätt och det goda resultat, som verksam- heten kunnat och kan uppvisa.

Som ett sammanfattande omdöme om driftförhållandena i vad det gäller produktionsanläggningarna, stamlinje- och fördelningsnäten vill elkraft— utredningen uttala, att möjligheterna till samkörning och god krafthushåll- ning uppenbarligen äro väl tillvaratagna i Sverige, dels genom de olika före- tagens egna driftorganisationer, dels ock genom den övervakning av kraft- hushållningen, som erhålles genom CDL-organisationen. Med hänsyn till de goda erfarenheterna av denna organisations hittillsvarande verksamhet synes, under förutsättning av en i huvudsak oförändrad organisation inom Sveriges elkraftförsörjning, dess fortbestånd vara att bestämt förorda. Ut- redningen finner ej skäl för närvarande föreligga till ändring av organisa- tionens karaktär i syfte att uppnå fastare samarbetsformer.

Kap. 9. Industrins och kommunikationernas

elkraftförsörj ning

Industrins och de elektrifierade samfärdsmedlens ställning bland elkraft- förbrukarna framgår av bilderna 3 (s. 82), 9 (s. 118) och 10 (s. 120).År 1952 utgjorde industrins andel av den totala, för högvärdiga ändamål nyttig— gjorda elkraften 63 %. Småindustrins och hantverkets förbrukning, som i motsats till den större industrins huvudsakligen uttages i form av lågspänd kraft och som år 1952 utgjorde 7,5 %, är ej inräknad i ovannämnda siffra. Järnvägar och spårvägar förbrukade samma år 9 %. Industrikonsumtio- nens andel av den totala konsumtionen uppvisar, som nämnts 1 kap. 4, s. 119, en klar tendens till minskning medan kommunikationernas andel kulmine- rat efter en lång uppgångsperiod. Under de senaste tio åren har den årliga konsumtionsökningen i genomsnitt utgjort för industrins del knappt 7 % per år och för järnvägar och spårvägar 4,5 % per år. För detaljförbruk- ningen har den under samma tid utgjort ej mindre än 12 % per år. Det finnes dock ingen anledning antaga annat än att industrin under över— skådlig tid kommer att dominera i fråga om elkraftförbrukningen. i !

Industrins elkraftförsörjning

Vad som i det följande säges om industrin avser i första hand den större industrin enligt ovanstående uppdelning. Småindustrins och hantverkets ! elkraftförsörjning behandlas huvudsakligen tillsammans med kraftförsörj- ; ningen för annan detaljförbrukning i städer och på landsbygd. Trots denna ] uppdelning har det, med hänsyn till tillgänglig statistik, blivit nödvändigt ! att i de siffermässiga uppgifterna rörande industrin i det följande medräkna ] även mindre industriföretag, i allmänhet till en undre gräns utgörande fem 1 anställda personer. Detta har emellertid ingen betydelse för de bedöman— % den beträffande industrin, exklusive småindustri och hantverk, som göras :, här. Förutom i detta kapitel behandlas en del för speciellt industrins el- ; kraftförsörjning viktiga frågor, sammanhängande med den särskilda skat- 3 ten på elektrisk energi, i ett senare kapitel (kap. 15).

Elkraftens betydelse inom olika industrigrupper

Elkraften har väsentligt olika betydelse inom olika industrigrupper. Av den elkraft, som år 1952 levererades till industrierna, föll 42 % på huvud- gruppen malmbrytning och metallindustri, 26 % på pappers- och grafisk

industri och 12 % på kemisk-teknisk industri medan återstoden, 20 %, fördelas på övriga industrigrupper.

Elkraftens betydelse för olika industrier kan på grundval av tillgänglig statistik lämpligen belysas från tre olika synpunkter, nämligen genom un- dersökning beträffande skilda industrier av dels elkraftförbrukningens storlek och tillväxt jämförda med bränsleförbrukningens, dels elkraftkost— nadens betydelse för industriprodukternas tillverkningskostnad, dels ock elkraftförbrukningens omfattning i förhållande till antalet inom industrin sysselsatta arbetare.

Jämförelse mellan elkraftförbrukningens och bränsleförbrukningens storlek och tillväxt inom industrin

Kommerskollegii industristatistik ger bl. a. upplysning om de olika indu— strigruppernas förbrukning av bränsle respektive elkraft. Som påpekats tidigare (s. 113) är det svårt att av enbart sådana uppgifter draga några be— stämda slutsatser beträffande i vilka proportioner industrin täcker sitt totala energibehov med bränsle och elkraft. I stort sett kan gränsen för de olika energiformernas användning anges så, att drivkraftbehovet tillfreds— ställes med elkraft och värmebehovet med bränsle. Väsentliga undantag fin— nas emellertid. För en del högkvalificerade värmebehov kommer elenergi till användning. Likaså kunna vissa industrier använda billig överskotts- kraft för värmealstring. I industriernas mottrycksanläggningar omsättas icke oväsentliga mängder bränsle till elenergi. De tekniska och ekonomiska betingelser, som äro avgörande för den "ena eller andra energiformen, växla under olika tider och inom olika industriföretag.

I bild 14 visas utvecklingen under de senaste decennierna rörande indu- strins totala bränsle— respektive elkraftförbrukning. Det bör observeras att den omständigheten, att kurvorna ritats i samma diagram och med olika skalor på den vertikala axeln, icke innebär någon omräkning till gemensam energienhet. Bränsleuppgifterna omfatta förbrukningen av stenkol, koks, torv, träkol, ved och annat träbränsle, flytande bränsle samt gas. För att erhålla ett enhetligt mått på de olika industrigrenarnas totala bränsle- konsumtion ha före hopsummeringen de särskilda bränsleslagen evalverats till stenkol. Som framgår av bild 14 har bränsleförbrukningen under nämn- da tidsperiod varierat tämligen kraftigt med en högsta förbrukning åren närmast före det senaste världskriget, en kraftig nedgång under krigsårens importbegränsning och därefter åter en kraftig uppgång. Elkraftförbruk- ningen visar en något jämnare utveckling med mindre nedgångsperioder i början av kriget samt under vattenbriståren 1947—48. En jämförelse mel- lan kurvorna ger tydligt vid handen att, totalt sett under hela perioden, en överflyttning har skett från bränsle till elenergi. Under normala tider synes dock tillväxten av bränsle- respektive av elkraftförbrukningen ha varit av i stort sett samma karaktär.

Milj. ton stenkol eller motsvarande, resp. 1 000 milj. I'd/lh 12

0 1920 25 50 55 40 45 50

Bild 14. Bränsle- och elkraftförbrukningen inom industrin åren 1920 —1950. (Enl. kommerskollegii industristatistik)

Inom flertalet industriföretag är kraftförbrukningen per produktions- enhet förhållandevis låg och kraftkostnadens inverkan på slutproduktens tillverkningskostnad ringa. Normalt uppgår kraftkostnaden till mindre än 2 ä 3 % av totala tillverkningskostnaden inom följande industrier: järn- och stålmanufaktur, mekaniska verkstäder, skeppsvarv, elektroteknisk industri, tegelbruk, porslinsfabriker, glasindustri, sågverk och hyvlerier, snickeri— och möbelfabriker, boktryckerier, sockerbruk, ullspinnerier och ylleväverier, trikåfabriker, sömnadsfabriker samt skofabriker. Förhållandevis få företag inom dessa uppräknade grupper driva egna vattenkraftstationer. De stor— industrier, för vilka kraftkostnaden utgör mer än 2 a 3 % av totala pro- duktionskostnaden, äro följande i ungefärlig ordning efter procenttalet med början med det lägsta: bomullsspinnerier och väverier, järnmalmsgruvor och anrikningsverk, metallverk, kolgruvor, metallmalmsgruvor och -anrik- ningsverk, cementfabriker, wallboardfabriker, järn- och stålverk, pappers- massefabriker, pappersbruk samt elektrokemisk industri. För sistnämnda grupp utgör kraftkostnaden ungefär 12 % av totala produktionskostnaden. Inom dessa grupper är det tämligen vanligt att industriföretagen ha egna

Ellrraftkostnadens betydelse för industriprodukternas tillverkningskostnad i i |

' O. 3' le,; Elkamisk industri

2 15 '

», J'arn— o.stålverk 2 .

'&' H/Cementfabriker

Pappershmk Pappel—srmssefa'tn—ilmr

l 5 !(olgruvor

' ' Wallboardi'abriker

.letallgruvor m.m. l ,0 _ Metallverk Pers lins- o .kalce Liam-ika Jårnmalmsgruvor m.m. Tecelbruk 0.5 & Bomullsindustri Mekaniska verkstäder o ' 0 1000 2000 5000 4000 5000 6000 7000 8000

Tillverknngsvärde , milj .lcr

Bild 15. Elkraftförbrakningen i förhållande till slutproduktens tillverkningsvärde inom ett antal industrigrupper år 1950, (Enligt kommerskollegii industristatistik; Medelvärdet för hela industrin ligger väsentligt lägre än vad bilden antyder, näm- ligen vid ungefär 0,!is kWh/kr.)

vatten— eller värmekraftstationer. Endast cementindustrin är praktiskt taget helt baserad på inköpt kraft.

Bild 15 visar schematiskt elkraftförbrukningens omfattning inom ett an- tal olika industrigrupper i förhållande till slutproduktens tillverknings- värde. I stapeldiagrammet representerar varje stapels baslängd industri- gruppens tillverkningsvärde år 1950 och stapelns höjd antalet kWh per kronas tillverkningsvärde samma år. Hela den inneslutna ytan represente- rar sålunda energiförbrukningen. Det bör emellertid framhållas, att fler- talet industrigrupper inom sig äro mycket oenhetliga. Icke minst gäller detta den elektrokemiska gruppen. Även många av de övriga gruppernas stapelhöjder representera medeltal för mycket skiljaktiga produkter. Dia— grammet kan därför icke göra anspråk på annat än att visa en ungefärlig och starkt schematisk bild av förhållandena. Dessutom tillkommer, att dia-

400 000 Elkemisk indash—i 140 000 .

Cementfatriker 120 000 *

Pappersmssefahriker 100 000 -

Metallverk 80 000 - Pappersbruk Järn— o. stålverk 60 000 - Vv'al lboardfabr ”12:e:- Metallmvor m.m. 40 000 . Järmnalmsgruvor m.m. Kolgruvor 0 00 . 2 O Porslins- o.!cakelfebriker Bonullsimlustri Thälw Mekaniska verkstäder O . . . . . . 0 50 000 100 000 150 000 200 000 250 000 arbetare

Bild 16. Elkraftförbrnlcningen i förhållande till antalet sysselsatta arbe- tare inom ett antal industrigrupper år 1950. (Enl. kommerskollegii industristatistik; Medelvärde! för hela industrin ligger väsentligt lägre än vad bilden antyder, nämligen vid ungefär 16 400 kWh/arbetare)

grammet endast upptar elkraften men ej den direktdrivande vattenkraften. som fortfarande har ganska stor betydelse inom vissa industrigrupper, exempelvis träslipericrna och pappersbruken.

Elkraftförbrnkningen i förhållande till antalet sysselsatta arbetare

En undersökning av elkraftförbrukningens omfattning i förhållande till antalet sysselsatta arbetare ger en annan bild av elkraftens betydelse inom olika industrigrupper. Bild 16 visar ett stapeldiagram, där varje stapels baslängd representerar antalet arbetare i industrigruppen och stapelns höjd antalet kWh per arbetare. En närmare undersökning visar bl. a. att, medan man i ett legeringsverk kan förbruka uppåt 3 milj. kXVh per arbetare och år vid full drift året runt, år åtgången i ett spinneri endast i runt tal 6 000 kW'h per arbetare och år.

De storindustrier, för vilka kraftkostnaden överstiger 2 a 3 % av totala produktionskostnaden ha som redan nämnts ofta egna kraftstationer. Bruks— industrins självförsörjning på kraftområdet är historiskt betingad och många industriföretag ha även i dag till väsentlig del sin kraftförsörjning baserad på egen vattenkraft, som successivt utbyggts.

Självförsörjningen på kraftområdet binder stort kapital och kräver in- tresse och arbete från företagsledningens sida. Den ger emellertid också många fördelar: de ofta förhållandevis korta överföringarna bli föga kost- samma; överskottskraften kan utnyttjas friare än om företaget köper all kraft och därvid även skulle kunna utnyttja överskottskraft från det kraft- säljande företaget; genom anpassning av avskrivningarna kan rörelsen hållas väl konsoliderad och motståndskraftig mot påfrestningar. Den egna kraftförsörjningen medför vidare en viss ökad ekonomisk säkerhet för före— taget, därest penningvärdet faller. Å andra sidan'kan dock det motsatta förhållandet inträffa vid prisfall, om en anläggning tillkommit under dyr- tid. För ett industriföretag föreligga vidare åtskilliga möjligheter att driva kraftstationer och ledningsnät billigare än ett företag för allmän distribu- tion. Reparationer kunna ofta utföras av eget folk och på egna verkstäder.

En speciell form av industriell självförsörjning på kraftområdet är indu- strins delägarskap i rena kraftföretag. Exempel på sådana företag äro Kraftaktiebolaget Ljusne strömmar (delägare Bergvik & Ala, Ströms Bruk och Ljusne—XVoxna), Lanforsens kraftaktiebolag (delägare Sandvikens jernverk till 1/3 och Stockholms stad till 2/3), Bergslagens gemensamma kraftförvaltning (delägare ett antal bergslagsindustrier m. fl.), Krångede aktiebolag (delägare Fagersta bruk, Sandvikens jernverk, Hofors bruk, Korsnäs, Bergslagens gemensamma kraftförvaltning, Stockholms stad, Syd- svenska kraftaktiebolaget). Denna industri-kooperativa kraftanskaffnings— form fick under 1920—1940-talen vidgad betydelse och möjliggjorde snab- bare tillgodogörande av kapitalkrävande men per nyttiggjord enhet billiga ' vattenfall och utbyggnad av härför erforderliga kraftledningar. ! Ännu under 1930-talet svarade enbart de rent självförsörjande industri- å företagen för omkring 1/3 av den totala elkraftproduktionen i landet. En ! jämförelsevis stor del härav utgjordes dock av värmekraft, i första hand & mottryckskraft från pappersbrukens och pappersmassefabrikernas kraft- anläggningar. (Denna produktion bortföll till stor del under kriget.) Av den totala elkraftproduktionen under år 1950, drygt 18 000 milj. kWh, sva- rade industriföretagen för 4200 milj. kWh, dvs. 23 %. Därav utgjorde 660 milj. kWh värmekraft, huvudsakligen mottryckskraft. Medräknas även in- dustriföretagens andel av kraftproduktionen inom delvis industriägda kraft- företag uppgick samma år industrins totala andel av Sveriges elkraftpro- duktion till 30 a 35 %. Som tidigare nämnts förbrukas en viss, kvantitativt

sett tämligen obetydlig, del av den inom industrierna producerade elkraften för andra än industriella ändamål.

För åtskilliga av de tidigare helt självförsörjande storindustriella kraft- företagen ha de egna krafttillgångarna så småningom visat sig otillräckliga och behovet av tillskottskraft har därefter fått täckas genom inköp. År 1950 uppgick den av industriföretag från främmande kraftverk mottagna, mins- kad med den till andra verk levererade, energin till ca 2 800 milj. kWh, dvs nära en fjärdedel av den inom industrin förbrukade elenergin.

Överföringen av elkraft till industrin berör i den mån kraften icke tages från lokalt belägen kraftkälla, i huvudsak endast fjärröverföringen och fördelningen och sålunda endast i mindre omfattning detaljdistributionen. I tekniskt avseende finnes därför beträffande denna överföring inget att tillägga utöver vad som tidigare sagts ifråga om råkraftöverföring.

Speciellt för de industrier, som helt eller delvis basera sin kraftförsörj- ning på inköp från företag, till vilka de icke äro ägare eller delägare, blir tariffrågan av betydelse. Som framgår av redogörelsen för tariffutveck- lingen 1 kap. 2, har så småningom en viss normalisering genomförts beträf- fande industritarifferna och i samband därmed en successiv sänkning av kraftpriserna. Dock tillämpas, som även omnämnts i kap. 2, speciella tarif- fer vid speciella belastningsförhållanden. Det tidigare normala förhållandet att kraftpriserna voro beroende av leveranspunktens läge är i huvudsak avvecklat men en måttlig differentiering av engrospriserna för Norrland, Mellansverige och Sydsverige har på senaste tid börjat att genomföras (se 5. 105).

För många industrigrenar utgör kraftpriset en väsentlig faktor för ut- vecklingsmöjligheterna. I fråga om åtskilliga produkter måste Sveriges in- dustri vara beredd att möta konkurrens från utlandet, särskilt från länder, som äro rika på billig vattenkraft, exempelvis Norge, Kanada och USA. Den svenska storindustrin har under utlandskonkurrensen haft ett gott stöd i vå- ra låga kraftkostnader. Sveriges goda ställning i detta avseende har i viss mån kunnat uppnås dels genom industrins självförsörjning med kraft, dels ' genom en framsynt taxepolitik från kraftleverantörernas sida.

Elkraftens betydelse för industrins lokalisering

! » l l

Industrins lokalisering inom landet åskådliggöres av bilderna 17 och 18, ' samt av tabell 2, vilka för år 1951 utvisa fördelningen på de olika länen och på grupper av lån av industrins arbetsställen, arbetare och elektriska energi- förbrukning. Beträffande energiförbrukningen har i den sistnämnda bilden även fördelningen på de fem industrihuvudgrupper åskådliggjorts, vilka i detta sammanhang kunna vara av särskilt intresse.

Frågan om elkraftens betydelse för industrins lokalisering förtjänar att närmare beröras. Av tekniskt-historiska skäl ha åtskilliga industricentra

Tabell 2. Den industriella elkraftförbrukningen inom olika län och grupper av län är 1951

Industriell elkraftförbrukning .. Antal indu- L _ 67 av hela Grupp an strlarbetare milj. Syferiges in— kWh/indu- lth dustriella el— striarbctare kraftförbr.

] Norrbottens 12 100 530 5 43 800 Västerbottens 11 300 570 5 50 300 Jämtlands 3 800 90 1 24 800 Västernorrlands 22 200 1 770 16 79 700

I 49 400 2 960 27 59 900

II Gävleborgs 29 700 950 8 32 000

[II Kopparbergs 27 500 1 010 9 36 900 Värmlands 26 900 990 9 36 800

111 54 400 2 000 18 36 900

IV Övriga Sverige 542 800 5 250 47 9 700 I+II 79 100 3 910 35 49 500

I + II+III 133 500 5 910 53 44 300 Hela Sverige 676 300 11 160 100 16 500

förlagts till trakter med god tillgång till vattenkraft. Detta gäller exempelvis flera av de stora bruksföretagen i Bergslagen och nedre Norrland. De äldsta ännu kvarstående centra för de starkt kraftförbrukande elektrokemiska och elektrotermiska industrierna utbildades inne i landet kring vattenkraft- stationerna vid Månsbo vid Avesta, Trollhättan, Gullspång, i Ljungan och i viss mån vid Porjus. Bild 18 visar en tydlig koncentration av starkt kraft— förbrukande industri till landsdelar med god eller någorlunda god tillgång till vattenkraft men med samtidig tillgång till andra råvaror eller andra förutsättningar för nämnda industrier. Jämtlands län, Sveriges minst indu- strialiserade, framträder dock som ett markant undantag. Utvecklingen har emellertid medfört att för vissa av de län, där den industriella kraftförbruk- ningen är stor, tillgången till närbelägen kraft blivit otillräcklig. Ett när- mare studium av de senare årtiondenas utveckling skulle dessutom visa en snabbare utvecklingstakt för det industriella näringslivet i mellan- och sydsvenska län än i andra delar av landet samt en påtaglig förskjutning från landsbygd till städer. Även om dessa fortfarande pågående förändringar av vår industrilokalisering äro mest påtagliga för mindre kraftberoende in-

' Antal arbetsställen

1000

C

...- få:—2020.

500 Län:

B]) = Norrbottens

AC = Västerbotte - Jämtlmde nl

- Västernorrl

, /

1 l l l

%s,o,d;.Zo,o,:,o,o,o,o,o,o,o::3$: . & ...AA = Gävleborgs = Kopparbergs - Värmlands Örebro Västmanlands Uppsala sto.:ldiolma &) Stockholm 1' Södnnnanlan Östergötla

. Gotlands EDACZYXWSTUCBADEIRPOFGHNKLM R=Skaraborgs P - Älvsborgs

O - Göteb. och F - Jönköpings G = Kronobergs H - Kalmar Hallands

! _- Blekinge

1 000 ' L - Kristianstad M - Malmöhus

40000-

whodamäNHN I

20000-

Hb! III

Elkraft- förbruk- 1 500 - ning

Milde'lh

= ||

1. I 500" ! l

0

BDACZYXWSTUCBADEIRPOFGHNKLM

Bild 17. Antal arbetsställen och arbetare samt total elkraftförbrukning inom in- dustrin, fördelade på de olika länen, är 1951. (Enl. Statistisk årsbok och kom— merskollegii industristatistik)

dustrier och även om den industriella elkraftförbrukningen fortfarande till övervägande del är lokaliserad till de vattenkraftrika länen (se tabell 2) är det dock uppenbart att den omedelbara närheten till naturkraft blivit av

?

/ Malmhrytning och metallindustri

*?

Pappa-s- och grafisk industri

_ år W ...? (se.

wsurcslnrrarorear

Kemisk-telnäsk industri

V.---. r.. 7.4. . Å

snlczrstrUCAD FGHNKLM

O'XJO'UwHIHCJtUPOQHU)

712311

I'.'l

Län: lion—botten:; Västerbo ttens Jämtlands Västernorr landa Gävl eborss Kopparbergs Värmlands Öretn': o Väsmurdards Uppsala Stockholms s tad. St ockho lms län Södemtlands Öst ergö t lands Got lands Slo-iraborgs !; lvsborgs Göt eb . och Bohus Jönköpings Kronobergs Kalmar llal lands Blelcinge Krist inristade; Malmöhus

Bild 18. Elkraftförbrukningen inom vissa industrigrupper, fördelad länsvis, är

1951. (Enl. kommerskollegii industristatistik)

allt mindre betydelse. Kraftöverföringstekniken har sålunda i hög grad minskat industrins bundenhet vid kraftkällan.

Elkraft finnes numera tillgänglig så gott som överallt i vårt land och det är vad elkraften beträffar närmast dess pris och kvalitet som kan öva inflytande på industrins lokalisering (se även kap. 14). Av de faktorer, som bestämma lokaliseringen av olika industrier, spelar emellertid även elkraf- tens pris ofta en underordnad roll. Bland de mest framträdande lokalise— ringsorsakerna märkas transportförhållandena och tillgången till eller priset på arbetskraft. Av stor betydelse kunna också vara sådana faktorer som till- gång pä tomtmark, material för produktionen, lämplig avsättningsmarknad. lämpliga bostadsförhållanden m. 111. Att elkraften såsom lokaliseringsorsak har en relativt liten betydelse framgår bl. a. därav, att nya industrier, även om de äro av kraftslukande karaktär, numera merendels förläggas till kus- ten, exempelvis Norrbottens järnverk i Luleå, Bolidens smältverk vid Rönnskär, Aloxidverken vid Kubikenborg, Stockholms superfosfats kväve— fabrik i Stockvik samt Skånska cements fabriker vid Köping och Vika (Södertörn).

Mot det sätt på vilket industrins kraftförsörjning huvudsakligen är ord- nad i vårt land finner elkraftutredningen ingen anmärkning. Ej heller fin- ner elkraftutredningen att några berättigade farhågor för närvarande kunna finnas för industrins framtida elkraftförsörjning.

Kommunikationernas elkraftförsörjning

Den helt övervägande delen av de elektrifierade samfärdsmedlens elkraft- förbrukning belöper på de elektrifierade statsbanorna.

Järnvågselektrifieringens utveckling har tidigare berörts (kap. 2). Vid utgången av år 1952 hade de elektrifierade linjerna vid statens järnvägar en banlängd av omkring 6 000 km, dvs. omkring 40 % av hela statsbano- nätet. Det är företrädesvis de starkast trafikerade banorna, som elektrifie- rats. Detta framgår därav, att av statsbanornas totala trafikarbete numera omkring 87 % uträttas med elkraft.

Man har beräknat, att de inbesparingar i fråga om kol och annat lok- bränsle, som uppstod enbart under krigsåren genom eldrift i stället för ; ångdrift, mer än väl uppväger hela det i statens järnvägars banelektrifie- ringar f. n. investerade kapitalet.

För de elektrifierade huvudbanorna användes ett med lågt periodtal : (162/3 p/S) arbetande enfassystem. I regel tillhandahålles den för järnvägs- drift avsedda trefaskraften vid 6 kV spänning i av kraftleverantörerna ägda transformatorstationer samt omformas och upptransformeras i järnvägen tillhöriga omformarstationer till en kontaktledningsspänning av 16 kV. Större delen av kraften till de elektrifierade statsbanorna levereras från statens vattenfallsverk. Kraften uttages i huvudsak vid ett 40-tal trans—

| l l l l l

formatorstationer. För vattenfallsverkets leverans gälla speciella tariffer, vilka äro beräknade efter självkostnadsprincip. De övriga kraftleverantö- rerna äro Sydsvenska kraftaktiebolaget och Stora Kopparbergs bergslags aktiebolag. Kraftuttagningen från dessa tre leverantörer har under 1952 skett till en genomsnittskostnad av 2,4 öre/kWh.

Av järnvägsstyrelsen verkställda utredningar ha visat att elektrifieringen av det svenska statsbanenätet bör fortsättas i viss ytterligare, icke oväsent- lig omfattning. När av statsmakterna hittills beslutade elektrifieringsprojekt genomförts, har den elektrifierade banlängden ökat till ca 6 800 km, mot- svarande 45 % av statens järnvägars totala banlängd. Av det totala trafik- arbetct kan då ca 90 % beräknas bli utfört genom elektrisk drift.

Den för elektrisk spårvägsdrift använda energin uppgick under år 1952 i de nio städer som bedriva spårvägstrafik till sammanlagt 124 milj. kWh (därav i Stockholm 82 och i Göteborg 29 milj. kXVh). År 1936 utgjorde motsvarande förbrukning 58 milj. kXVh (därav i Stockholm 36 och i Göteborg 13 milj. kXVh). Under mellanliggande period har sålunda spårvägarnas energibehov ökat med 114 %. Enligt Svenska elverksföreningens statistik, varur före— stående uppgifter äro hämtade, utgjorde medelpriset för energi till spårvägs- drift under 1952 i sju av städerna (uppgifter för Stockholm och Norrköping saknas) mellan 5,7 och 10,3 öre per kWh.

Förutom vid spårvägarna användes i mindre utsträckning elkraft för drift av andra lokala trafikmedel såsom vid förortsbanor med begränsad ut- sträckning samt trådbussar. Även ackumulatordrivna fordon förekomma, ehuru i obetydlig omfattning.

Kommunikationsmedlens elektrifiering är otvivelaktigt av stort national- ekonomiskt värde såväl under normala tider som under tider med import— svårigheter, då även beredskapsmässiga synpunkter tillkomma. Den elektri- fiering som redan gjorts får därför betraktas som synnerligen ändamålsen- lig. Mot en ökad elkraftanvändning genom fortsatt elektrifiering och utveck- ling av trafiken kunna ur landets kraftförsörjningssynpunkt inga betänk- ligheter resas.

Kap. 10. Städernas elkraftförsörjning

Distributionen av elektrisk kraft bedrives under väsentligt olika tekniska och ekonomiska förutsättningar inom tätorterna och på den egentliga lands- bygden. Även om givetvis många problem äro gemensamma för all dylik i distribution —— det är närmast detaljdistributionen som avses i detta sam- manhang — synes det lämpligt att bedöma städernas respektive landsbyg- dens kraftförsörjningsfrågor var för sig och att så långt möjligt behandla förekommande gemensamma problem där de huvudsakligen höra hemma dvs. i detta kapitel rörande städernas respektive i nästa kapitel rörande landsbygdens elkraftförsörjning. Av naturliga skäl intaga landsbygdens tätorter en mellanställning, varför synpunkterna på såväl städernas som den egentliga landsbygdens elkraftförsörjning i olika avseenden gälla för denna grupp. Vissa speciella frågor, som äro av stort intresse för såväl stads— som landsbygdsdistributionen, behandlas gemensamt i ett efterföljande kapitel (kap. 12).

Stadsdistributionens omfattning

Samtliga städer och andra tätorter i vårt land ha tillgång till elektrisk kraft och praktiskt taget samtliga hushåll inom dessa orter äro anslutna till det elektriska distributionsnätet. Elektrifieringsgraden är således för tätorternas del i det närmaste 100 %. (För hela riket var elektrifierings— ' graden vid slutet av år 1953 ca 98,5 %. Se mera härom under Landsbygdens elkraftförsörjning, s. 211).

Av bild 3 framgår, att detaljförbrukningen år 1952 utgjorde 28 % av den totala, för högvärdiga ändamål nyttiggjorda elkraften. Av bilden framgår även att detaljförbrukningen genomgått den snabbaste utvecklingen av de tre huvudkonsumtionsgrupperna industri, järnvägar och spårvägar respek- , tive detaljförbrukning. Den sistnämndas andel av den totala konsumtionen ' var sålunda genomsnittligt under femårsperioden 1936—1940 16 % medan den under femårsperioden 1946—1950 utgjorde 24 %. För detaljförbruk— ' ningen har den årliga ökningen under de senaste tio åren utgjort genom- snittligt 12 % per år medan motsvarande ökning för den totala elkraftkon- sumtionen för högvärdiga ändamål under samma tid utgjorde genomsnitt- ligt 8 % per år. Beträffande den väntade konsumtionsutvecklingen hänvisas till kap. 4, bilderna 8 och 10. Av detaljförbrukningen hänför sig omkring 60 % till enbart städerna och 40 % till landsbygden inklusive dess tätorter. Om städer, köpingar och municipalsamhällen räknas till en grupp utgör de— taljförbrukningen där omkring 70 % av hela landets detaljförbrukning.

)

Förbrukningsintensitcten för detaljdistribuerad energi, uttryckt i kVVh/Nte, utgjorde år 1951 för städer och andra större tätorter i runt tal 300. Den varierar givetvis inom tämligen vida gränser, beroende på de skilda för- utsättningarna för elkraftens uttagning och användning, men avvikelserna från medelvärdet äro icke så stora som på landsbygden. Omkring 75 % av detaljkonsumenterna i städer och andra större tätorter hade en specifik förbrukning som låg mellan 250 och 400 kWh/Nte. Det lägre värdet re— presenterar ungefärligen ett normalhushåll utan elektrisk matlagning och det högre ett dylikt med elektrisk matlagning.

Den tekniska distributionsapparaten

Några för städerna och landsbygdens större tätorter karakteristiska för- hållanden, som ha inverkat på elkraftdistributionens tekniska utformning, ha berörts 1 kap. 1 (s. 67) och kap. 2 (s. 94). Härav framgår att exempelvis sådana problem som omläggningen från likströms— till växelströmsdistribu- tion samt nödvändigheten att i koncentrerad stadsbebyggelse använda kab- lar och komplicerade distributionsanläggningar i övrigt (t. ex. underjordiska transformatorstationer) kunnat och kunna medföra stora svårigheter och kostnader för stadsdistributionen men att denna dock, bl. a. på grund av den täta bebyggelsen och den höga belastningstätheten, överlag kunnat ord- nas på ett tekniskt-ekonomiskt fördelaktigt sätt.

Den till följd av bränslebristen ökade efterfrågan på elkraft under senaste världskriget och den samtidigt inträdande materialknappheten orsakade i många fall, att distributionsnäten i städerna liksom på landsbygden icke kunde utvidgas och förstärkas i önskad takt. Eftersläpningen i detta av— seende har emellertid därefter för städernas del i stort sett upphört, varför stadsdistributionen numera i tekniskt avseende får anses genom— gående fylla alla rimliga krav på överföringsförmåga och kraftkvalitet.

Stadsdistributionens organisation

Distributionen av elkraft kan på samma sätt som exempelvis distributio— nen av gas och vatten betraktas som en samhällelig uppgift. Denna synpunkt har för städernas del kommit till uttryck i distributionsföretagens organisa- tionsform. Av Sveriges 133 städer ha f. n. i runt tal 82 %, representerande 92 % av det totala invånarantalet, helt kommunägda distributionsföretag, som handha huvuddelen av all elektrisk distributionsverksamhet inom res— pektive stad. I 14 % av städerna med 5 % av det totala invånarantalet hand- has distributionen huvudsakligen av företag helt i enskild eller i statens ägo. I 2 % av städerna med 1 % av invånarantalet handhas distributionen huvud- sakligen av bolag, som äro till ungefär hälften i kommunal och till den övriga delen i enskild ägo. I resterande 2 % av städerna med 2 % av

invånarantalet finnes ett kommunägt men därutöver ett företag (i staden verksamt industriföretag), vardera med en betydande del av distributionen.

Den kommunala företagsformen är sålunda förhärskande i städer och den är vanlig även inom andra större tätorter. Distributionsverksamheten bedrives dock enligt affärsmässiga principer även i de fall, där den utövas såsom en samhällelig funktion. Kommunala elverk drivas sålunda —— stun- dom tillsammans med gasverksrörelse —— såsom en från kommunens verk- samhet i övrigt skild affärsrörelse under ledning av en särskild verksstyrelse, eventuellt drätselkammaren eller en teknisk avdelning inom denna.

I de fall, då icke kommunägda företag utöva stadsdistribution, har vanli- gen staden enligt avtal med distributionsföretaget stadgat olika förbehåll så- som att detaljtarifferna skola godkännas av stadsfullmäktige eller att sta- den äger utöva viss kontroll över verksamheten. Vidare har i regel staden dels betingat sig en årlig koncessionsavgift, dels förbehållit sig rätt att fram- deles, exempelvis vid avtalstidens utgång, själv överta detaljdistributionen i staden. Stundom innehar staden en betydande del av aktierna i vederbö- rande detaljdistributionsbolag. De kommunala intressena bli sålunda i stor utsträckning tillgodosedda även i dylika fall. Endast i enstaka fall torde i praktiken intressemotsättningar mellan distributionsbolaget och vederbö— rande stad eller samhälle ha förekommit. En närmare behandling av frågan om kommunernas inflytande på elkraftförsörjningen lämnas i kap. 12.

I fråga om företagens storlek gäller att stadsföretagen genomgående äro betydligt större än de återförsäljande distributionsföretagen på landsbygden i fråga om såväl antalet detaljförbrukare som energiomsättning. Det genom- snittliga antalet förbrukare hos stadsföretagen är drygt 8 000 medan för landsbygden över 90 % av samtliga distributionsföretag med ungefär hälf- ten av alla landsbygdsförbrukare ha ett förbrukarantal understigande 1 000.

Att en stad eller annan tätort har kommunalt elverk behöver icke betyda, att samtliga invånare erhålla kraft från detta. Bortsett från att industrier och andra större förbrukare ibland erhålla kraft direkt från något stor- kraftföretag, förekomma i åtskilliga städer vid sidan av stadselverket ett eller flera andra företag med detaljdistribution, vanligen dock inom någon mindre del av staden i anslutning till en industri eller i ett ytterområde, som ingår i något landsbygdsföretags distributionsområde. Detta behöver icke innebära att kraftförsörjningen är orationellt ordnad. Det kan tvärt— om utgöra den lämpligaste lösningen på distributionsproblemet, emedan de naturliga gränserna för ett distributionsområde mera sällan sammanfalla med kommungränserna. Att distributionen är uppdelad på flera företag kan emellertid i många fall också antagas bero på att frågan om distributions- verksamhetens organisation ännu ej blivit slutgiltigt löst, exempelvis i fråga om nyligen stadsplanelagda områden. (Se mera om denna fråga i kap. 12).

Gentemot stadsdistributionens organisation kunna i och för sig inga an- märkningar framföras.

& | ;

Stadsföretagens kraftanskafning och kraftavsättning. Tarifer och anslutningsvillkor

Av de i Svenska elverksföreningens statistik för driftåret 1951 redovisade 99 företagen med stadsdistribution ha 33 egna vattenkraftstationer och 41 egna värmekraftverk, de sistnämnda i allmänhet avsedda endast för reserv- eller toppkraftalstring. Det stora flertalet kommunala elverk inköper rå- kraft direkt från något storkraftföretag. Samtliga stadselverk ha anknyt- ning till riksnätet — ännu någon tid dock med undantag av Visby —— och deras kraftbehov kan anses vara tillgodosett i full utsträckning. Genom att stadsföretagens inköp avse relativt stora kraftbelopp blir medelkostnaden per kWh inköpt råkraft genomsnittligt lägre för stadsföretagen än för lands- bygdsföretagen.

I fråga om stadsföretagens kraftanskaffning bör också erinras om den på många håll pågående eller ifrågasatta utbyggnaden av värmekraftverk, an- ordnade för mottrycksdrift i kombination med värmedistribution. Det är icke osannolikt att denna art av kraftalstring kommer att få stor betydelse för städernas elkraftförsörjning. Som redan påpekats i kap. 6 finner elkraft- utredningen icke anledning att närmare ingå på de möjligheter, som yppa sig genom dylik drift, och de härmed sammanhängande speciella problemen.

Industrin är i stor utsträckning lokaliserad till städer och andra större tätorter och elverken där ha ofta en betydande kraftavsättning för indu— striella ändamål. Det är icke ovanligt, att större delen av den från ett stads— företag levererade energin avsättes till industrier och större hantverk i form av högspänd kraft. I flertalet städer med över 20 000 invånare avsatte under år 1951 vederbörande stadselverk mera än hälften av den totalt för- sålda energin till andra ändamål än detaljdistribution. Även om industri- leveranserna kunna ha stor betydelse för stadselverken, förekommer det dock icke sällan, att i städer belägna industriföretag själva producera sin kraft eller inköpa denna från annan leverantör än staden.

Förhållandena rörande såväl kraftanskaffning som kraftavsättning äro enligt elkraftutredningens bedömande för stadsföretagens del goda.

De inom städer och andra större tätorter tillämpade tarifferna för detalj— distribution av elkraft äro i allmänhet uppbyggda enligt moderna principer. Rörande tariffernas utveckling hänvisas till kap. 2. Att denna utveckling gått snabbare för städernas än för landsbygdens del torde till stor del kunna tillskrivas Svenska elverksföreningens insatser.

Den av elverksföreningen föreslagna huvudtariffen för städer och större samhällen avviker från normaltariffen i elkraftutredningens förslag till standardtariffer, framlagda i särskilt betänkande (SOU 1947: 4), såtillvida att den förra utgöres av ett polygontariffsystem bestående av en enkel ener- gitariff'oeh två grundavgiftstariffer, samtliga valfria, medan den senare är en enda grundavgiftstariff. I kommentarerna till elverksföreningens förslag

har såsom motiv härför anförts, att självkostnadsförhållandena vid distribu— tion inom städer och andra större tätorter vore sådana, att man vid sidan av den vanliga grundavgiftstariffen med ganska lågt energipris för abon- nenter med begränsat energibehov och begränsad energiuttagning kunde medge tillämpning i stället av en enkel energitariff eller en grundavgifts— tariff med lägre grundavgift och något högre energipris. Fullständiga poly— gontariffer eller polygontariffsystem hade Vidare varit i tillämpning inom ett mycket stort antal städer och andra tätorter under så lång tid, att ett generellt avståndstagande från denna praxis icke kunde anses lämpligt. Allteftersom den specifika förbrukningen stiger, kommer antalet abonnen- ter i polygontariffens första och andra avsnitt att successivt minska och efter en viss övergångstid kan man räkna med att samtliga abonnenter automatiskt blivit överförda till tariffens tredje avsnitt, vilket är identiskt med den av elkraftutredningen rekommenderade normaltariffen. Sett på längre sikt kan önskemålet om största möjliga enhetlighet på tariffområdet sägas vara fullt tillgodosett.

Sådana företag, som bedriva elkraftdistribution inom såväl en stad som på utanför staden liggande landsbygd, tillämpa ofta olika tariffer, inklusive anslutningsavgifter, inom och utom själva tätbebyggelsen (exempelvis det stadsplanelagda området). Av abonnenterna på den rena landsbygden ut- tages vanligen vid anslutningen till nätet en engångsavgift, avsedd att helt eller delvis täcka anläggningskostnaderna. Dylika anslutningsavgifter före- komma däremot sällan inom tätbebyggelsen. Om därtill de strömavgifter, som företaget tillämpar vid sin landsbygdsdistribution, äro högre än avgif- terna inom tätbebyggelsen, eller om företaget drives med avsevärd vinst, som endast kommer de inom stadens jurisdiktionsområde boende tillgodo, så är det förklarligt, att landsbygdsabonnenterna stundom anse sig miss- gynnade, även om deras priser ej äro högre än på landsbygden i allmänhet. Här möter alltså frågan, om det är berättigat, att ett företag med såväl stads— som landsbygdsdistribution uppdelar självkostnaderna på olika om- råden eller om en utjämning av priset bör ske mellan tätort och glesbygd. En del synpunkter på denna fråga, som av naturliga skäl är av större in- tresse för landsbygdens än städernas befolkning, skola framföras i samband med behandlingen av landsbygdens elkraftförsörjning i kap. 11 ävensom vid behandlingen av elkraftförsörjningens rationalisering i avd. II.

Stadsföretagens landsbygdsdistribution

Ett stort antal kommunala stadselverk bedriva detaljdistribution icke blott inom stadens eget område utan även i en eller flera angränsande lands- kommuner. Särskilt i Skåne är det vanligt, att städerna ha en betydande landsbygdsdistribution.

Enligt praxis får distributionsverksamhet anses falla under begreppet

| ! 1 i i

>konnnuns gemensamma hushålls- och ordningsangelägenheter», vilka kom- munen enligt gällande kommunallagar äger att själv vårda. Eftersom dylik verksamhet är förenad med affärsrisk, kan det från rent principiell syn- punkt möjligen ifrågasättas, om det ingår i en kommuns kompetens att ut- sträcka distributionen utanför kommunens gränser.

1946 års kommunallagskommitté, som fått i uppdrag att utreda bl. a. behovet av att utvidga den kommunala beslutanderätten, har i betänkande med förslag angående ändringar i kommunallagarnas bestämmelser om borgerlig primärkommuns kompetens och om kvalificerad majoritet (SOU 1947: 53) i fråga om kommunernas verksamhet uttalat bl. a. följande.

Vid sidan av dessa nu antydda generella regler böra vissa ytterligare begräns- ningar uppställas i fråga om kommunernas verksamhet. En given sådan ligger däri att de samhälleliga angelägenheter, som kunna bliva föremål för kommuns om- vårdnad, måste vara lokaliserade till kommunen. Detta innebär självfallet icke, att t. ex. ett företag eller en verksamhet, som kommun vill främja, nödvändigtvis måste bedrivas inom den egna kommunens gränser. Men det måste fordras, att det allmänna intresse som tillgodoses genom den kommunala åtgärden hänför sig till den egna kommunen. Hänför sig intresset till riket såsom sådant, såsom fallet t. ex. är med det militära försvaret, eller till en annan kommunal enhet, faller åt- gärden utanför kommunens kompetens.

Av detta uttalande av kommunallagskommittén vill det synas, som om en distributionsverksamhet utom kommunens egna gränser i princip borde falla utanför den kommunala beslutanderätten. Om t. ex. ett stadselverk bedriver landsbygdsdistribution, vilken i och för sig går med förlust, kan verksamheten anses strida mot stadens ekonomiska intressen och borde redan av denna anledning falla utanför stadens kompetens. Om å andra sidan landsbygdsdistributionen ger så stor vinst, att det skulle vara för- enat med vederbörande landskommuners intresse att själva övertaga verk- samheten, borde detta intresse ha företrädesrätt och staden alltså avstå från landsbygdsdistributionen.

Mot de här framförda synpunkterna kunna vägande praktiska skäl av sainhällsekonomisk räckvidd anföras. De naturliga gränserna för ett distri— butionsområde, som lämpligen bör tillhöra ett och samma distributions- företag, sammanfalla mera sällan med kommungränserna, vilket redan påpekats på s. 200. Erfarenheten visar också att mycket små företag av oli- ka skäl — tekniska, ekonomiska eller organisatoriska _ äro olämpliga som självständiga förvaltningsenheter. Då det bör vara ett samhällsintresse att de mera väsentliga förutsättningarna för distributionsföretagens verksam— het äro så gynnsamma som möjligt, synes kommunintresset böra få stå till- baka, i den mån det är oförenligt med det samhällsekonomiska.

För frågan om städernas landsbygdsdistribution innebär denna stånd- punkt, till vilken elkraftutredningen ansluter sig, att bestämmelserna om kommunernas kompetens icke böra anses utgöra hinder för ett kommunalt elverk att bedriva distribution även i andra kommuner, där särskilda skäl

föreligga. Därvid förutsättes, vilket ytterligare skall klargöras under den speciella behandlingen av kommunernas inflytande på elkraftförsörjningen, s. 270, att de utomstående kommunerna tillförsäkras behörigt inflytande på distributionsverksamheten.

Stadsföretagens »överskottspolitika

Stadsföretagens distributionsverksamhet ger i allmänhet synnerligen gott ekonomisk resultat. De kommunala elverkens avgifter synas i allmänhet vara så avvägda, att de ge ett överskott utöver elverkets kostnader. Detta överskott kan antingen komma stadens kassa direkt till godo, i det att ver— ket till staden inlevererar en årsvinst, vilken staden använder som bidrag till bestridande av sina övriga utgifter. Alternativt kan stadens olika del- förvaltningar och institutioner erhålla kraftleveranser från elverket, utan att verket av staden krediteras motsvarande ersättning. I båda fallen med— för överskottet en minskning av stadens skattebehov, i det förra fallet ge- nom att öka dess inkomster, i det senare fallet genom att minska dess ut- gifter. Slutligen kan elverkets överskott komma staden indirekt till godo, nämligen om det placeras i verket i form av medelst vinstmedel bekostade utvidgningar och nyanskaffningar, varigenom staden utan belastning av skatte- eller lånebudgeten erhåller en ökning av sina kapitaltillgångar.

Verkställda undersökningar samt tillgänglig statistik ha icke kunnat ge en klar bild av de kommunala elverkens verkliga driftöverskott, bl. a. beroen- de på att elverken ej ha enhetligt bokföringssystem och speciellt att avskriv- ningsmetoderna och redovisningen av investerade medel äro varierande. Det är dock uppenbart att de kommunala elverken i allmänhet utgöra en in- komstkälla, som kan ha avsevärd betydelse för kommunalskattens höjd. Överskottens relativa storlek, som under 1930—talet kunde vara bety- dande, ha emellertid under det senaste decenniet avsevärt reducerats. Särskilt gäller detta om man i kostnaderna medräknar avskrivningar på det för året gällande återanskaffningspriset, vilken avskrivningsmetod en- ligt vad som redan framhållits i kap. 4, s. 123,enligt elkraftutredningens upp- fattning är lämplig med hänsyn till en sund ekonomisk utveckling av distri- butionsverksamheten.

Varje tillägg på detaljdistributionspriset för elkraft inverkar hämmande på en ökad användning av kraften för de högvärdiga ändamål, som detalj- distributionen tillgodoser. Mot denna bakgrund ter sig elverkens överskotts- politik, i den mån verkliga överskott föreligga, olämplig ur kraftförsörj- ningssynpunkt. Det må dock å andra sidan också framhållas att den belast- ningsökning, som en sänkning av kraftpriset medför, i de flesta fall nöd- vändiggör förstärkningar och utvidgningar av distributionsanläggningarna, vilka arbeten under tider med brist på materiel och arbetskraft kunna vara omöjliga att genomföra.

På grund av den starka monopolställning, som tillkommer elverken i städer och andra större tätorter, äro dessa sålunda i stånd att vid detalj- distributionen uttaga vinster, vilka i praktiken kunna framträda som en indirekt beskattning och i viss mån verka hämmande på en ökad använd- ning av elkraft. Med hänsyn till de i praktiken minskande vinstandelarna finner elkraftutredningen emellertid icke anledning att föreslå några sär- skilda åtgärder häremot i detta sammanhang. Utredningen återkommer dock till härmed sammanhängande spörsmål i kap. 12 vid behandlingen av frågorna om kommunernas inflytande på elkraftförsörjningen (s. 270) och om prisregleringsinstitutet (s. 276).

Kap. 11. Landsbygdens elkraftförsörjning

I den speciella redogörelse för landsbygdens elkraftförsörjning, (redogö- relse nr 3, SOU 1953: 13), som framlades våren 1953, har elkraftutredningen sammanfattat de huvudsakliga resultaten av sina undersökningar på detta område. Nämnda redogörelse kommer därför till väsentliga delar att ut- göra grunden för den följande framställningen. Ifråga om olika bedöman- den nöjer sig utredningen med att hänvisa till redogörelse nr 3. Härutöver vill elkraftutredningen framhålla de speciella skrivelser, berörande förhål— landena inom landsbygdens elkraftförsörjning med förslag till provisoriska statliga åtgärder för stöd av en allmän upprustning av distributionsnäten, som utredningen avlämnat till Chefen för kommunikationsdepartementet den 27 november 1950 och till Kungl. Maj:t den 26 januari 1953. Väsent- liga delar av den sistnämnda skrivelsen komma att refereras i det följande. Elkraftutredningen vill slutligen i detta sammanhang erinra om följande tre, av utredningen tidigare framlagda handlingar, nämligen Redogörelse för detaljdistributörerna samt deras råkraftkostnader och priser vid distribu— tion av elektrisk kraft (redogörelse nr 1, SOU 1947: 3), Betänkande med förslag till standardtariffer för detaljdistribution av elektrisk kraft (SOU 1947: 4) samt Landsbygdselektrifieringens utbredning år 1950 (SOU 1951: 14).

Som redan påpekats i samband med behandlingen av städernas elkraft— försörjning (s. 198) äro vissa problem på ifrågavarande område gemen- samma för städer och landsbygd även om man såväl i detta betänkande som i tidigare sammanhang behandlar dem såsom stads— respektive lands- bygdsproblem beroende på var de främst anses höra hemma. Särskilt landsbygdens tätorter intaga en mellanställning. För dessa kunna i olika avseenden och i olika utsträckning gälla synpunkterna på såväl städernas som den egentliga landsbygdens elkraftförsörjning.

Förefintliga brister och svagheter inom landsbygdens elkraftförsörjning ha huvudsakligen samband med distributionen och det är därför i första hand distributionsföretagens problem, som i detta sammanhang skola skär- skådas.

Vid elkraftutredningens undersökningar angående eldistributionen på landsbygden har det visat sig, att de olika distributionsföretagen arbeta un- der mycket skiftande ekonomiska, tekniska och organisatoriska förhållan- den, vilka delvis äro en följd av den historiska utvecklingen. Landsbygds— elektrifieringen har, som framgår av översikten i kap. 2, i sin utveckling följt en våglinje, som har sina toppar i tider av bristhushållning i samband med två världskrig och sin vågdal i mellanliggande depressionstid. Elektri-

fieringsarbetet har sålunda varit mest omfattande under dyrtider med sam- tidig brist på fullgod materiel. Forceringen och knappheten på kvalificerad arbetskraft har på många håll resulterat i en bristfällig planläggning och även påverkat arbetets kvalitet. Allt detta har haft till följd att särskilt de under första världskriget utförda elektrifieringsarbetena ofta blivit tekniskt undermåliga och fått ett försämrat ekonomiskt utgångsläge. Under senare år har den ytterst snabba utvecklingen ifråga om elkraftens användning, icke minst på landsbygden, ställt anspråk på en motsvarande utveckling av distributionsapparaten, vilka anspråk distributionsföretagen i mycket stor utsträckning dock icke varit mäktiga att fylla.

För att få en uppfattning om i vilka avseenden bristfälligheter inom landsbygdens elkraftförsörjning förekomma, synes det lämpligt att söka belysa hithörande frågor från skilda synpunkter. Till närmare granskning skola därför upptagas vissa landsbygdsdistributionen berörande förhållan- den av teknisk, ekonomisk och organisatorisk natur, som kunna inverka begränsande eller hindrande för en rationell lösning av kraftförsörjnings— frågan. Dessförinnan skall emellertid som en lämplig bakgrund i korthet beröras en del problem av mera allmän karaktär.

Några allmänna landsbygdsproblem

Med hänsyn till sitt uppdrag har elkraftutredningen ansett det angeläget att sammanställa en kortfattad översikt av vad som nu anses vara lands- bygdens huvudproblem, särskilt i den mån dessa ha eller kunna väntas få samband med elkraftförsörjningen.

Det är av intresse att gå något tillbaka i tiden. Förhållandet mellan stad och landsbygd har spelat en stor roll i den ekonomiska och sociala utveck— lingen. Ända intill tiden för det industriella genombrottet mot mitten av _" 1800-talet kan man för vårt land säga, att relationerna mellan städerna och

landsbygden karakteriserades av samma drag som i äldre tid. Förutsätt— . ningen för den industriella utvecklingen var då bl. a. möjligheten till en

tämligen samlad produktion, där kraftkällan för den maskinella driften, ångan eller den direkta vattenkraften, kunde utnyttjas i relativt stora, fasta enheter i kontinuerlig drift. För att tillgodose detta följde med den växande industrin ökad tätortsbildning samt tätorternas starka tillväxt. Glesbygden med dess till jordens avkastning bundna produktion och spridda bebyggelse hade ringa förutsättningar att utnyttja en motsvarande mekanisering för jordbruket och ej heller för en differentierad industriell produktion. Av nämnda orsaker har bl. a. lönenivån inom t. ex. de industriella och kom- mersiella tät'ortsyrkena stigit snabbare än i jordbruket, som först senare fått möjlighet att ekonomiskt utnyttja maskiner (genom förbränningsmoto- rer och elkraft). I samband härmed har utvecklingen under de senaste 75—100 åren karakteriserats av en nära nog oavbruten om än till stor-

leken växlande flyttning från landsbygdens främsta näring, jordbruket, till de nya stadsmannanäringarna i tätorter.

Man bör emellertid ha i minnet, att det som hårdast pressat jordbruket under industrialismens tidigare skeden icke har varit de anspråk på arbets— kraft och kapital, som kommit från industrin. Den stora jordbrukskrisen på 1880-talet berodde på konkurrens från det transoceana jordbruket och från den ryska produktionen. Den nya och än allvarligare jordbrukskrisen genom prisfallet kring 1930-talet berodde på konkurrens från jordbruket i vissa stora produktionsländer med större förutsättningar bl. a. genom jordbrukets mekanisering. Härtill kom ett starkt försvårat handelsutbyte.

För hundra år sedan var den totala befolkningen i Sverige 3,5 milj. Av dessa bodde ca 90 :% på landsbygden. Ca 80 % tillhörde yrkesgruppen jord— bruk med binäringar (egentlig landsbygd). Huvudparten av befolkningen bodde m. a. o. i en relativt gles bygd i nära anslutning till den odlade jor- den. Endast 10 % funnos i städer och ungefär lika många i rikets då inre— gistrerade 29 köpingar eller i brukssamhällena.

Femtio år senare, vid sekelskiftet 1900, var bilden i många avseenden en annan. Industrialismens genombrott, näringsfrihetens genomförande och järnvägarnas tillkomst hade förändrat samhällets struktur. Detta gällde icke minst för landsbygdens del. Av landsbygdens stora födelseöverskott, över 2 milj. under perioden 1850—1900, har man beräknat att emigrationen tog 0,9 milj., landsbygdssamhällena (landsbygdens tätorter) ungefär lika mycket och städerna återstående 0,5 milj. Befolkningstillskottet på lands- bygden kunde icke få sin utkomst vid jordbruket. Den agglomerade lands- bygden, tätorterna som representerade mellanformen mellan städer och . egentlig landsbygd, utvecklades. Vad stadsnäringar m. fl. då icke mäktade taga emot gick till andra länder.

Under femtioårsperioden 1900—1950 har yrkesgruppen jordbruk med binäringar fortsatt att lämna folk till städerna och den tätortsbetonade landsbygden. Ju längre denna folkvandring pågått och jordbruksbefolk- ningens födelseöverskott minskat desto mer ha vissa följdverkningar fram- trätt. Så sent som under 1930-talet kunde de tätortsbetonade näringarna industri, handel, samfärdsel och allmän tjänst öka utan någon större och till sina verkningar i olika avseenden mera påtagbar befolkningsminskning inom jordbruket. Ett annat blev förhållandet efter omkring 1940.

Därest icke en stark och hittills oförutsedd ändring av vårt näringslivs struktur skulle inträffa, anses minskningen av den direkt jordbrukande befolkningen ännu komma att fortsätta om än med olika styrka i olika delar av landet. Man har räknat med att omflyttningen av arbetskraft mellan olika näringsgrenar så småningom leder till åtminstone ett någor- lunda jämviktsläge. Måhända kan antagas, att ett sådant läge inträder om ytterligare tjugo år med en jordbruksbefolkning av en knapp femtedel mot nuvarande ca en fjärdedel av totala befolkningen.

Orsakerna till denna folkflyttning har tidigare berörts något. Här skall några ytterligare synpunkter återgivas i detta sammanhang.

Ökningen av de enskilda fastigheternas åkerareal har inneburit en viss — ehuru ganska obetydlig —— minskning av jordbrukets företagarantal och därmed en reducering av antalet brukningsdelar inom jordbruket. Kanske än mera avgörande för det minskade arbetskraftsbehovet har varit den för jordbrukets del pågående driftsmekaniseringen. De förbättrade tekniska anordningarna både i den direkta produktionen och i hem och hushåll ha friställt många armar. Industrin själv har härvid övertagit många led i en äldre jordbruksproduktion. Givetvis måste det också ur allas synpunkt vara önskvärt, att jordbruket under tillfredsställande produktionsförutsätt- ningar inte binder onödig arbetskraft. Lönekonkurrensen från andra nä— ringar och tron på förbättrad levnadsmiljö inom tätorterna synes dock ha föranlett en för kraftig avflyttning från jordbruket. Man måste ha i minnet att Vår begränsade befolkningstillväxt i förhållande till främst industrins expansion och speciella krav på lokalisering i viss mån framtvingat denna för vårt land särskilt framträdande typ av konkurrens om arbetskraften.

De problem, som folkavflyttningen kan medföra för vissa jordbruks- och skogsbygder, äro ofta svårbemästrade. Genom befolkningsuttunningen kun- na utpräglade glesbygder uppstå, där en fortsatt avflyttning berör främst de yngre åldersklasserna och av dem mest kvinnorna. Kostnaderna för att förse befolkningen med den gemensamma service, som livet numera fordrar, bli i regel där relativt höga och denna förbättrade standard därför svår att åstadkomma. I vissa trakter har man redan nått eller när kanske snart den gräns, där befolkningsuttunningen med dessa följder medför att byg- den kan ha svårt att bestå. Minskad jordbruksbefolkning inom en bygd behöver dock ej medföra en dylik tillbakagång. Inom våra bättre utvecklade jordbruksbygder t. ex. har visserligen befolkningen minskat men ålders- klass- och könsfördelningen kunnat bibehållas någorlunda tillfredsställande.

Här i korthet antydda problem ha visat sig bli alltmera aktuella och där- » för kräva ökad uppmärksamhet. Våra dagars centrala jordbruks— och lands- - bygdsproblem synas invecklade. Jordbruksrationalisering i ordets egentliga , bemärkelse är önskvärd, men dess följder, när stark folkuttunning följer i en bygd, kräva motåtgärder. Det har därvid bl. a. talats om att man mera än hittills skulle söka länka utvecklingen in i sådana banor, att en från jordbruket (och skogsbruket) flyttande befolkning kunde bli varaktigt bo- satt i bygden, t. ex. i mindre tätorter eller bebyggelseområden med god funk— tion i förhållande till kringliggande bygd. Dessa tätorter skulle då samverka med de egentliga jordbruksbygderna och erbjuda möjligheter till hantverk och småindustri samt servicetjänster av olika slag för bygdens lokala behov. Härigenom skulle en landsbygd kunna erbjuda tillfällen till större yrkes- differentiering liksom över huvud taget till ett kulturellt och materiellt rikare liv än vad nu stundom kan vara fallet. I detta sammanhang talas

även om de mera utpräglade skogsbygderna och att fall kunna finnas, när även en befolkning skulle kunna samlas till en lämpligt belägen centralort eller tätbebyggelse — som helst även skulle inrymma annan bebyggelse än skogsarbetarnas —— och därigenom få del av förbättrade förhållanden i olika avseenden. Exempel finnas även, där större arbetskraftssökande industri- företag kunnat lägga delar av sin produktion inom en bygd, där yrkes— gruppen jordbruk med binäringar varit starkt förhärskande.

Man torde vara ense om vikten för landsbygden och dess jordbruksbygder av ökade gemensamma realkapitalanläggningar av olika slag. Tidigare har nämnts betydelsen av jordbrukets mekanisering. Härtill bör erinras om för— delen av goda trafikförbindelser för transporter av olika slag, tillgång till tillfredsställande vatten och avlopp, god elkraft, telefon med för landsbyg- den avpassade taxeområden, goda byggnader med mekaniserade ekonomi- avdelningar för matlagning och tvätt samt gårdsdriften i övrigt ävensom erforderlig markplanering för en effektiv byggnadspolitik och annan hit- hörande verksamhet genom de nya storkommunerna. Härigenom blir grun- den lagd för en god, mångsidig utveckling av en landsbygd. Detta gäller så- väl dess jordbruk som andra näringar såsom hantverk, småindustri och di— verse serviceyrken. Det kan i detta sammanhang förtjäna erinras om att jordbrukets produktion har kunnat öka i sådan omfattning att, medan det i för femtio år sedan endast nödtorftigt tillgodosåg vårt behov, räcker det nu trots en starkt minskad jordbruksbefolkning för en med ca 2 milj. ökad

| i

folkmängd.

Man kan nog säga, att det år elkraften, som i mycket skall kunna ge förut- sättningarna för utvecklingen i många, delvis förändrade avseenden. Tidi- gare omnämndes det industriella genombrottet kring mitten av 1800-talet och hur ångan som kraftkälla ledde till utvecklingen av tätorter och sam- : tidig utflyttning från jordbruksbygderna. För glesbygden kunde icke denna 4 kraftkälla utnyttjas. Helt andra blevo förutsättningarna genom elkraftens : införande. Elkraft kan levereras till snart sagt de minsta enheter till förhål- : landevis lågt pris. Genom den ökande utnyttjningen av elkraft för allt flera ; ändamål skapas dessutom allt bättre förutsättningar för en rationell och å ekonomisk elkraftanvändning även inom landsbygdens spridda bebyggelse. De med landsbygdens näringsliv förbundna speciella problemen fordra emellertid vederbörligt beaktande.

Frågan om landsbygdens elkraftförsörjning framstår som en faktor av * mycket stor betydelse.

Landsbygdsdistributionens omfattning

Elektrifieringsgraden (dvs. det procentuella antalet bostadshushåll, som har tillgång till elektricitet för åtminstone belysning) var år 1950 för den egentliga landsbygden 93 % och för hela landsbygden, dvs. all bebyggelse

utom städer, 96 %. För hela riket (städer och landsbygd) var elektrifierings- graden samma år 97 a 98 %. Ovannämnda siffror äro hämtade ur elkraft- utredningens redogörelse för landsbygdselektrifieringens utbredning år 1950. Det under de senaste årtiondena pågående elektrifieringsarbetet hade år 1950 lett därhän, att endast 46 500 av de omkring 700 000 bostadslägen- heterna på egentliga landsbygden ännu voro oelektrifierade. Av dessa oelek- trifierade lägenheter föllo på Norrland exklusive Gästrikland 8 500, på södra och mellersta Sveriges, inklusive Gästrikland, skogs- och dalbygder 22 000 samt på södra och mellersta Sveriges slättbygder 16 000. Beaktar man det elektrifieringsarbete, som utförts sedan ovannämnda tidpunkt, kan antalet oelektrifierade hushåll på den egentliga landsbygden vid slutet av år 1953 uppskattas till i runt tal 30000. Elektrifieringsgraden var sålunda vid denna tidpunkt ungefärligen 96 % för den egentliga landsbygden. För hela landsbygden torde den ha stigit till omkring 97 % och för hela riket till omkring 98,5 %.

Den återstående elektrifieringen är naturligt nog den, som är besvärligast att utföra och drar de högsta specifika kostnaderna. Man torde kunna räkna med att vårt land inom något tiotal år kan anses vara elektrifierat så långt detta är praktiskt möjligt, varvid bortses från sådana områden med mycket gles bosättning, där en elektrifiering icke kan tänkas komma till stånd med rimliga kostnader. Antalet inom dylika områden belägna hushåll kan upp- skattas till sammanlagt ett eller annat tiotusental, dvs. 1 å 2 % av det totala antalet hushåll på landsbygden.

Det må emellertid redan nu påpekas —— elkraftutredningen återkommer härtill längre fram i denna redogörelse att en väsentlig del av de på landsbygden belägna elektrifierade hushållen endast äro vad man kallar belysningselektrifierade, dvs. överföringsanläggningarna äro så knappt di- mensionerade, att de i huvudsak möjliggöra enbart elektrisk belysning.

Trots att sålunda landsbygdens extensiva elektrifiering nått långt är det blott en förhållandevis liten del av landets totala elkraftkonsumtion, som 3 faller på landsbygden. I samband med redogörelsen för städernas elkraft— ; försörjning har redan framhållits, att av den detaljdistribuerade elkraften, ., vilken är 1952 utgjorde 28 % av den totala för högvärdiga ändamål nyttig- . gjorda elkraften, omkring 40 % faller på landsbygden, inklusive landsbyg- _ dens tätorter. Frånräknas köpingar och municipalsamhällen utgör lands- *» bygdens andel endast omkring 30 %, dvs. omkring 8 % av den totala kon- * sumtionen. Förbrukningsintensiteten för detaljdistribuerad energi på lands- ) bygden varierar inom mycket vida gränser. För mera välelektrifierade om- ! råden låg den år 1951 ungefärligen vid 200 å 300 kWh/Nte medan den för mindre välelektrifierade områden ofta understeg 50 kWh/Nte.

En uppfattning om den totala detaljförbrukningens och dess olika under- gruppers tillväxt och nuvarande storlek samt om den väntade utvecklingen kan erhållas av bilderna 3, 8 och 10.

Den tekniska distributionsapparaten I stor utsträckning omhänderhar en råkraftleverantör kraftöverföringen fram till eller till och med bygdetransformatorn, under det att ett medel- stort eller mindre detaljdistributionsföretag svarar för distributionen över ortsnätet med tillhörande lågspänningsnät. I en del bygder har elektrifie- ringen lösts genom att råkraftleverantören dragit fram överföringsledningar , till varje enskild ortstransformator. Distributionsföretag (transformator- , lag), som därigenom befriats från kostnader för högspänningsnät, äro ge- i nomgående mycket små. På andra håll omhänderhar det råkraftdistribue— | rande företaget även detaljdistributionen fram till konsumenterna. Erfaren- j heterna säga att missförhållanden, grundade på otillfredsställande tekniska | betingelser inom distributionsapparaten, främst äro att finna inom områ- |

|

den, som försörjas med elkraft över små eller medelstora detaljdistributions- företag, varmed dock icke är sagt att missförhållanden icke förekomma även på andra håll. Dessa erfarenheter ha bekräftats genom elkraftutredningens undersökningar.

Den analys av landsbygdsnätens tillstånd, som gjorts i elkraftutredningens redogörelse nr 3 (s. 10—14 samt 80—88), är fortfarande fullt aktuell. Sammanfattningsvis kan sålunda sägas att landsbygdsföretagens anlägg- ningar ofta icke äro i tillfredsställande skick sett från drifts- och säker- , hetssynpunkt och att nätens överföringsförmåga måste bedömas som i stor utsträckning otillräcklig. Näten äro till stora delar sådana, att de, om icke betydande förbättringar snart åstadkommas, icke på ett nöj aktigt sätt kunna tillgodose de ökade behov, som kunna förväntas under den närmaste tiden. Särskilt näten-tillhörande små distributionsföretag äro otillräckliga. Som en av orsakerna till de rådande förhållandena inom landsbygdsnäten har an— givits den brist på materiel och arbetskraft, som förelegat under en lång följd av år, och de under de senare åren starkt ökande materiel- och arbets- kostnaderna. Även företag, som ha god vilja att förbättra sina anläggningar, . kunna genom materiel- och kapitalsvårigheter bli hindrade härifrån. '

Den betygssättning av detaljdistributionen i avseende på driftsäkerhet och » nätens belastningsbarhet, som överinspektörerna i statens elektriska inspek- 3 tion gjort inom sina områden på elkraftutredningens begäran —— redovisad i redogörelse nr 3 är visserligen icke fullt jämförbar inbördes men ger dock möjlighet till det ungefärliga sammanfattande omdöme, som nedan- stående tabell 3 visar. Bedömningen avser förhållandena i början av 1950- talet.

1 elkraftutredningens nyssnämnda skrivelse den 26 januari 1953 med förslag till statliga stödåtgärder för landsbygdsdistributionens upprustning har upprustningskostnaden för detaljdistributionsnäten, hänförd till då rå— dande förhållanden, beräknats till i runt tal 400 milj. kronor. Det har där- vid förutsatts en allmän standard på anläggningarna efter arbetenas utfö- rande motsvarande ungefär den standard, som nu råder inom exempelvis

Tabell 3. Sammanfattande omdöme av det tekniska till- ståndet år 1950 av landsbygdens detaljdistributionsnät. (Enligt uppgifter från överinspektörerna i statens elekt- riska inspektion)

Ur drifts— och så—

Med hänsyn till

. överföringsförmå- kerhetssynpunkt, lgan, i % av totala % av totala anlagg- anliig nings-

ningsbeståndct ' % bcstandet

Mycket bra ............ Bra ...................... 45 35 Dåligt ................... 40 45 Mycket dåligt ......... 10 15

Summa 100 100

vattenfallsverkets egen detaljdistribution. Nämnda kostnadssiffra utgjorde självfallet en grov uppskattning. Genom arbetenas utsträckning över en för- hållandevis lång tidsperiod borde man räkna med att högst avsevärda av? vikelser från den angivna totalkostnaden kunde uppstå. Enligt elkraft- utredningens uppfattning ha sedan januari 1953 icke så stora ändringar i " berörda förhållanden inträtt, att de motivera en justering av den gjorda uppskattningen.

Landsbygdsnätens standardisering

», Undersökningarna rörande distributionsapparatens tekniska tillstånd ha * klart visat, att distributionsnäten hos ett stort antal landsbygdsföretag för närvarande icke äro i sådant skick, att de kunna tillgodose de ökade behov, som kunna förväntas under de närmaste åren. Ett intensifierat upprust- nings- och rationaliseringsarhete genom förnyelse, omläggning och förstärk- ning av landsbygdsnäten med bl. a. erforderlig höjning av distributions- spänningen till lämplig standardspänning är sålunda ett önskemål, som el- , kraftutredningen vill starkt understryka.

Genom att landsbygdselektrifieringens tillkomst och utbredning i allmän— het berott av lokala initiativ och sålunda skett områdesvis vid skilda tid- punkter och under mycket växlande betingelser, ofta under stark tids- press. har självfallet den planmässighet saknats, som måste förutsättas för en väl genomförd standardisering av den elektriska materielen. Till större delen ha elektrifieringsarbetena dessutom utförts under en tidsperiod av intensiv teknisk utveckling, då standardiseringstanken icke var så stark som nu och standardiseringen på närliggande områden ej heller hunnit så långt som nu. Det är uppenbart att det hade varit fördelaktigtur fabrikations-, anläggnings- och driftsynpunkt om en längre gående standardisering av

spänningar, apparatstorlekar och apparatutförande hade kunnat genomfö- ras icke blott inom de olika kraftföretagen var för sig, vilket i stor ut- sträckning så småningom skett, utan även mellan de olika företagen. Före— kommande olikheter i exempelvis spänningssystemen ha emellertid medfört praktiska svårigheter att få till stånd ett mera genomgripande förenhetli— gande.

Enligt givna direktiv ingår i elkraftutredningens uppdrag även att un- dersöka de elektriska system- och standardiseringsfrågorna. Dessa frågor ha upptagits till behandling av den på elkraftutredningens initiativ tillkom- na samarbetskommittén för landsbygdsnätens standardisering. Genom den— na kommittés försorg ha hittills utarbetats normer för ortstransformatorer, varigenom viktiga data och utförande av dessa i distributionsnäten ingåen- de betydelsefulla anläggningsdelar standardiserats. Dessutom har framlagts förslag till standard för såväl ortstransformatorstationer som linjemateriel för ortsnät och lågspänningsnät. Kommittén utarbetar f. 11. en handbok, som förutom rekommendationer beträffande materiel och konstruktioner skall innehålla tekniska råd och anvisningar rörande nyelektrifierings- och förstärkningsarbeten inom landsbygdsnäten. Förutsättningarna för en ra- tionalisering och ett ökat förenhetligande inom den tekniska delen av lands— bygdsdistributionen och därigenom för ett nedbringande av de totala, fram- tida anläggningskostnaderna torde härigenom icke oväsentligt förbättras.

Landsbygdsdistributionens och distributionsföretagens organisation

I kap. 2 har lämnats en tämligen ingående redogörelse för den hittills- varande utvecklingen av bl. a. landsbygdens elkraftförsörjning, och de där- med sammanhängande organisatoriska förhållandena. Det framgår av den- na redogörelse, att de organisatoriska och ekonomiska frågorna för lands- bygdselektrifieringen redan från början blevo problem av stor betydelse och räckvidd. Den första elektrifieringen fick på många håll karaktären av »skumelektrifiering», varvid distributionsnäten utformades och dimen- sionerades endast för de aktuella behoven inom små områden med något så när tät bebyggelse. Sålunda tillkommo en mängd små och inbördes utspridda distributionsföretag, vilka ofta saknade förutsättningar för elekt- rifieringens utvidgning till mellanliggande områden. På många håll bildades småföretag genom att ett begränsat antal abonnenter fingo utnyttja den produktion av elkraft som kunnat ordnas vid en kvarnrörelse eller annat mindre industriföretag, som redan på ett tidigt stadium för sitt kraftbehov utnyttjat ett närbeläget mindre vattenfall. Inom några större råkraftföre- tags' områden organiserades landsbygdsdistribution i större skala genom bildande av elektriska distributionsföreningar. Även dessa omfattade till en början endast de tätast bebyggda delarna av landsbygden. Medan i städer

och köpingar distributionen i flertalet fall omhändertogs av kommunala elverk befattade sig kommunerna på den egentliga landsbygden endast undantagsvis direkt med kraftdistributionen. Allt detta har lett till en för- hållandevis stor organisatorisk splittring och oenhetlighet inom denna del av vår kraftförsörjning, där sålunda företag av ett flertal olika organisa- tionsformer och mycket varierande storlek svara för kraftens slutliga distri- bution fram till konsumenterna.

Elkraftutredningens undersökningar rörande organisatoriska förhållan— den inom detaljdistributionen ha utförligt behandlats i förutnämnda re- dogörelse nr 3 (s. 15——20, 89——93). Sammanfattningsvis framgår därav ) att 58 % av alla landsbygdsföretag år 1950 utgjordes av föreningar. Det procentuella antalet förbrukare på landsbygden, som erhöll kraft genom !

1 l l l

föreningar, var 33 %. Endast 9 % av företagen voro aktiebolag men des— sa hade hand om icke mindre än 36 % av antalet landsbygdsförbrukare. Bolagen voro sålunda genomsnittligt väsentligt större än föreningarna. Fö— retagstyperna industri respektive enskild person utgjorde vardera 13 % av antalet företag men hade hand om 16 respektive 3 % av antalet förbrukare. Statliga, kommunala och speciella företag redovisades tillsammans som , 7 % av antalet företag, omfattande 12 % av antalet förbrukare.

I fråga om företagstypernas lokala fördelning framgår det, att förening- arna år 1950 bildade den till antalet största företagsgruppen i samtliga län utom Jönköpings, Kronobergs, Kalmar, Gotlands, Blekinge och Gävle- borgs län. Det har visat sig att föreningsdriften är förhållandevis vanlig inom län, där förekomsten av mindre, lokala kraftkällor är ringa eller där ' större kraftföretag på ett relativt tidigt stadium byggt överföringsnät för ' försäljning av råkraft. På platser med små, lätt utbyggbara fall omhänder- has kraftförsörjningen i stor utsträckning, såsom en följd av den lokala vattenkraftens tidiga användning för kvarnar, sågar och andra smärre industrier, av företag av typen industri och enskild person. ' Beträffande landsbygdsföretagens fördelning på olika storleksgrupper , framgår vidare av redogörelse nr 3 att av de år 1950 existerande ca 2 750 » landsbygdsföretagen hade ca 2 330 eller 84 % ett förbrukareantal understi— gande 500 per företag. Av landsbygdens totalt 894 100 förbrukare erhöllo 284 300 eller 32 % elkraft från företag med mindre än 500 förbrukare per företag. Ungefär hälften av alla landsbygdsförbrukare erhöll kraft från företag med mindre än 1 000 förbrukare vardera.

I redogörelsen belyses även utvecklingen under senare hälften av 1940-

! talet. Det framgår därav, att distributionsföreningarnas andel av den totala ' detaljdistributionen under nämnda tidsperiod minskat och att samtidigt därmed antalet småföretag minskat. Detaljdistributionens handhavande har rönt en märkbar förskjutning mot större företag, vanligen av aktiebolags- typ. Den statliga detaljdistributionen har ökat från att omfatta 2,3 % av landsbygdsförbrukarna år 1944 till 5 ,o är 1950 (7 % år 1952). Dessa

förhållanden sammanhänga med att råkraftföretagen i tämligen stor ut- sträckning övertagit små återförsäljande företag, ofta föreningar. Företrä— desvis har detta skett när småföretagen haft svårigheter att vidmakthålla tillfredsställande distributionsförhållanden. Råkraftföretagen ha därigenom utökat sin från början i vissa fall tämligen obetydliga detaljdistribution. Sammanslagningar sinsemellan av angränsande små och mindre bärkraf- tiga företag ha däremot icke skett i någon större omfattning dels tydligen beroende på att det under nuvarande förhållanden icke finnes något lämp— ligt organ, som kan tänkas ta initiativet till och genomföra eller genomdriva dylika rationaliseringar, dels förmodligen också beroende på ett växande intresse från råkraftleverantörens sida att själv ta hand om detaljdistribu— tionen.

Även om man bortser från lantgårdar, industrier o. d., som bedriva distri- bution huvudsakligen i syfte att förse anställda med elkraft, finnas otvivel— aktigt en mängd distributionsföretag, där antalet förbrukare är så lågt att en rationell drift knappast är tänkbar. Konsumentstockens sammansättning kan vidare ha stor betydelse för distributionsverksamhetens utveckling. Den av jordbrukets elinventering gjorda undersökningen, som också refe— reras i redogörelsen nr 3, utvisar, att användningen av elkraft inom det rena jordbruket ännu är mycket begränsad. I städer och andra tätorter utgör avsättningen till industrier, hantverk, affärer o. d. en betydelsefull faktor, som verkar utjämnande på kraftuttagningen, medan jordbruksdistrikten visa lägre utnyttjning av den relativt höga elektriska effekt, som måste ställas till jordbrukets förfogande. Den ensidiga sammansättningen av kon- sumentstocken hos ett distributionsföretag inom ren jordbruksbygd ger så- lunda ej samma möjligheter för företaget att utnyttja abonnerad effekt som inom städerna.

De system för landsbygdselektrifiering, som följts i vårt land, ha som förut anförts haft till följd en betydande splittring av detaljdistributionen i många och ofta mycket små enheter. Genom den av omständigheterna framtvingade utvecklingen under senare åren pågår en förskjutning mot storföretagsdrift. Nämnda utveckling går emellertid förhållandevis lång- samt, enär sanering på denna väg vanligen icke sker annat än i fall med extremt undermålig distribution. Det kan också ifrågasättas om en oregle— rad och eventuellt intensifierad utveckling av detta slag är önskvärd.

Beträffande de inom landsbygdsdistributionen förekommande olika orga— nisationsformerna må följande tilläggas.

Den kooperativa organisationsformen kan sägas vara den normala över- allt, där den lokala distributionen ordnats genom ett för ändamålet särskilt bildat företag. Den grundläggande principen för flertalet kooperativa distri- butionsföretag är numera, vilket framgår av kap. 2, att varje konsument skall ingå i företaget med ett antal andelar motsvarande >>omfattningen av och ändamålet med den av medlem ägda eller brukade fastigheten eller dess

elektriska anläggning» och som kapital insätta häremot svarande del av anläggningskostnaden. Som regel äro också samtliga stadigvarande förbru- kare inom en andelsförenings område tillika medlemmar i föreningen. Det är dock ej ovanligt, att medlemskretsen gjorts sluten och att nytillträdande förbrukare i motsats till medlemmarna benämnda abonnenter —— icke åtnjuta samma förmåner i form av rätt till vinstutdelning eller låga taxor som medlemmarna. Den ekonomiska föreningen såsom organisationsform lägger sålunda icke något verkligt hinder i vägen för det enskilda vinst- intressets tillgodoseende och för att förbrukare uteslutas från möjligheten att utöva inflytande på företagets skötsel.

Att den ekonomiska föreningen blivit i viss mån dominerande som admi- nistrationsform beror delvis på, att vattenfallsstyrelsen och även enskilda storkraftleverantörer i stor utsträckning, åtminstone tidigare, understött detta system med lokala företag av kooperativ natur. Man ville få bygdens män aktivt intresserade i såväl tillkomsten som förvaltningen av detalj— distributionen, man ville utnyttja den inom andra områden, t. ex. mejeri- föreningsrörelsen, vunna erfarenheten, man ville försäkra sig om bygdens ekonomiska medverkan till uppbyggandet av distributionsapparaten osv., allt i avsikt att hålla distributionskostnaderna nere vid lägsta möjliga nivå.

Att detta rent svenska system med lokala företag ledda av tekniskt osko- lade förtroendemän utfallit så väl som det på många håll obestridligen gjort, beror på flera samverkande omständigheter, främst därpå att man samman- fört de för uppgiften intresserade lokala krafterna med kraftverkens tek- niskt skolade personal och att mellan dessa båda ett i stort sett gott sam- arbete varit rådande. Utvecklingen har emellertid bl. a. medfört ett alltmer ökat behov av teknisk-ekonomisk sakkunskap inom landsbygdsdistributio- nen, och sådan har i många fall ej i tillräcklig grad stått till de lokala små- företagens förfogande.

De av enskild person drivna företagen utgöras till mycket stor del av små företag. Distributionen sker exempelvis genom ägaren till ett jordbruk eller en kvarn och avser företrädesvis anställda eller andra närboende en- ligt Överenskommelser, som träffats från fall till fall.

Industriföretag med landsbygdsdistribution äro ofta organiserade såsom aktiebolag. I motsats till de under gruppen aktiebolag förda företagen driva de emellertid distributionen såsom birörelse vid sidan av den egentliga, in- dustriella verksamheten. Industriernas detaljdistribution är i regel begrän- sad till ett närliggande område, som huvudsakligen bebos av i industriföre— tagen anställda personer.

I gruppen aktiebolag ingå i första hand en del stora råkraftsäljande kraft- aktiebolag, som själva samtidigt ha mer eller mindre omfattande lands- bygdsdistribution inom sina kraftverksområden, exempelvis Sydsvenska kraftaktiebolaget, Yngeredsfors, Gullspång—Munkfors och Skandinaviska elverk. Aktiebolagsformen användes emellertid även av mera lokalt betonade

småföretag. För några av statens vattenfallsverk övertagna företag har aktiebolagsformen bibehållits.

De kommunala företagen äro som nämnts relativt fåtaliga på landsbyg- den och finnas där merendels i köpingar och municipalsamhällen. Elkraft- försörjningen på landsbygden har först så småningom kommit att framstå såsom en kommunal angelägenhet. Landskommunernas möjligheter att själva svara för detaljdistributionen motverkas dessutom ofta av det förhål- landet, att distributionsområdenas av tekniska skäl bestämda gränser icke sammanfalla med kommunernas. Som tidigare nämnts (s. 202) förekommer dock en ganska omfattande landsbygdsdistribution i kommunal regi däri- genom, att åtskilliga stadselverk förse den omkringliggande landsbygden med elkraft. Detta kan i många fall vara till fördel för landsbygden, i det att de jämförelsevis stora stadselverkens större resurser och möjligheter i fråga om sakkunnig personal, lågt råkraftpris och rationellt ordnad drift komma även landsbygden tillgodo. Å andra srdan föreligger svårigheter för landsbygdskonsumenterna att utöva inflytande på stadselverkens skötsel av landsbygdsdistributionen. Hithörande problem skola mera ingående behand- las i ett senare avsnitt rörande »Kommunernas inflytande på elkraftför— sörjningen» (s. 270).

Av det sagda framgår, att detalj distributionen av elkraft särskilt på lands- bygden handhas av företag med mycket skiftande organisationsformer. Det finnes emellertid ingen anledning antaga, att förekommande bristfälligheter beträffande landsbygdsdistributlonen i nämnvärd grad ha sin grund däri, att den i det särskilda fallet valda företagsformen i och för sig varit olämp- lig. Förekommande olägenheter torde i första hand betingas av att distribu- tionsenheterna varit för små eller icke tillräckligt bärkraftiga. Det kan gö- ras gällande att företag, som drivas av enskild person eller bolag, ha olämp- liga organisationsformer ur den synpunkten, att de i första hand tillgodose det privata vinstintresset och att konsumenterna ha mycket små möjlig— heter att göra sina intressen gällande. På samma sätt kan dock sägas att också statens vattenfallsverk och de kommunala elverken äro affärsdrivande verk, även om vinstintresset här ej har samma betydelse, samt att åtmin- stone de mindre konsumenternas möjligheter att mera nämnvärt inverka på företagens skötsel även i dessa fall av naturliga skäl äro begränsade.

Teoretiskt sett böra de organisationsformer vara ur allmän synpunkt lämpligast, där förbrukarna eller samhällsmedlemmarna ha de största möj- ligheterna att Öva skäligt inflytande på verksamheten. Speciellt den koope- rativa distributionsföreningen borde utgöra en organisationsform, där öns- kemålen om såväl vinstintressets avkoppling som förbrukarnas möjligheter att öva skäligt inflytande på verksamheten i väsentlig grad kunna tillgodo- ses, under förutsättning att föreningen icke är av sluten typ. Oavsett vilken organisationsform som tillämpas gäller emellertid som regel, att distribu- tionsföretagen måste drivas enligt affärsmässiga grunder och att de en-

skilda förbrukarnas eventuella möjligheter att göra sina intressen gällande i huvudsak äro av formell art.

Tillgång till teknisk och ekonomisk sakkunskap

Vid nyelektrifiering på landsbygden förekomma en mängd frågor som kräva fackkunskap. Hit höra frågor som röra bildandet av en ekonomisk förening, kapitalanskaffning, distributionsapparatens planläggning, dimen- sionering och utformning, sökande av koncession och statsbidrag, upprät- tande av kontrakt med byggnadsentreprenör och råkraftleverantör, fast— ställande av detaljdistributionstariffer samt ordnande med bokföring, mä- tareavläsning och debitering. Även sedan elektrifieringen genomförts er— fordras teknisk och ekonomisk sakkunskap för företagens normala skötsel, för tillsyn, utvidgning och förstärkning, reparation och underhåll av näten, för övervakning av företagens ekonomi och uppgörande av bokslut, för handläggning av tariffrågor, för uppgörande av råkraftkontrakt osv. Vidare är det i hög grad önskvärt, att distributionsföretagen kunna lämna sina för- brukare en viss, elementär kundtjänst såsom anvisningar för installationer, råd angående vilka detaljer, som kunna och höra elektrifieras och råd vid anskaffandet av elektriska bruksföremål, exempelvis vilka motorstorlekar, som erfordras i olika fall, samt huruvida elektrisk matlagning och annan elvärme kan användas.

Den sakkunskap, som står till distributionsföretagens förfogande, kan företrädas av företagens egen personal, ävensom utomstående, konsulteran- de organ. Större distributionsföretag ha som regel tillgodosett sitt väsent- liga behov av teknisk och ekonomisk sakkunskap genom att anställa kva- lificerad personal och äro sålunda i mindre utsträckning beroende av råd- givning utifrån. Medelstora och små distributionsföretag sakna däremot, som framgår av redogörelsen för förekommande organisationsformer, i stor ut- sträckning egen sakkunnig personal och ledas administrativt och ekono- miskt merendels av förtroendemän utan särskild utbildning. För det tek- niska handhavandet av anläggningarna finnes normalt vid medelstora före- tag en hel- eller deltidsanställd elektrisk installatör men småföretagen sakna ofta helt dylik teknisk personal. Det är uppenbart att dessa medel- stora och små distributionsföretag i stor utsträckning äro hänvisade till utomstående konsulterande organ och installationsfirmor för råd och an— visningar i olika frågor och hjälp med att utföra även enklare arbets- uppgifter. '

Alltsedan landsbygdselektrifieringens tidigaste skede har det rätt brist på kvalificerad personal för distributionsföretagens tekniska ledning. Sär- skilt under den forcerade elektrifiering, som kom till stånd under och efter första världskriget, kom denna brist till synes i dåligt planlagda och utför- da anläggningar. Vid denna tidpunkt var installatörsyrket fritt och anlägg-

ningarna kommo därför ofta att utföras av personer, som saknade såväl teoretisk som praktisk utbildning i installatörsyrket.

Genom tillkomsten av 1919 års förordning angående behörighet att utföra elektriska anläggningar förbättrades förhållandena, även om det till en bör— jan vanns icke mycket mer än att de mest inkompetenta yrkesutövarna eli— minerades och att installatörernas ansvarskänsla stärktes. Man får näm- ligen beakta, att åstadkommandet av en kompetent yrkeskår av den stor— leksordning, varom här är fråga, måste vara en svår och tidskrävande upp— gift, för vars lösning installatörsförordningens utfärdande endast kan be- traktas som ett steg på vägen. Med stöd av nämnda förordning hade kom- merskollegium år 1925 meddelat installatörsrättigheter till ca 3 000 personer, motsvarande det dåvarande ungefärliga behovet av självständigt arbetande installatörer. Det dröjde emellertid länge, innan de teoretiska utbildnings- möjligheterna inom yrket blevo någorlunda tillfredsställande ordnade. På grund härav tvingades kommerskollegium, särskilt under de första tio åren efter det förordningen trätt i kraft, i många fall att med tillämpning av dispensbestämmelser utfärda behörighetsbevis för yrkesutövare som icke hade erforderlig teoretisk utbildning. Dispensförfarandet framkallade åtskillig kritik, särskilt från de håll där man av skilda anledningar önskade en stark begränsning av antalet självständigt arbetande installatörer.

Genom kungörelsen den 2 juni 1939 uppdelades, som nämnts 1 kap. 5, s. 155, installatörerna allt efter behörighet och kompetenskrav i tre klasser. A, B och C.

Behörighet såsom installatör av klass A avser alla slags starkströms- anläggningar. A-installatörer inneha som regel högre teknisk utbildning och skola ha en allsidig praktisk utbildning inom facket innan de erhålla behörighet. Förutsatt att de inneha nödiga personliga kvalifikationer i övrigt torde deras kompetens för de uppgifter, varom här är fråga, vara god.

För vinnande av B-behörighet, för vilken endast gäller den inskränk- ningen att verksamheten är begränsad till visst i behörighetsbeviset angivet geografiskt område, erfordras, förutom att under en avsevärd tid ha varit praktiskt verksam inom facket, att inneha teoretiska kunskaper motsva- rande det kunskapsmått, som inhämtas vid installatörskurs med minst 600 timmars undervisningstid (s. k. B-kurs). Även B—installatörerna få anses inneha god kompetens, ehuru den som regel icke är tillfyllest i fråga om speciellt planläggning av större och mera komplicerade anläggningar.

C-installatörs behörighet i vad avser landsbygdsanläggningar är begrän- sad till installationsarbete i anslutning till redan befintlig distributions- anläggning. Dessa installatörer kunna sålunda få behörighet icke endast för inomhusinstallationer utan även för distributionsanläggningar, förutsatt att dessa äro anslutna till befintlig dylik anläggning. För behörighet av klass C fordras, förutom lika lång praktisk utbildning som B-installatö- rerna, att vederbörande styrker sig vara förtrogen med för elektriska an-

läggningar gällande föreskrifter och deras tillämpning på anläggningar av det slag behörigheten skall avse samt ha kännedom om elektroteknikens enklare grundbegrepp. Styrkandet av denna teoretiska kompetens plägar ske genom företeende av godkänt avgångsbetyg från installatörskurs med minst 220 timmars undervisningstid (s. k. C—kurs).

Ehuru många C-installatörer på grund av personlig duglighet kunna vara fullt kompetenta för de uppgifter, som enligt deras bevis stå dem öppna, ligger det i sakens natur att de, med den relativt obetydliga teoretiska ut- bildning de inneha, som regel icke räcka till för de uppgifter som normalt möta vid planläggning och beräkning av elektriska distributionsanlägg- ningar i allmänhet. De som ha ansvaret för den nya installatörskungörelsens innehåll torde icke heller vid utformningen av bestämmelserna om installa- törernas befogenheter ha haft den uppfattningen, att C-installatörer skulle besitta dylik kompetens. Då detta oaktat bestämmelserna för C—behörighet avfattades så, att möjlighet lämnades att ge ganska vittgående befogenheter åt dessa installatörer, har detta givetvis berott på att hänsyn måst tagas till de former, under vilka landsbygdselektrifieringen uppbyggts i vårt land, nämligen genom ett stort antal delvis mycket små distributionsenheter.

Även om icke alla småföretag sakna egen fast installatör, kvarstår dock behov av ett stort antal installatörer för distributionsföretagens räkning. Det torde knappast vara praktiskt genomförbart att inom rimlig tid fram- bringa kompetenta, självständigt arbetande installatörer i den omfattning, som med nuvarande organisation inom landsbygdens elkraftförsörjning skulle behövas. Härtill kommer att anställandet och även anlitandet av mera högkvalificerade installatörer i många fall ställer sig ekonomiskt betungan- de för småföretagen. På grund av dessa omständigheter har man redan varit nödsakad att utforma den nya installatörskungörelsen så att möjlig- het bereddes att utan dispensförfarande meddela behörighet åt så stort antal installatörer, som distributionsföretagen och allmänheten i övrigt hade oavvisligt behov av, oaktat att detta förde med sig att behörighet i många fall har måst lämnas åt personer, som endast haft nödtorftig kompetens för sin uppgift. Jämfört med den gamla installatörsförordningen äro kraven i den nya dock i så måtto skärpta, att ny behörighet icke kan lämnas den, som saknar teoretisk utbildning.

Beträffande de behöriga elektriska installatörerna i landet göras inom kom- merskollegium tid efter annan vissa statistiska undersökningar och ur dessa kunna åtskilliga uppgifter erhållas angående installatörskårens sammansättning och förändringarna inom densamma. Enligt en inventering per den 1 januari 1935 uppgick antalet behöriga installatörer till 3686. Den i april 1948 hade antalet stigit till 5364 och den 1 april 1952 till 6 314. Fördelningen på olika yrkeskate- gorier åren 1935 och 1948 (för år 1952 saknas motsvarande uppgift) framgår av följande sammanställning.

Antal % Antal %

Självständiga företagare ........................... 1 654 44,3 2 496 46,5 Anställda vid elverk, distributionsförening—

ar o. d. ............................................. 905 24,6 1 207 22,5 Anställda vid industrier, allmänna inrätt-

ningar o. d. ....................................... 988 26,8 1 489 27,8 Konsulterande och besiktningsmän ......... 139 3,8 172 3,2

Summa 3 686 100,0 5 364 100,0

Under åren 1935—1948 ökade installatörernas antal sålunda med i genomsnitt 46 %. Ökningen är störst inom grupperna självständiga företagare och industri- anställda eller ca 50 %.

Med tillkomsten av 1939 års installatörskungörelse genomfördes som nämnts en uppdelning av installatörerna i klasser. Omklassificeringen av de äldre installa— törerna var fullt genomförd i början av år 1942, och från denna tid finnas fort- löpande statistiska undersökningar rörande installatörernas uppdelning på de olika klasserna.

Tillväxten av installatörskåren har under senare år skett hastigare än tidigare. Ökningen var perioden januari 1935—juni 1942 ca 75 installatörer per år, juli 1942—april 1945 ca 155, maj 1945—mars 1948 ca 230 och april 1948—april 1952 ca 240 installatörer per år. Orsakerna till denna hastigare tillväxt torde bero på de relativt goda konjunkturerna och de förbättrade undervisningsmöjligheterna inom yrket. Tillväxten sker hastigt inom B-klassen, medan C-klassen under senare är snarare visat viss tendens till stagnation. Av de 2053 installatörer, som utöver avgången från yrket _ tillfördes kåren under perioden 1942—1952 voro 16,9 % A-installatörer, 51,1 % B-installatörer, 27,5 % C-installatörer och 4,5 % specialbehöriga.

I följande sammanställning visas hur antalet installatörer inom varje klass ökat under 10—årsperioden 1942—1952.

Antal installatörer Ökning 1942 1952 Antal % Klass A ................................................ 511 857 346 67 » B ................................................ 1 802 2 852 1 050 58 » C ................................................ 1 900 2 465 565 30 Specialbehöriga .................................... 48 140 92 191 Summa 4 261 6 314 2 053 48

Bortses från de specialbehöriga har alltså klass A.vuxit mest relativt sett. Där- efter kommer klass B och sist klass C. Klass B är numera den till numerären största installatörsklassen.

Den undersökning, som gjordes 1935, visade att 52,7 % av installatörskåren då saknade för behörighet föreskriven teoretisk utbildning. Eftersom för alla ny- tillkommande installatörer möjligheterna till dispens från denna utbildning i stort sett borttogos i och med tillkomsten av 1939 års installatörskungörelse, har an- talet dispenserade numera väsentligt nedgått. De dispenserades antal i procent av hela antalet installatörer var vid nedan angivna tidpunkter följande.

Klass A Klass B Klass C Totalt 1/7 1942 .................................... 0,5 27,9 19,5 47,9 1/5 1945 .................................... 0,5 23,9 16,6 41,0 1/4 1948 .................................... 0,5 19,3 12,0 31,8 1/5 1952 .................................... 0,3 14,7 8,1 23,2

I själva verket äro förhållandena numera bättre än som framgår av siffrorna ovan, enär de dispenserade inom klasserna A och B i många fall ha teoretisk utbildning, som skulle berättiga till behörighet av lägre klass utan dispens.

I underdånig skrivelse av den 14 juni 1950 i ett remissärende beträffande tillämpningen av dispensbestämmelse i installatörskungörelsen har elkraft— utredningen framhållit, att kungörelsens kompetensbestämmelser behöva överses. Elkraftutredningen är även nu av den uppfattningen att en över— syn är erforderlig, bl. a. med hänsyn till betydelsen av att erforderlig tek- nisk personal med för de olika arbetsuppgifterna tillräckliga kvalifikatio- ner skall finnas tillgänglig för arbetet med landsbygdsdistributionens upp- rustning och den fortsatta distributionsverksamheten. Enär en dylik över— syn ligger vid sidan av elkraftutredningens egentliga undersökningsområde förutses, att en sådan kommer till stånd i särskild ordning.

I rent ekonomiska frågor, särskilt beträffande bokföring och bokslut, är ofta sakkunskapen inom småföretagens ledning otillräcklig. Enligt 1 5 4 mom. i 1929 års bokföringslag har den, som yrkesmässigt driver rörelse för framställning eller överföring av elektrisk kraft till avsalu, skyldighet att föra handelsböcker på sätt som i lagen stadgas. Denna skyldighet gäller, till skillnad mot vissa andra rörelser, oavsett antalet anställda. Med hän- syn till de stora värden som förvaltas av distributionsföretagen, är det av vikt att bokföringen skötes på ett tillfredsställande sätt och att boksluten uppgöras riktigt. Svårigheter uppstå särskilt i fråga om värderingen av an- läggningstillgångar, dvs. ledningsnät, transformatorer, mätare etc., och i fråga om avskrivningsåtgärderna. Mycket skiftande förfaringssätt tilläm- pas härutinnan av olika företag och den bristande sakkunskapen i dessa ofta svårbedömbara ekonomiska frågor kunna leda till att företagens eko- nomi blir undergrävd.

Den sakkunniga rådgivning utifrån, som står till landsbygdsföretagens förfogande, lämnas av konsulterande organ av olika slag, till vilka, ehuru något oegentligt, även de råkraftleverantörer som inrättat kundtjänst få räknas. Bland råkraftleverantörerna är det i första hand statens vattenfalls- verk, som bedriver kundtjänst i sådan omfattning, att den till väsentlig del fyller landsbygdsföretagens behov av sakkunnig rådgivning utifrån. Även andra råkraftleverantörer lämna emellertid i växlande grad rådgivning till sina abonnenter och tendensen synes numera gå mot ökad rådgivnings- verksamhet av detta slag.

Frågan om den elektriska konsulentverksamheten på landsbygden har i olika sammanhang varit föremål för statsmakternas uppmärksamhet. Vid 1917 års riksdag beslutades inrättandet av bl. a. en central konsulentbefatt- ning under lantbruksstyrelsen med uppgift närmast att verka för elkraf- tens ökade utnyttjning inom jordbruksnäringen. Anslag för denna befatt— ning anvisades emellertid icke längre än t. o. 111. år 1920, varefter befatt- ningen indrogs.

Även den lokala konsulentverksamheten har understötts av staten. Ur- sprungligen på grund av motioner vid 1918 års riksdag ha statsmakterna för främjande, i vad på länsstyrelserna ankommer, av en planmässig orga- nisation och utveckling av landsbygdens elektrifiering årligen (med undan- tag för budgetåren 1933/34 och 1934/35, då anslaget av statsfinansiella skäl icke upptogs i riksstaten) anvisat anslag, som under åren fram till andra världskriget uppgått till ca ll/i milj. kronor. Dessa medel ha av länsstyrel- serna i första hand använts för understödjande av den konsulentverksam— het i elektrifieringsfrågor, som inom länet bedrivits av elektriska länsför- eningar och liknande organ. Vidare må nämnas, att 1939 och 1940 års riksdagar anvisat särskilda medel, tillhopa 100 000 kronor, för undersök- ning rörande landsbygdens elektrifiering m. m.

För understödjande av den allmänna verksamheten inom länsföreningar- na i Jämtlands, Västerbottens och Norrbottens län ha under åren 1941— 1953 (november) statsbidrag anvisats med ca 160 000 kronor. Under samma tidsperiod ha olika länsstyrelser beviljats statsbidrag med ca 376 000 kro— nor för undersökningar rörande elektrifieringen av länens landsbygd m. 111. Av sistnämnda belopp ha ca 25 300 kronor anvisats under år 1950, 57 000 kronor under år 1951, 40 600 kronor under år 1952 och 35 500 kronor under tiden januari—november 1953. Ansökningar om ytterligare statsbidrag med sammanlagt ca 25 000 kronor äro under prövning.

Konsulterande (länsföreningar och andra) tillföras därjämte genom dist- ributörerna statsbidragsmedel för projekteringsarbete avseende statsbidrags- berättigade anläggningar genom att kostnaderna för projekteringsarbetet i dessa fall inräknas i anläggningskostnaden. Hur stor del av projekterings- kostnaden som är statsbidrag kan icke anges, eftersom någon uppdelning av statsbidrag på de olika kostnadsgrupperna normalt icke göres.

Länsstyrelserna anlita vid behov de elektriska länsföreningarna i elektri- fieringsfrågor. Länsföreningar som åtaga sig utredningar i elektrifierings- frågor finnas för närvarande i tolv län nämligen Jönköpings, Kronobergs, Blekinge, Kristianstads, Hallands, Skaraborgs, Värmlands, örebro, Gävle- borgs, Västernorrlands, Jämtlands och Västerbottens län. Dessutom finnes en länsförening i Norrbottens län, som emellertid under de senaste åren ej sysslat med projekt för distributionsanläggningar, samt en sammanslut— ning, Mälarprovinsernas elektriska länsförening, med säte i Stockholm. Förutom de statsbidrag, som lämnats till länsföreningar för deras verk— samhet, erhålla ett flertal föreningar bidrag från landsting eller hushåll- ningssällskap. I övrigt få de lita till medlemsavgifter och egen förvärvs- verksamhet. I några fall äro länskonsulenterna anknutna till vederbörande ångpanneförenings elektrotekniska avdelningskontor.

Erfarenheterna av länskonsulentverksamheten ha varit växlande. Det är helt naturligt, att resultatet i hög grad måst bli beroende av ekonomiska re- surser och framför allt av konsulentens person och förmåga. Där goda

förutsättningar härutinnan förefunnits ha konsulenterna också uträttat ett betydande arbete till fromma för landsbygdens planmässiga elektrifie- ring.

Inom de olika länen har konsulentverksamheten omfattats med mycket olika intresse från landsbygdsbefolkningens och berörda institutioners sida. Medan anslutningen till länsföreningarna i några län varit synnerligen liv- lig, ha dessa föreningar i andra län endast samlat ett mindre antal av lands- bygdens distributionsföretag som medlemmar. I någon mån sammanhänger detta givetvis med det olika behovet av länskonsulenter i olika delar av lan- det. I vissa landsdelar omhänderhas kraftdistributionen direkt till varje konsument till övervägande delen av större kraftföretag, vilka själva ut- föra anläggningarna och svara för deras skötsel och drift genom fast an- ställd personal. Här saknas sålunda i nämnvärt antal sådana distributions— företag, som i regel bilda stommen i de elektriska länsföreningarna. I andra län ha brandförsäkringsanstalternas elektriska besiktningsmän i viss mån även åtagit sig uppgifter, som eljest närmast ankomma på länskonsulen- terna. Slutligen ha inom betydande områden, särskilt inom vattenfalls- verkets försörjningsområde, råkraftleverantören i stor utsträckning tillhan- dagått med rådgivning, vilket minskat behovet av annan konsulteringsverk- samhet.

Erfarenheterna från länskonsulentverksamheten i olika delar av landet ha visat, att verksamheten icke förmått bli ekonomiskt bärig utan under- stöd av allmänna medel. I den mån dylika medel uteblivit har verksamheten i regel måst antingen inskränkas eller främst inriktas på lönande uppdrag utanför de ursprungliga uppgifterna.

Förslag att förskaffa länskonsulenterna en bättre och mera tryggad ställ— ning än den hittillsvarande ha vid olika tillfällen framförts. Här må bland annat nämnas, att den år 1930 upplösta Riksföreningen för landsbygdens elektrifiering (se nedan) i skrivelse till Konungen den 5 december 1928 hemställde om åtgärder för genomförande av en planmässig organisation av den statsunderstödda elektriska konsulentverksamheten. Framställning- en, som bl. a. åsyftade konsulentverksamhetens förläggande under hushåll— ningssällskapen och höjda statsanslag, mottogs inom intresserade kretsar med mycket delade meningar och ledde icke till någon åtgärd (Kungl. Maj:ts beslut den 4 december 1930).

'Vid 1941 års riksdag väcktes vidare motioner om utredning angående den elektriska konsulentverksamheten på landsbygden. I sitt utlåtande an- förde jordbruksutskottet, att kommerskollegium visserligen i avgivet utlå- tande tillstyrkt en sådan utredning, som av motionärerna begärdes, men av olika skäl ansett tveksamt, huruvida utredningsarbetet kunde förväntas leda till några praktiskt realiserbara förslag. Utskottet framhöll vidare, att frågan om behovet av elektrifieringskonsulenter på landsbygden samt deras ställning och arbetsuppgifter komme att i viss utsträckning upptagas till

behandling av den pågående hushållningssällskapsutredningen. Med anled- ning härav och då de av riksdagen för budgetåren 1940/41 och 1941/42 anvisade anslagen på tillhopa 10 milj. kronor till befrämjande av lands- bygdens elektrifiering enligt bestämmelserna i nödig utsträckning finge dis- poneras jämväl för undersökningar och planläggningar rörande elektrifie— ringsföretag, eller med andra ord till elektrisk konsulteringsverksamhet, ansåg sig utskottet icke böra förorda bifall till motionerna. Riksdagen av- slog jämväl desamma.

Hushållningssällskapsutredningen har i sitt betänkande (SOU 1942: 32) i denna fråga framfört följande synpunkter.

Hushållningssällskapsutredningen får för sin del framhålla, att tre frågor synas i detta sammanhang vara av särskild betydelse för närvarande, nämligen frågorna om planläggning och utförande av elektrifieringsanläggningar, ävensom om in- stallationer i byggnaderna samt taxefrågor. Den förstnämnda frågan torde i regel handhas av vederbörande kraftverk eller av länsstyrelsen. För detta ändamål torde, såsom kommerskollegium antytt, numera tillräckligt antal teknici stå till förfogande. I varje fall torde för detta ändamål icke kunna ifrågakomma spe- ciella, hos hushållningssällskapen anställda konsulenter.

Vad åter angår installationsarbeten i byggnaderna synes, såsom redan tidigare framhållits, konsulterande verksamhet härutinnan icke vara erforderlig i sådan omfattning, att densamma skulle kunna motivera särskilda hos hushållningssäll- skapen eller eljest anställda konsulenter.

Rådgivning i taxefrågor och över huvud taget spörsmålet rörande elektrifie- ringstaxor å landsbygden framstår för utredningen såsom en synnerligen betydel- sefull fråga, icke minst för jordbrukets utövare. Utredningen anser emellertid icke, att detta spörsmål kan lösas genom en reorganisation av konsulentverk- samheten.

Med anledning av vad sålunda anförts har hushållningssällskapsutredningen icke funnit skäl att till närmare prövning upptaga och framlägga förslag rörande den elektriska konsultationsverksamheten på landsbygden.

Konsulterande verksamhet på hithörande område bedrives även av ett flertal privata företag, såväl större som mindre.

Tillhandahållandet av teknisk sakkunskap har även varit en huvuduppgift för de under olika tider verksamma landsomfattande sammanslutningar, som upptagit landsbygdens elektrifieringsfrågor på sitt program. Tidigare sammanslutningar av detta slag ha emellertid merendels visat sig föga livs— kraftiga. Lantmännens elektriska centralförening, som grundades på våren 1918 med uppgift bl. a. att verka för bildande av länsföreningar och att själv vara det centrala organet för dessa, avsåg även att inrätta en konsultativ byrå. I föreningens uppgifter ingick vidare låneförmedling och indirekt också materielförsäljning. Föreningens upplösning, som skedde redan i november 1918, förklarades bl. a. av dess »något oklara och vitt svävande ekonomiska program, vilket knappast var motiverat av rådande förhållanden».

Samma månad bildades i stället den ovannämnda Riksföreningen för landsbygdens elektrifiering u.p.a. Denna hade enligt stadgarna till uppgift

bl. a. att sammanföra de lokala organisationerna för landsbygdens elektri- fiering samt att utåt företräda dessa, att verka för en enhetlig och planmäs- sig organisation av elektriska länsföreningar samt av distributionsför— eningar i län, där länsföreningar eller analoga sammanslutningar ej existe- rade, att verka för en ändamålsenlig materielstandardisering, att stå med- lemmarna till tjänst med upplysningar i tekniska frågor och bokföring etc., inköp och utbyte av elektrisk materiel, anskaffning av lån till elektriska . anläggningar, försäkringar m. m.'Under några år erhöll riksföreningen l statsbidrag.

i Från riksföreningens verksamhet må följande data anföras. År 1920 utgavs av föreningen bokföringsformulär för elektriska distributionsföreningar och lokala kraftföretag på landsbygden. I samband med lantbruksveckan 1922 anordnades en »elektrisk vecka» med en serie föredrag av framstående tyska och svenska experter på landsbygdselektrifieringens område. Åren 1924 och 1925 utgav för- eningen ett medlemsblad som bilaga till tidningen Installatören. Vidare utgavs ' en serie meddelanden, däribland ett i form av en kortfattad lärobok i elektroteknik 5 och ett annat som behandlade installationsmateriel för ]antgårdar. År 1928 fram- ' lade riksföreningen, som nämnts på s. 225, förslag angående konsulentverksam- : heten på landsbygden.

Riksföreningen för landsbygdens elektrifiering upplöstes i början av år 1930. Med hänvisning till att de organisationsformer, under vilka arbetet med landsbygdens elektrifiering i fortsättningen komme att bedrivas på olika fronter, måste få betydelse jämväl för den rådgivande verksamheten, kommenterades upplösningsbeslutet i tidskriften ERA för mars 1930, varur följande citat är hämtat.

»Riksföreningens huvudsakliga arbetsuppgifter komma att övertagas av Jord- brukstekniska föreningen. En del av dess upplysningsverksamhet övertages av en nybildad elektrisk sektion inom Sveriges Allmänna Lantbrukssällskap. Vissa andra frågor kräva kanske andra organ. Det är en heterogen krets, som intresserar sig för landsbygdens elektrifiering. Arbetet berör både jordbrukare och små- industri jämte en betydande grupp av rena hushållsabonnenter. Bland distribu- törerna finnas både kooperativa och privata företag, både återförsäljare och självproducerande kraftverk. Det har framkastats tanken att bilda en särskild sektion inom Svenska Elektricitetsverksföreningen för landsbygdsbetonade distri- butionsföretag. Det lär även ha ifrågasatts att skapa en speciell förening för landsbygdens elektriska konsulenter. Vad upplysningsverksamheten på landsbyg- den om elektricitetens rationella användning beträffar, faller denna delvis inom Feras ram. I viss utsträckning böra energidistributörena själva påtaga sig denna uppgift.

Riksföreningens upplösning har förenklat situationen, men läget är alltjämt så oklart, att det larvar grundlig eftertanke.»

De i citatet omnämnda planerna på att inrätta en elektrisk sektion av Sveriges allmänna lantbrukssällskap (numera Sveriges lantbruksförhund) eller Svenska elverksföreningen kunde icke realiseras.

Nästa försök att få till stånd ett landsomfattande samarbetsorgan för landsbygdens distributionsföretag gjordes när Riksförbundet för elektrifie-

ringen på landsbygden (REL) bildades i maj 1948. Medlemmarna utgöras av distributionsföreningar och liknande konsumentägda distributionsföre- tag, vilka äro eller avses bli sammanslutna till länsföreningar eller samord- nade med befintliga elektriska länsföreningar. Förbundets ursprungliga syfte var närmast att för medlemmarna och därigenom för konsumenterna på landsbygden vara ett samarbets— och förhandlingsorgan samt en organi— sation för tillhandahållande av teknisk, ekonomisk, administrativ och juri— disk sakkunskap. På grund av alltför ringa anslutning har emellertid REL icke kunnat fullfölja sitt ursprungliga syfte och ombildades därför i maj 1951 till ekonomisk förening med verksamheten huvudsakligen inriktad på materielanskaffning för medlemmarnas räkning. Vid sidan av denna verksamhet avser REL dock även i fortsättningen att stå medlemmarna till tjänst med råd främst i tekniska frågor.

Bland de organisationer, som visat intresse för landsbygdens elektrifie- ringsfrågor, märkes Riksförbundet landsbygdens folk (RLF), som i oktober 1950 inrättade en elektroteknisk avdelning. Den av RLF sålunda upptagna verksamheten avser i första hand hjälp åt landsbygdens distributionsföre- tag och åt enskilda konsumenter med förhandlingar i elkraftfrågor även- som rådgivning i tekniska, ekonomiska, organisatoriska och juridiska pro— blem tillhörande detta område. Inom vart och ett av sina länsförbund har RLF inrättat länsnämnder för elkraftfrågor. Länsnämnderna äro avsedda att i första hand handlägga alla frågor av lokal natur.

Med hänsyn till den korta tid, under vilken REL och RLF verkat inom berörda verksamhetsområde, är det icke möjligt att nu fälla något omdöme om de båda organisationernas möjligheter att fullgöra de stora och betydel- sefulla uppgifter, som de ha påtagit sig. Mycket kan härvid bli beroende av vilken anslutning från landsbygdsföretagens sida, som organisationerna kunna få. Av betydelse ur allmän synpunkt är bl. a. att verksamheten får en sådan omfattning och inriktning, att den tillgodoser samtliga landsbygds- konsumenters intressen och sålunda ej blott vissa konsumentgrupper eller vissa landsdelar.

I detta sammanhang må påpekas att olika organisationer utge publika- tioner, vilka syssla med landsbygdens elektrifieringsfrågor även vad det gäller råd och upplysningar. Som exempel härpå kan nämnas de av För- eningen för elektricitetens rationella användande utgivna tidskrifterna ERA, EL och JOEL, Jordbrukstekniska institutets meddelanden, Svenska elektri- kerförbundets tidning Elektrikern och Svenska installatörsförbundets In- stallatörstidningen.

Bortsett från de företag, som ha egen personal med kvalificerad sakkun- skap, kan för landsbygdsföretagen sägas förekomma två olika system för tillgodoseende av rådgivningsbehovet, nämligen dels kundtjänstsystemet, varvid distributionsföretag, som äro råkraftabonnenter hos vissa storföre— tag, väsentligen genom dessas medverkan täcka sitt servicebehov utan sär-

skilt debiterad kostnad, dels konsulentsystemet, innebärande att distribu- tionsföretagen vid behov anlita utomstående konsulteringsorgan mot ersätt- ning i varje särskilt fall. Försöken att lösa konsulentfrågan genom bildan- det av elektriska länsföreningar ha av olika skäl ej lett till helt tillfreds- ställande resultat. I brist på centralt sammanhållande organ har något egentligt samarbete mellan de olika länsföreningarna ej kommit till stånd. Verksamheten hos det år 1948 bildade Riksförbundet för elektrifieringen på landsbygden samt hos den år 1950 bildade elektrotekniska avdelningen inom Riksförbundet landsbygdens folk kan ännu icke bedömas. Det statliga stödet åt konsulentverksamheten har varit mycket begränsat.

Rådgivningen i fråga om kraftförsörjningsfrågorna på landsbygden kan icke sägas ha fungerat på ett tillfredsställande sätt trots mångfalden av or- ganisationer som ha befattning med landsbygdens olika kraftförsörjnings- frågor. En vägande orsak härtill är att tillgängliga konsulteringsorgan, läns— konsulenter m. fl. icke anlitas i nämnvärd omfattning. Detta gäller även för smärre landsbygdsföretag, som ej ha tillgång till kostnadsfri rådgiv— ning genom vederbörande råkraftleverantör. Det ligger i sakens natur att det utrednings- och planeringsarbete, som förutsättes för utbyggande eller upprustning av ett distributionsnät, ofta måste bli omfattande och där— med kostsamt. Inom många distributionsföretag torde den i regel oberätti- gade uppfattningen råda att anläggningarna genom konsultation av sak- kunniga organ onödigt fördyras.

Landsbygdsföretagens kraftanskafning och kraftavsättning. Tarifer och anslutningsvillkor

I elkraftutredningens redogörelse nr 3 (s. 20—50, 94—109) ha behandlats utredningens undersökningar rörande företagens kraftanskaffning och kraftavsättning, avseende åren omkring 1944 och 1950. Undersöknings— resultaten ha framlagts översiktligt i tabeller, diagram och bilder. I det föl- jande skola vissa slutsatser ur nämnda redogörelse framföras sammanfatt- ningsvis. Därj ämte skola kompletterande synpunkter, framkomna genom det fortsatta utredningsarbetet, framläggas.

En stor del av distributionsföretagen på landsbygden täcka sitt behov av elkraft helt och hållet genom inköp från något storkraftföretag. År 1944 —— senare uppgift avseende hela landet saknas —— utgjorde de totalinköpande landsbygdsföretagen i riket 65 % av samtliga landsbygdsföretag med totalt 46 % av landsbygdens förbrukare. Av alla landsbygdsföretag erhöllo 22 % råkraft direkt från statens vattenfallsverk och 25 % direkt från något annat storkraftföretag. I allmänhet ha även de distributörer, som hämta sin rå- kraft från mindre företag, möjlighet att erhålla tillräckligt med kraft, efter- som så gott som samtliga råkraftlevererande företag numera ha anknytning till- riksnätet. Detsamma gäller i regel de delinköpande företagen, dvs. före-

tag med egen kraftkälla, som inköpa tillskottskraft från annat håll. Av dessa delinköpande landsbygdsföretag, år 1944 tillhopa ca 460 i hela landet eller 13 % av landsbygdsföretagen, ha många från början varit självförsör- jande. Det ökade kraftbehovet har emellertid sedermera föranlett anknyt- ning till ett eller flera andra företag. Det är ej ovanligt, att ett såsom del- inköpande betecknat företag under vissa tider avstår en del kraft från det egna kraftverket och att alltså, om än i mindre utsträckning, ömsesidigt kraftutbyte äger rum mellan företagen.

Utvecklingen efter år 1944 har lett till en minskning, totalt sett, av an- talet landsbygdsföretag. Procenttalen i ovanstående sammanhang torde emellertid hittills icke ha ändrats i någon nämnvärd utsträckning.

Missförhållanden i fråga om distributionsföretagens kraftanskaffning förekomma huvudsakligen inom kategorien självförsörjande företag och då främst bland dem, som icke ha anknytning till riksnätet eller till lokala vattenkraftcentraler av tillräcklig storlek. Allt eftersom elektrifieringen ut- sträckts ha förekommande lokala kraftanläggningar med begränsade resur- ser kunnat anslutas till de större näten och detta har ofta medfört att den lokala anläggningen nedlagts. Antalet företag med enbart egna, fristående kraftstationer utgjorde år 1944 omkring 650 dvs. 19 % av landsbygdsföre- tagen. Dessa betjänade dock endast 7 % av antalet landsbygdsförbrukare. Härvidlag har utvecklingen fram till år 1950 lett till en märkbar reducering så att sistnämnda år 13 % av antalet företag, representerande 3 % av an— talet förbrukare, fick kraft från fristående kraftstationer. Särskilt i vissa delar av Norrland men även annorstädes, exempelvis i Värmlands och Öre- bro län, voro dylika småföretag ännu förhållandevis vanliga. Den omstän- digheten, att ifrågavarande lokala kraftstationer vanligen äro utbyggda i vattendrag med tidvis otillräcklig vattentillgång, medför påtagliga olägen- heter för förbrukarna. Det förekommer sålunda inom dylika företag, att användningen av elkraft särskilt för motordrift inskränkes till vissa korta tider på dygnet eller på grund av säsongvariationerna i krafttillgången helt förbjudes under vissa årstider. Småindustri och hantverk ha givetvis under sådana förhållanden knappast möjligheter att inrättas eller utvecklas i dy- lika bygder. En nödvändig förutsättning för att ernå drägliga kraftförsörj- ningsförhållanden är, att ifrågavarande företag anslutas till riksnätet. Det kan också förväntas att denna fråga inom en nära framtid skall bli tillfreds— ställande löst i samband med elektrifieringens fortgående utsträckning till mellanliggande oelektrifierade områden.

' Av den riksöversikt, som lämnats i redogörelse nr 3, framgår att priset på elektrisk kraft uppvisar tämligen stora variationer på skilda orter. Detta beror i första hand på att leverantörernas självkostnader för kraftens till- handahållande på förbrukningsplatsen växla, särskilt på grund av olikheter i överföringen till förbrukningsområdet, och i avsättningsförhållandena inom förbrukningsområdet. Till de rådande olikheterna bidrar emellertid

.. —::M.mim.—H—_mn.f_ -... =.

| l l | »

även en mängd andra omständigheter. Den elektriska kraften användes på olika håll i landet och inom olika företags avsättningsområden i varie- rande utsträckning för olika ändamål. Detta sammanhänger med tariffernas utformning, kraftanläggningarnas standard och kvaliteten på den överför- da kraften, behovet av och möjligheterna att använda densamma för olika ändamål inom jordbruk, hantverk och småindustri, bostadshushåll etc. för maskinell drift. belysning, matlagning och andra uppvärmningsändamål m. m. Den specifika energiförbrukningen och medelpriset för kraften äro av naturliga skäl starkt beroende av varandra på så sätt att med en hög förbrukning som regel följer ett lågt medelpris och tvärtom.

Vad till en början kostnaderna för råkraft beträffar har det framhållits, såväl i redogörelse nr 3 som härovan i kapitel 2, att en viss, landsomfattande normalisering av engrostarifferna successivt kommit till stånd. Vattenfalls- styrelsens taxepolitik har ofta följts även av andra leverantörer. Resultatet av denna utveckling har blivit en tämligen god enhetlighet ifråga om rå- kraftpriset inom Norrland, Mellansverige respektive Sydsverige med en måttlig stegring av priset från norr till söder.

Den relativa enhetlighet, som sålunda utan något särskilt standardise- ringsarbete har vunnits beträffande råkrafttarifferna, har emellertid ännu icke helt kunnat åstadkommas ifråga om de för detaljdistributionen till- lämpade tarifferna, ehuru stora standardiseringsvinster ändock kan sägas ha uppnåtts.

Elkraftutredningens tariffinventering avseende åren 1943—1944 visade, att detaljtariffer av de mest skiftande typer användes och att bl. a. på grund härav de olika företagens inkomster per kWh detaljdistribuerad energi varierade betydligt. Medelpriserna hos olika storleksgrupper av lands- bygdsföretag resp. hos landsbygdsföretagen i de olika länen varierade avse- värt, som framgår bl. a. av tabeller och bilder i redogörelse nr 3. För samt- liga landsbygdsföretag utgjorde medelpriset vid tiden för undersökningen 14 öre/kWh. Motsvarande värde för stadsföretagen var 12 öre/kWh. Pris— nivån var sålunda — och är givetvis fortfarande —— högre på landsbygden än i städerna, vilket i första hand beror på skillnaden i distributionskostna— der, i sin tur bl. a. påverkad av den lägre förbrukningsintensiteten på lands- bygden än i städerna. Det är emellertid att märka, att vid medelprisberäk- ningen hänsyn icke tagits till engångsavgifterna, vilka egentligen före- komma endast på landsbygden. I verkligheten lågo sålunda medelpriserna för landsbygden än högre än vad tariffinventeringens siffror utvisa.

Av undersökningarna framgick, att de s. k. topprisföretagen —— företag med särskilt hög prisnivå —— vanligen voro att finna inom de minsta före- tagsgrupperna. Någon utpräglad tendens till att topprisföretagen företrä- desvis skulle tillhöra någon särskild företagstyp kunde ej förmärkas, även om typen »enskild person» uppvisade förhållandevis något större andel än övriga typer. Ej heller kunde något utpräglat samband mellan befolk-

ningstätheten inom de olika länens landsbygd och genomsnittspriscrna konstateras, vilket dock torde få anses bero på speciella orsaker.

Elkraftutredningens undersökningar visade, att prissättningen tidigare ofta varit hämmande för ökad elanvändning. Det är emellertid klart, att även på detta område en betydande utveckling skett, i synnerhet på lands- bygden, varvid den ökade användningen av moderna detaljtariffer har haft en väsentlig inverkan. De av elkraftutredningen år 1947 rekommenderade standardtarifferna (SOU 1947: 4) tillämpas numera över hela landet i för- hållandevis stor omfattning. Speciellt inom de delar av landet, där utveck- lingsfrämjande tariffer av liknande typ hittills använts i mindre utsträck- ning, skapas genom införande av moderna tariffer möjligheter till sänkt medelpris för detaljdistribuerad kraft och till ökad specifik energiförbruk- ning. En reservation rörande normaltariffens införande får dock göras med hänsyn till det förhållandet, att denna tariff på vissa håll tillämpas med en del tilläggsbestämmelser av sådan art, att man där i realiteten infört andra tariffer, som, speciellt i avseende på nyanslutning, kunna vara av mindre gynnsam karaktär. (Se redogörelse nr 3 s. 35—50).

I bilaga 8 i redogörelse nr 3 har angivits de grundavgifter i den s. k. nor- maltariffen, som i början av år 1952 tillämpades av ett 50-tal tillfrågade större landsbygdsföretag. Grundavgifterna för dessa företag varierade mel- lan 7 och 10 kr/Nte. Det må påpekas, att normaltariffen icke avser att standardisera grundavgiften. Denna bör nämligen vid varje företag bestäm- mas så, att den tillsammans med de standardiserade abonnent- och energi- avgifterna täcker företagets totala årskostnader för den detaljdistribuerade kraften. I många fall, speciellt inom småföretagen, torde missuppfattningar i detta avseende ha förelegat och man har ansett sig skyldig att välja en bestämd grundavgift, exempelvis den, som statens vattenfallsverk tillämpar (8: 50 kr/Nte år 1952). Om självkostnaderna därigenom icke blivit täckta har företaget eventuellt kompenserat sig genom att taga ut extra engångs— avgifter av något slag. Detta har givetvis icke varit avsikten med normal- tariffen.

Beträffande distributionsverksamhetens självkostnader må i detta sam— manhang erinras om vad som redan sagts i kap. 4 s. 119 om kostnaderna för anläggningarnas förnyelse. Särskilt de mindre företagen ha f. n. svårigheter att på ett tillfredsställande sätt få täckning för de totala själv- kostnaderna genom kraftförsäljningsinkomsterna, delvis beroende på de begränsade möjligheterna till skattefria avskrivningar. En anpassning av tarifferna till de totala självkostnaderna skulle med säkerhet, även om någon särskild skattekostnad icke behövde medräknas, i mycket stor ut- sträckning medföra väsentliga tariffhöjningar. Det är givet att den rena landsbygden, och särskilt den glesbebyggda delen av densamma, härvidlag ligger sämst till. Endast under den förutsättningen att landsbygdsföretagen inom sina distributionsområden även ha delområden med någorlunda tät

bebyggelse eller i övrigt även ha konsumenter, vilkas förseende med elkraft ur kostnadssynpunkt ställer sig någorlunda gynnsam, kan verksamheten beräknas bli skött på ett tillfredsställande sätt utan alltför höga elkraft- priser eller stadigvarande stöd utifrån. Möjligheter till en önskvärd utjäm- ning av distributionskostnaderna böra sålunda finnas.

Erfarenheterna av normaltariffen och de övriga av elkraftutredningen rekommenderade standardtarifferna torde i huvudsak kunna anses vara ' mycket goda. Detta utesluter emellertid icke att önskemål framkommit om | såväl justeringar som kompletteringar i form av utsträckt standardisering. Dylika justeringar och kompletteringar kunna anses erforderliga främst ifråga om tariffernas anpassning till ett variabelt penningvärde, ifråga om tariffenhetsberäkningen för vissa grupper av konsumenter samt ifråga om uttagandet av anslutningsavgifter och andra engångsavgifter.

Genom skrivelse den 9 november 1951 till Svenska elverksföreningen har elkraftutredningen anhållit om föreningens medverkan till en översyn av standardtarifferna. Arbetet med denna översyn pågår fortfarande och det är elkraftutredningens avsikt att i ett kommande särbetänkande framlägga förslag till sådana ändringar och kompletteringar till tariffstandardise- ringen, som efter avslutad översyn befinnas lämpliga.

Landsbygdsföretagens ekonomiska förhållanden

I redogörelse nr 3 ha redovisats vissa undersökningar rörande företagens ekonomiska förhållanden. Det framgår därav, att landsbygdsföretagens eko- nomiska förhållanden, bokföringsmässigt sett, från att åren närmast efter första världskriget ofta ha varit ansträngda successivt förbättrats under mellankrigstiden. Under 1930-talet betraktades det aktuella ekonomiska läget såsom för flertalet landsbygdsföretag gynnsamt. Den successiva steg- ringen av elkraftförbrukningen på landsbygden medförde bl. a. sänkta me- delpriser för råkraften och ökad utnyttjning av distributionsanläggningarna. Fram till slutet av 1930—talet var dessutom materieltillgången god och byggnadskostnaderna måttliga, varigenom förutsättningarna för erforder- lig successiv förstärkning av näten voro goda. Annorlunda blevo förhållan- dena i sistnämnda avseende under de senare krigsåren och under efterkrigs- tiden. Den tilltagande knappheten på materiel och de stigande byggnads- kostnaderna medförde då en eftersläpning beträffande anläggningarnas så- väl underhåll som förstärkning och sålunda en minskning av den marginal i nätens överföringsförmåga, som tidigare fanns. Genom den alltjämt starkt ökande elkraftförbrukningen torde emellertid även under denna utveck- lingsperiod landsbygdsföretagens ekonomiska ställning snarare ha förbätt- rats än försämrats, rent balanstekniskt sett. Penningvärdesförsämringen under de senaste åren har dock verkat ogynnsam på ekonomin, särskilt som taxehöjningar försvårats genom det under en tid rådande prisstoppet.

Stickprovsundersökningar gåvo vid handen att distributionsföretagens låneskuld i förhållande till anläggningskostnaderna år 1948 var relativt obe- tydlig. En undersökning av företagens likviditet samma år visade att till— gångarna som regel något överstego skulderna. Saldona voro emellertid vanligen obetydliga och det synes som om företagen strävat efter att medelst taxeregleringar göra sig skuldfria men samtidigt utan nämnvärda disponibla tillgångar.

Företagens rent balanstekniska ekonomiska ställning torde sålunda, åt— minstone fram till för några år sedan, ha varit genomgående god. De senaste årens utveckling torde ej heller nämnvärt ha ändrat detta förhållande. Det måste emellertid starkt framhållas, att en skenbart god ekonomisk ställ- ning mycket väl kan uppkomma på bekostnad av distributionsnätens under- håll. Den verkställda bedömningen av nätens tekniska tillstånd ger till- sammans med ovan refererade studium av företagens ekonomiska förhål- landen tydligt vid handen att så blivit fallet i mycket stor utsträckning. De senare årens utveckling i fråga om materieltillgång och byggnadskostnader å ena sidan och landsbygdens elkraftbehov å andra har på många håll lett till ökad eftersläpning i fråga om underhåll och erforderlig förstärkning av landsbygdsnäten. Det finnes därför många småföretag med till synes ordnad ekonomi, vilkas ställning dock är så ogynnsam, att erforderlig upp- rustning av distributionsnäten ej kan ske utan hjälp i någon form.

Fortsatt landsbygdselektrifiering

I runt tal 30 000 bostadshushåll på den svenska landsbygden eller ca 3 % av samtliga landsbygdshushåll äro f. n. oelektrifierade. (Jfr kap. 5 s. 149 och kap. 11 s. 211.) Elektrifieringsgraden för landsbygden är alltså ca 97 %, vilket innebär att Sverige, trots landets glesa bebyggelse, ifråga om extensiv elektrifiering intar en av de främsta platserna bland nationerna. Detta betyder emellertid icke att nyelektrifieringsverksamheten i vårt land skulle vara avslutad. Som framhållits i flera olika sammanhang är det av stor betydelse för näringslivet på landsbygden och för befolkningens levnads- standard icke minst i de glesbebyggda delarna av landet — samt därige- nom också för möjligheterna att förhindra en fortsatt avfolkning av sådan bebyggelse, som ur samhällelig synpunkt bör bestå, att elektrifieringen får största möjliga utbredning. Även om givetvis icke all bebyggelse i landet kan eller bör elektrifieras — en avflyttning från avlägsen bebyggelse eller enstaka lägenheter kan och bör naturligtvis icke under alla förhållanden hållas tillbaka — så torde man kunna utgå ifrån att sannolikt minst 15 000 lägenheter i landet med omkring 100 000 normaltariffenheter ytterligare böra elektrifieras, vartill givetvis kommer nybebyggelsen, som företrädes- vis sker inom förut elektrifierade bygder. Restelektrifieringen —— alltså med bortseende från nybebyggelsens elektrifiering .— beräknas med hänsyn till

nu rådande priser- och förhållanden i övrigt draga en kostnad av genom- snittligt minst 600 kronor per tariffenhet eller totalt minst 60 milj. kronor, i vilket belopp konsumenternas installationskostnader ej äro medräknade. Elektrifieringens utveckling såväl extensivt som intensivt bör i första hand vara en angelägenhet för vederbörande distributionsföretag. Dessa böra sålunda av egna fonderade eller upplånade medel bekosta distribu— tionsnätets såväl utvidgning som förstärkning. Kapitalanskaffning genom tillskott utifrån i form av bidrag i någon form från stat eller kommun etc. bör ifrågakomma endast om och i den mån en investering beräknas icke bli räntabel inom rimlig tid. Det kan vidare synas skäligt att ett företag, som t. ex. på grund av goda naturliga förutsättningar kunnat konsolidera sin ekonomiska ställning, bör få vidkännas större insatser för att tillgodose det allmänna intresset av elektrifieringens fortsatta utbredning än ett gles- bygdsföretag med svag ekonomi, som arbetar på självkostnadsgränsen. Rent allmänt torde man kunna påstå, att särskilt de större kraftföretagen, även om de bedriva huvudsakligen landsbygdsdistribution, ha goda ekono- miska möjligheter att medelst — förutom enligt praxis utgående anslut— ningsavgifter — egna fonderade medel eller utnyttjande av föreliggande lånemöjligheter finansiera en fortsatt landsbygdselektrifiering inom sina försörjningsområden. Härvid bortses från sådana hinder som bestå i knapp- het på materiel och arbetskraft eller legala investeringsbegränsningar. En betydelsefull insats har utan tvekan gjorts icke blott av vattenfallsstyrelsen utan även av en del enskilda kraftföretag för elektrifiering också av sådana bygder, där kraftavsättningen måste förutses bli ringa och vinsten obefintlig. Det är emellertid samtidigt uppenbart att man icke bör ställa kravet på en i och för sig förlustbringande elektrifiering alltför högt eller med andra ord kräva att ett distributionsföretag, även när möjligheter därtill finnas, alltid skall genom utjämning med sina bättre distributionsområden ensamt svara för kostnadstäckningen av en dyrbar glesbygdselektrifiering, som ej kan bli räntabel. För de mindre företagen saknas dessutom i regel möjlig- het att med tillämpning av rimliga tariffer på egen hand ombesörja en dylik elektrifiering. Om ett företags egna fonderade eller eljest tillgängliga medel ej förslå, kan kapitalanskaffning för utvidgning av rörelsen ske på olika sätt, exem- pelvis genom 3) insatser av nya andelsägare i företaget och av äldre andelsägare vid större utvidgning av elanslutningen dvs. ökning av tariffenhetstalet (en— gångsavgifter av medlemmar i kooperativa företag resp. nyemission av aktier i aktiebolag),

b) anslutningsavgifter vid nyanslutning av abonnenter respektive medlem- mar i kooperativa företag,

c) lån,

d) bidrag genom statens medverkan,

e) bidrag från kommun, av regleringsmedel o. d.

De under a) och b) nämnda formerna för kapitalanskaffning ha tidigare i olika sammanhang berörts, bl. a. i redogörelse nr 3 (s. 45—50) i samband med behandlingen av engångsavgifterna. Dessa förslå i regel icke för den kapitalkrävande restelektrifieringen på landsbygden, utan företagen få där- för ofta i stor utsträckning använda lånemedel eller lita till bidrag från stat och kommun.

Enligt nu tillämpade regler för statsbidrag till befrämjande av landsbyg- dens elektrifiering, för vilka redogjorts i kap. 5 (s. 149—153), kan bidrag ut— gå för nyelektrifiering så snart den specifika anläggningskostnaden för ett särskilt elektrifieringsprojekt överskrider en fixerad gräns. Någon pröv— ning av företagets behov av ekonomiskt stöd med hänsyn tagen till dess totala verksamhet sker ej. I proposition vid 1940 års riksdag uttalades bl. a., att det begärda anslaget borde användas för statsbidrag till elektrifierings- företag, vilka befunnos vara särskilt förtjänta och i behov av hjälp, samt att man icke borde bortse från befolkningens ekonomiska bärkraft i de trakter, där elektrifiering skulle ske. Det torde vara klart att man härvid avsåg en viss utjämning av kostnaderna inom företagets hela distributions— område. Att man likväl avstått från en behovsprövning i denna bemärkelse beror på, såsom torde framgå av den i kap. 5 refererade utredningen, att den icke kunde förenas med den praktiska förenkling, som användandet av en siffermässigt fastlagd subventionsnorm innebar. Man utgick därvid även ifrån att behovsprövningen skulle i viss mån kunna undvaras, om undre bidragsgränsen sattes så högt att endast relativt dyra elektrifieringar bleve subventionerade.

Den senast genomförda höjningen av undre statsbidragsgränsen till 150 kr. per Nte innebar som nämnts i kap. 5 icke ett återställande av denna gräns till sin ursprungliga reella nivå. Då därtill kommer att den specifika anläggningskostnaden ökat, icke endast till följd av penningvärdets för- sämring utan även beroende på att den återstående elektrifieringen avser allt mera svårelektrifierbara områden, är det förklarligt, att huvuddelen av alla landsbygdselektrifieringar numera äro statsbidragsberättigade. År 1940 torde statsbidragsgränsen ha legat ungefär 50 % över den då rådande normalkostnaden för en nyelektrifiering — vilket sålunda motiverade att man kunde förenkla behovsprövningen — men nu ligger statsbidragsgrän- sen betydligt under den kostnad, som får anses vara normal för en ny- elektrifiering. En av anledningarna till att man ansåg sig kunna utdela statsbidrag utan behovsprövning i vidare bemärkelse har alltså bortfallit.

Den omständigheten att statsbidrag utgår utan egentlig behovsprövning kan innebära, att andra möjliga och lämpliga utvägar för kapitalanskaff— ning lätt förbises. Även företag, som äro synnerligen kapitalstarka eller kreditvärdiga och där utjämningsmöjligheterna med bättre distributions— områden äro mycket goda, kunna nämligen erhålla statsbidrag så snart

ett speciellt elektrifieringsprojekt siffermässigt uppfyller kostnadsvillkoren enligt gällande bidragsregler. Som framgår av det ovan sagda finnes skäl att i viss utsträckning ekonomiskt understödja nyelektrifieringar även i dessa fall men bedömningen bör ändock kunna vara mera restriktiv och stödet mindre, än då det gäller ekonomiskt svaga företag, som på grund av distributionens karaktär nödgas hålla väsentligt högre tariffer. Såsom villkor för åtnjutande av statsbidrag stadgas bland annat att bi- dragstagaren skall förplikta sig »att — därest genom ökad anslutning eller annan omständighet skillnaden mellan anläggningskostnaden och stats- bidraget befinnes per normaltariffenhet räknat hava nedgått under 150 kro- nor — till statsverket återbära det mot kostnadsminskningen svarande be- loppet, skolande sådan skyldighet dock endast föreligga såvida Kommers- kollegium — ifråga om företag i annan än statlig eller kommunal ägo efter ! prövning av bidragstagarens ekonomiska ställning — funnit skäligt medde— la föreskrift om återbäring». Utan att närmare gå in på innebörden av i detta villkor skulle det teoretiskt kunna sägas, att ett statsbidrag utgör : ett räntefritt lån, som är eller kan bli förenat med återbetalningsskyldighet. l Erfarenheten hittills har emellertid visat, att denna omständighet som regel ' icke har någon praktisk betydelse. Någon återbetalning har sålunda, bort- sett från några rena undantagsfall, icke krävts och ej heller skett. I skatte— hänseende ha de företag, som erhållit statsbidrag, för övrigt ej heller med- givits rätten att skattefritt göra årliga avskrivningar av de anläggningar, som finansierats med statsbidrag, låt vara att de ej heller så ofta ha begärt detta. I ett den 2 mars 1951 avgivet yttrande över riksdagsmotioner (I: 48 och II: 31) om vidgad rätt till statsbidrag för elektrifieringsföretag på landsbyg- den förordade elkraftutredningen en översyn av bidragsgrunderna med hän- syn till under senare tid inträdda ändringar beträffande den återstående elektrifieringens art och omfattning och den allmänna kostnadsnivån för elektrifiering. De ändringar i bidragsgrunderna, som sedan dess ha skett, ta emellertid ej tillräcklig hänsyn till att restelektrifieringen sedan år 1940 ändrat karaktär och nu ankommer mera sällan på nystartade kooperativa sammanslutningar av bygdens befolkning än på större kraftbolag' eller eljest ekonomiskt konsoliderade distributionsföretag. Enligt elkraftutredningens mening är tiden nu inne för en mera djupgående omprövning av bidrags- grunderna, varvid i första hand frågan om införande av behovsprövning i vidare bemärkelse bör övervägas.

Det har ovan berörts att anläggningar, som helt eller delvis finansierats med hjälp av statsbidrag, ur taxeringssynpunkt icke kunna avskrivas till den del, som motsvarar bidraget. Om förnyelsemedel ändock genom kraft- försäljningsinkomsterna uttagas även för denna del, medför detta beskatt— ning enligt gällande skattelagar. Detta förhållande har redan tidigare på- pekats av elkraftutredningen i dess skrivelse den 26 januari 1953 angående

statligt stöd åt upprustning av elektriska distributionsnät på landsbygden. Förhållandet kommer även att beröras i efterföljande avsnitt av detta kapitel. Det bör emellertid här påpekas att nämnda skatteproblem sanno- likt medverkar till, att den ekonomiska skötseln av de mindre distribu- tionsföretagen ofta är sådan, att den resulterar i anläggningarnas förfall. Det synes nödvändigt att även detta problem beaktas i samband med en omprövning av bidragsreglerna. Elkraftutredningen har i den ovan om- talade skrivelsen rekommenderat, att statligt stöd för upprustning av be- fintliga distributionsnät normalt skall lämnas som lån, vilket till erforderlig del skall vara räntefritt. Därigenom behöva, i vad det gäller det statliga stödet, inga skattetekniska svårigheter uppstå att i självkostnaderna med- räkna även förnyelsekostnaderna. (Elkraftutredningen får i detta samman— hang hänvisa till sina principiella uttalanden i kap. 4 (s. 119—124) angå- ende självkostnader och kostnadstäckning.) Ehuru enbart därigenom icke någon egentlig förbättring i ekonomiskt hänseende vinnes kan det, med hänsyn till de psykologiska faktorerna, ifrågasättas huruvida även nyelek- trifieringsstödet för framtiden för mera normala fall borde få formen räntefritt län.

Om stödbeloppet i form av räntefritt lån ges samma storlek som bidra- get enligt nuvarande regler, minskar självfallet stödverkan i de proportio- ner, som bestämmas av amorteringen. Elkraftpriset inom det företag som utför nyelektrifieringen bör emellertid kunna justeras med beaktande av totalekonomin. Statens uppoffring för nyelektrifieringen blir mindre och företagets eller konsumenternas uppoffring i motsvarande mån större. Där goda möjligheter föreligga till ekonomisk utjämning mellan gynnsamma distributionsområden samt mindre gynnsamma, ännu icke elektrifierade områden kan det rent principiellt med hänsyn till det ovan sagda synas riktigt att nyelektrifieringsstödet får denna begränsade verkan.

Det bör självfallet beaktas att den nu återstående nyelektrifieringen har förhållandevis liten omfattning, vilket talar för att icke nu införa sådana ändringar i bidragsprinciperna, som icke anses nödvändiga.

De befintliga landsbygdsnätens upprustning

Statsbidrag från anslaget till befrämjande av landsbygdens elektrifiering avses i princip endast för nyelektrifiering. Mångenstädes på landsbygden gör sig emellertid behovet av förstärkningar av redan befintliga nät starkt gällande. Detta gäller särskilt områden, där elektrifiering skett under dyr- tiden i samband med första världskriget —— alltså utan statsbidrag — och ofta endast för belysning och med underhaltig materiel. I de talrika fall, där anläggningarnas underhåll blivit eftersatt eller där erforderliga nätför- stärkningar icke gjorts, föreligga betydande investeringsbehov. Ett till- godoseende av dessa kan innebära mycket svårlösta finansieringsproblem,

i 5 l l !

__._2.5_£:-...._ .:.va .nu-..... ___.

> far.—mmm.. . ,,,,

trots att distributionsföretagens ekonomi skenbart är god. I verkligheten kan läget ofta vara prekärt, beroende på att medel för även de allra nöd- vändigaste upprustningsåtgärderna saknas och ej utan stora svårigheter kunna anskaffas vare sig genom lån eller på annat sätt.

Elkraftutredningens tidigare förslag

| Elkraftutredningen har tidigare i särskilda skrivelser ingående behand- lat dessa problem. I förutnämnda skrivelse till chefen för kommunikations- departementet den 27 november 1950 redogjorde sålunda utredningen för sina synpunkter på behovet av upprustning av landsbygdsdistributionen , samt finansieringen härav. På särskilt uppdrag av Kungl. Maj :t verkställde elkraftutredningen sedermera en förnyad undersökning rörande samma problem och framlade resultatet härav i underdånig skrivelse den 26 januari 1953. I båda skrivelserna lämnade utredningen förslag till provisoriska stat- liga åtgärder för stöd åt en allmän upprustning av distributionsnäten på landsbygden. Ifråga om finansieringsproblemen framhöll elkraftutredningen i sin skri- velse den 26 januari 1953 i huvudsak följande.

Upprustningens finansiering

De kooperativa distributionsföretagen ha som regel finansierat sina anlägg- ningar åtminstone till en del genom kontanta engångsavgifter, insatser, från kon- sumenterna—delägarna. Härigenom ha i princip tarifferna —— för föreningsmed- lemmarna — kunnat hållas lägre än om motsvarande anläggningskapital skulle anskaffats genom lån. Engångsavgifterna ha nämligen, till skillnad från lånet, icke behövt förräntas genom kraftförsäljningsinkomsterna. I en del fall har man ej heller räknat med avskrivning av motsvarande anläggningsdelar, som anskaf- fats genom engångsavgifter, vilket sålunda i realiteten inneburit en kapitalför- brukning så att nytt kapital — genom förnyade engångsavgifter eller län — fått anskaffas efter hand som nätet på grund av sin förslitning måst förnyas. I de övriga fallen, där man genom kraftförsäljningsinkomsterna fått möjlighet till av- skrivning av anläggningarna, har man därmed fått medel (även om de i allmänhet icke, bl. a. med hänsyn till penningvärdesförsämringar, varit tillräckliga) till förfogande för nätets successiva förnyelse.

Enligt elkraftutredningens mening är det önskvärt, att ett distributionsföre- tags tariffer äro så avpassade, att de ge företaget nödiga inkomster för anlägg- ningarnas såväl underhåll som successiva förnyelse. Men anläggningarna behöva icke endast underhållas och förnyas, de behöva även successivt förstärkas med hänsyn till belastningsökningen. Även till den begränsade, successiva förstärkning, som omtalas i elkraftutredningens förslag till standardtariffer (SOU 1947:4, sidor- na 77—79), är det lämpligt, att medel anskaffas genom kraftförsäljningsinkoms- terna. Med en sådan taxepolitik har företaget möjlighet att, under förutsättning av en normal belastningstillväxt och icke alltför kraftiga penningvärdesförånd- ringar, kontinuerligt bedriva sin kraftförsörjningsverksamhet utan språngvisa och för konsumenterna besvärande och svål-förståeliga tariffhöjningar eller förnyade

engångsavgifter. Därigenom erhålles även kontroll på längre sikt av att företagets ekonomi är tillfredsställande. (Vid nyanslutningar eller onormala belastningsök- ningar erfordras självfallet kapitaltillskott, som till en del kunna behöva täckas genom engångsavgifter.)

Genom en lämplig ekonomisk skötsel av företaget bör det göras möjligt att utan ekonomisk olägenhet — såsom tillkommande beskattning -— hålla tarifferna i princip konstanta, oberoende av växlingar i behovet av underhålls-, förnyelse- och förstärkningsarbeten till följd av nätets ålder och tekniska tillstånd samt normala belastningsökningar.

Efter nybyggnad eller fullständig upprustning av ett distributionsnät äro till en början utgifterna för nätets underhåll, förnyelse och förstärkning låga för att sedermera, efter hand som materielen förslites, växa. Taxorna böra, som nämnts, redan från början avpassas så, att de —— under förutsättning av konstant penning- värde och i huvudsak oförändrade distributionsförhållanden -— utan att företaget behöver tillföras nya kapitaltillskott täcka de totala nätutgifterna på lång sikt. För att de totala kostnaderna för nätet, inberäknat avskrivningar, skola hållas i nivå med kraftförsäljningsinkomsterna, varigenom sålunda det beskattningsbara överskottet blir lågt eller lika med noll, fordras då -— speciellt vid företag, som icke äro så stora att kostnaderna kunna tidsmässigt uppdelas mellan olika delom- råden — att avskrivningarna till en början äro förhållandevis stora för att seder- mera successivt sjunka. Man torde som regel icke genom en plan för hunden avskrivning kunna i önskvärd utsträckning anpassa denna efter nämnda förhål- landen. Med fri avskrivning är emellertid anpassning möjlig. Emedan den fria avskrivningen sålunda för företag av denna typ erbjuder väsentliga fördelar, torde den i allmänhet böra eftersträvas. Det må anföras, att de företag som här åsyftas, icke ha någon nämnvärd ekonomisk styrka och att deras tariffer icke skola lämna inkomster, som nämnvärt överskrida deras självkostnader. Då de totala avgif- terna för den försålda kraften därjämte måste vara måttliga, saknas anledning till att sådana företags verksamhet skall annat än i minsta möjliga mån belastas med skatter. Bl. a. med hänsyn till det sagda kan det måhända visa sig lämpligt, att som villkor för statligt stöd föreskriva, att bokföring enligt enhetliga prin- ciper införes.

De kooperativa distributionsföretag, som genom sin taxepolitik ej erhållit medel för anläggningarnas underhåll, förnyelse och normala förstärkning, böra nu, om deras nät äro i otillfredsställande skick, principiellt i högre grad än om större avgifter uttagits, finansiera upprustning inklusive erforderlig förstärkning genom företagets eventuella likvida tillgångar, förnyade engångsavgifter eller normalt räntebärande lån —— i det följande tillsammans benämnda »eget kapitaltillskott». Detta har dock som regel icke stått klart för delägarna-konsumenterna, varför betydande svårigheter ofta föreligga i varje fall att uttaga nya engångsavgifter. Därtill medverkar det förhållandet, att företagen i regel successivt fått nya kon- sumenter under årens lopp och gjort tillhörande nätutvidgningar. Det är då oftast omöjligt att åstadkomma full rättvisa vid uttagandet av nya engångsavgifter och samtidigt få tillfredsställande finansieringsunderlag för erforderliga ombyggnader. Om upprustningsarbetena finansieras i större utsträckning medelst lån, måste tarifferna höjas så, att de räcka för förräntning av dessa lån. Bortsett från de nu rådande, betydande svårigheterna —— bl. a. med hänsyn till de ekonomiska säkerhetskraven _ att över huvud taget få lån för dessa ändamål uppträder då i dagens läge den olägenheten, att höjningar av tarifferna för nämnda ändamål sammanfalla i tiden med behovet av att höja tarifferna även på grund av steg- rade driftskostnader och råkraftkostnader. Därtill kommer att tarifferna i och

för sig måste bli relativt höga på grund av nuvarande uppdrivna byggnadskost- nader. För att upprustningen skall komma till stånd är det därför nödvändigt, att möjligheter skapas till såväl normalt räntebärande lån på enklare villkor än hittills som räntefria län eller bidrag utifrån. I pengar räknat torde de ränte— bärande lånen kunna överväga, emedan huvuddelen av det totalt erforderliga kapitalet med säkerhet kan göras räntabel genom företagens distributionsverk- samhet.

Anläggningar, som finansierats helt eller delvis med hjälp av statsbidrag, kunna ur taxeringssynpunkt icke avskrivas till den del, som motsvarar bidraget _ då icke detta upptages som inkomst. Om förnyelsemedel ändock genom kraftförsälj- ningsinkomsterna uttages för hela den ursprungligt anläggningskostnaden, med- för detta enligt gällande skattelagar beskattning. Enligt elkraftutredningens upp- fattning utgör detta förhållande en allvarlig olägenhet för kraftförsörjningen inom de mera svårelektrifierade delar av landsbygden, där statsbidrag för distributions- nätens byggande eller upprustning äro motiverade. Härigenom blir nämligen en strävan från bygden-s sida att för framtiden ordna sin kraftförsörjning på egen hand med successiva avsättningar för nätens vidmakthållande direkt motarbetad av staten. Åtgärder böra därför om möjligt vidtagas för att eliminera ovannämnda nackdelar.

Statsbidragen äro redan nu formellt förbundna med återbetalningsskyldighet och det torde icke kunna medföra några märkbara olägenheter om bidragen även reellt omformas till räntefria lån att amorteras eller återbetalas i sin helhet efter viss tid. Företagen skulle därigenom taxeringsmässigt få rätt att avskriva även de mot dessa lån svarande anläggningsdelarna och sålunda få möjlighet att utan ovannämnda skattekonsekvenser tillämpa taxor, som täcka även anläggningarnas förnyelse under förutsättning av någorlunda konstant penningvärde. Efterhand som ett räntefritt lån blivit återbetalat till staten får företaget begära nytt lån, dvs. förfara på samma sätt som efter åtenbetalning av ett normalt lån.

För staten innebär systemet med räntefria lån i stället för bidrag att det ut- lämnade kapitalet automatiskt kommer tillbaka och att före varje ny utbetalning ny undersökning kan göras beträffande det låntagande företagets ekonomiska förhållanden och behov av statligt stöd.

Med hänsyn till de tidigare nämnda nackdelarna med upptagande av förnyade engångsavgifter bör det icke förutsättas, att ett företag, som ursprungligen finan- sierats med engångsavgifter och som nu är i behov av nytt kapitaltillskott för anläggningarnas upprustning, skall fortsätta med detta finansieringssystem. En övergång till finansiering genom räntebärade lån bör kunna göras. Å andra sidan föreligger all anledning att för finansiering av upprustning utnyttja sådana för- nyade engångsavgifter, som konsumenterna frivilligt påtaga sig, antingen anled- ningen är den, att de därmed ernå en snabbare förbättring av sina distributions- förhållanden eller den, att de i gengäld erhålla lägre krafttaxa.

I vissa fall finns det anledning att sätta eget kapitaltillskott från företags- ägarna-konsumenterna som villkor för statligt räntefritt lån eller bidrag. Mot understödjande av nätupprustningarna med räntefritt kapital utifrån kan nämli- gen den invändningen riktas, att därmed incitament skapas för företagen att för- summa nätunderhållet och avsiktligt låta anläggningarna förfalla till dess att dylikt ekonomiskt stöd är motiverat för den erforderliga upprustningen. Vid kooperativt bedriven distribution få då konsumenterna under tiden betala mindre för kraften än de skulle fått göra, om underhållet skötts normalt. I sådana fall bör därför eget kapitaltillskott, beräknat med hänsyn till det underpris, som konsumenterna åtnjutit, kunna sättas som villkor för statligt räntefritt kapitaltill-

skott. Förutom att tidigare oberättigade förmåner därmed kunna kompenseras, torde förekomsten av en sådan föreskrift i varje fall minska risken för ett fram— tida försummande av nätunderhållet och därmed också undanröja nämnda in- vändning mot statligt understödjande av nätupprustningarna.

Det ovan sagda hänför sig i första hand till kooperativa företag. I princip samma förhållanden gälla även för icke-kooperativa distributionsföretag även om där frågan huruvida kapitaltillskottet på grund av tidigare underhållsförsummelse skall komma från företaget eller konsumenterna tillkommer och kan bedömas något olika. Att sätta engångsavgifler från konsumenterna hos icke—kooperativa företag som ett villkor för statligt räntefritt kapitaltillskott är icke lämpligt. Även när kapitaltillskottet från sådana konsumenter i princip kunde anses motiverade —— när tarifferna varit för låga för att möjliggöra underhåll samt normal förnyelse och förstärkning — måste hänsyn tagas till att konsumenterna icke genom med- bestämmanderätt i företaget haft möjlighet att påverka tariffsättningen och nät— arbetenas omfattning. (Vissa mellanformer ifråga om organisation förekomma dock, t. ex. aktiebolag, i vilka så gott som samtliga konsumenter äro aktieägare.)

Vid icke-kooperativa företag tillkommer det fallet, att tarifferna kunna ha varit tillräckligt höga för att möjliggöra förutom underhåll även successiv förnyelse och normal förstärkning, men att företagets ägare tagit ut alltför höga vinster och låtit nätet förfalla. Det kapitaltillskott från företaget, som även här bör sättas som villkor för statligt räntefritt kapitaltillskott, bör självfallet icke i ett dylikt fall avkrävas konsumenterna utan skall i princip tillhandahållas av företaget självt. Om svårighet föreligger för företagets ägare att ställa det erforderliga kapitalet till förfogande, bör det dock genom de förbättrade lånemöjligheterna bli möjligt för företaget att på egen bekostnad verkställa den upprustning, som blivit nödvändig genom tidigare försummat underhåll. Härvid kan företagets av— kastning för en kommande period sjunka till ett värde, som ligger under det normala. För det fall att företagets ägare icke är i stånd till eller önskar uppfylla på skälig grundval uppställda anspråk i nämnda avseende och gällande villkor för koncession icke äro uppfyllda _ exempelvis genom att de elektriska säker— hetsföreskrifterna åsidosatts kan koncessionen förklaras förverkad och distri- butionsverksamheten bli överlåten till annan. Nämnda förhållande torde även för företag av denna typ minska risken för ett framtida försummande av nätunder- hållet. :

Det må påpekas, att speciella frågor kunna uppstå, exempelvis vid förstärkning av rena belysningselektrifieringar, som av sociala eller andra skäl gjorts inom områden, som i själva verket kanske icke bort elektrifieras, då kostnaderna legat ovanför gränsen för vad som för närvarande kan anses rimligt. Att förstärka nätet till normal belastningsbarhct får i dylikt fall som regel anses ogenomförbart och bör betraktas som specialfall.

För täckning av upprustningskostnader ifrågakomma sålunda normala, ränte- bärande lån och räntefria kapitaltillskott. De senare kunna, förutom av likvida tillgångar hos företagen, utgöras av engångsavgifter från konsumenterna eller statliga räntefria län eller bidrag. Av skäl som anförts torde i detta sammanhang formen statligt räntefritt lån böra föredragas framför statsbidrag.

Förslag till principer för statligt finansiellt stöd åt upprustning av elektriska distributionsnät under provisorieliden

Storleken av det statliga räntefria kapitaltillskottet kan bestämmas efter två olika huvudprinciper, nämligen anläggningskostnadsprincipen, varvid kapitaltill-

skottet efter någon regel göres direkt beroende av upprustningsko'stnaden, eller årskostnadsprineipen, varvid kapitaltillskottet på ena eller andra sättet bestäm— mes med hänsyn till kostnaderna för den distribuerade kraften efter anläggning- arnas upprustning. Statligt räntebärande län är motiverat enbart då svårighet föreligger att på annat sätt anskaffa sådant kapital, som genom distributionsverk- samheten kan förräntas, och bör bestämmas med hänsyn härtill.

Att grunda tilldelningen av räntefritt kapital enbart på upprustningskostnaden har den fördelen, att reglerna kunna bli jämförelsevis enkla och i princip lika de hittills tillämpade reglerna för nyelektrifieringsbidrag. Å andra sidan får man med detta system icke den möjlighet att ta hänsyn till det verkliga behovet av statligt stöd, som erhålles då bedömningen grundar sig på årskostnaderna. Om upprustningsstödet skall möjliggöra icke endast att för tillfället rusla upp näten till önskvärd standard och belastningsbarhet utan även att näten för framtiden skola kunna bibehållas i gott tillstånd och detta med tillämpning av ett i någon mån utjämnat elkraftpris, måste hänsyn tagas till de verkliga kostnaderna för den distribuerade kraften efter upprustningens genomförande. Elkraftutredningen finner det därför önskvärt, att de räntefria kapitaltillskotten bestämmas med hänsyn till kostnaderna för den distribuerade kraften. Liknande synpunkter kunde självfallet också göras gällande beträffande bestämningen av stödet för nyelektrifiering, 'Inen elkraftutredningen finner ej anledning att upptaga denna fråga till behandling i föreliggande förslag för en provisorietid.

Vid bedömningen av ett företags behov av statligt stöd för upprustning av en större eller mindre del av sitt distributionsnät bör som regel företagets totala distributionsverksamhet tagas i betraktande, varigenom sålunda en utjämning av distributionsverksamhetens lönsamhet inom hela distributionsområdet som regel förutsättes. I konsekvens härmed förutsättes också, att ett distributionsföretag som regel skall tillämpa enhetliga tariffer inom hela sitt område.

Utöver ovanstående anser elkraftutredningen det ur rättvisesynpunkt vara ange- läget att vid bestämningen av det statliga stödet nödig hänsyn tages till de fakto- rer, som varit orsaken till nätets bristfälliga tillstånd. Därjämte bör skälig hänsyn även kunna tagas till olika sociala förhållanden, såsom befolkningens struktur och ekonomiska bärkraft.

För att det skall kunna bedömas, huruvida statligt stöd bör utgå till ett distri- butionsföretag för upprustning av dess nät, fordras i första hand kännedom om följande:

a) Nätets uppbyggnad och tillstånd, erforderliga upprustningsåtgärder och be- räknade kostnader härför.

b) Företagets tidigare finansiering och de tillämpade tarifferna, likvida till- gångar och kvarstående skulder.

c) Företagets möjlighet bedömd efter en preliminär undersökning att täcka kostnaderna genom företagets likvida tillgångar, engångsavgifter från konsu- menterna eller banklån. (1) En med hänsyn till beräknad framtida kraftuttagning genomförd räntabilitets- kalkyl för företaget i sin helhet, utvisande vilken grundavgift i normaltariffen, som företaget behöver hålla, om inga räntefria kapitaltillskott erhållas. (Det förutsättes att standardtarifferna enligt elkraftutredningens förslag, SOU 1947:4 tillämpas.) I första hand måste företagen själva svara för att erforderliga uppgifter i dessa avseenden samlas. För att bistå företagen med erforderlig sakkunnig hjälp och för nödvändiga lokala undersökningar rörande olika förhållanden, som aktuali-

)

seras genom begäran om statligt stöd, erfordras tillgång till sakkunnig och opar- tisk personal med lokalkännedom.

Det beslutande organet, som förutsättes bli elberedningen, får med ledning av inkomna uppgifter och efter nödvändiga kompletterande undersökningar avgöra, om projektet bör samordnas med rationaliseringsåtgärder, som beröra även andra företag. Förutsatt att de föreslagna upprustningsåtgärderna kunna anses leda till rationella distributionsförhållanden, att åtgärderna äro lämpliga med hänsyn till teknisk standard och tänkbara kommande rationaliseringar i större skala samt att de angivna kostnaderna äro skäliga med hänsyn till gällande priser och rim- ] liga med hänsyn till nätets uppgift, får elberedningen härefter avgöra hur stor ; del av de erforderliga penningmedlen, som företaget rimligen självt bör anskaffa I respektive hur stor del, som kan tillskjutas av staten genom räntebärande lån '

!

respektive genom räntefritt kapitaltillskott.

Statligt stöd i ena eller andra formen bör principiellt, under ovannämnda förutsättningar, kunna utgå, om svårighet att på annat sätt anskaffa erforderligt kapital föreligger eller om ombyggnaden resulterar i en nödvändig, allmän pris— höjning inom företagets område, medförande en alltför hög grundavgift. Även om statligt stöd sålunda bör lämnas endast i de fall, där upprustningsarhetet i allt väsentligt kan anses vara ett led i en önskvärd, mera vittgående rationalisering och där dennas uppdelning i etapper icke medför kostnadsökning av betydelse, må dock i särskilda ömmande fall stöd kunna lämnas även för en mera proviso- risk upprustning.

I princip bör följande riktlinjer för den statliga stödverksamheten för upp— rustning av landsbygdens distributionsnät kunna tillämpas.

Statligt räntebärande lån mot normal statlig utlåningsränta bör kunna utgå, om svårigheter föreligga att finansiera ombyggnaden på annat sätt. Det statliga räntebärande lånet bör icke överstiga den del av det för upprustningen totalt erforderliga kapitalet, som genom företagets verksamhet kan göras räntabelt med tillämpning av skäliga tariffer.

Statligt räntefritt lån bör kunna utgå, om det erforderliga elkraftpriset enligt ovannämnda räntabilitetskalkyl överstiger den övre gränsen för ett normalt el- kraftpris. Det räntefria lånets storlek bör med beaktande av efterföljande maxi- meringsregler kunna bestämmas som det kapital, som vid avsedd utbyggnad och verklig kostnad härför erfordras för att elkraftpriset skall reduceras till nämnda gränsvärde. Vid bedömandet av om och i vad mån räntefritt lån skall utgå, bör hänsyn även tagas till hur stor del av upprustningskostnaden, som med hänsyn till tidigare kapitalförbrukning och kraftavgifter skäligen bör täckas genom kapitaltill- skott från företagets ägare och från konsumenterna. Bortsett från den inverkan, som företagets tidigare finansiering och kraftavgifter sålunda kunna ha kan ovan— stående med hänsyn till dagens prisläge (januari 1953) uttryckas så, att räntefritt lån bör kunna utgå, om den kalkylerade grundavgiften i normaltariffen överstiger 12:— kr/Nte. Det räntefria lånets storlek bör då maximalt kunna utgöra det kapital, som erfordras för att grundavgiften skall reduceras till 12:—— kr/Nte.

För ovannämnda lånetyper böra gälla särskilda, för låntagaren förhållandevis gynnsamma säkerhetsbestämmelser.

Det räntefria lånet bör icke överstiga den verkliga aktuella upprustningskost- naden och bör normalt, per tariffenhet räknat, icke överstiga ett av Kungl. Maj:t angivet belopp. Nämnda belopp synes för närvarande kunna utgöra 200:—— kr/Nte.

Som tidigare framhållits böra engångsavgifter från konsumenterna kunna eval- veras till en förhöjd grundavgift. I de fall företagen och konsumenterna så finna lämpligt, böra engångsavgifter också kunna inbetalas med högre belopp än som

www, . '

.- m..—_em_

-m,

vore erforderligt enligt elberedningens skälighetsbedömning, varigenom grund- avgiften kan sänkas. Vid behov kan, enligt ovanstående regler, statligt ränte- börande lån utgå för täckande av det mot engångsavgifterna svarande kapital- behovet.

I samband med en nätombyggnad kunna olika rationaliseringsåtgiirder av större omfattning —— exempelvis sammanslagning av företag befinnas lämpliga. Elbe- redningen bör då samtidigt upptaga denna fråga till behandling, särskilt om ombyggnaden därigenom lämpligen borde utföras på annat sätt. Vid samman- slagningar bör följande beaktas. Principiellt böra de statliga stödåtgärder, som skulle komma ifråga för det ena företaget, om en rationalisering genom samman- slagning icke vore aktuell, vidtagas separat och oberoende av om sammanslag- ningen i och för sig ger förbättrade ekonomiska förutsättningar för det sålunda rationaliserade, större företaget. Omfattningen av stödet bör dock i dylikt fall begränsas med hänsyn till de besparingar, som ernås genom sammanslagningen. Genom denna regel torde möjligheterna att på frivillig väg åstadkomma samman- slagningar mellan företag med olika ekonomiska förhållanden och olika standard på anläggningarna underlättas.

Där skäl därtill föreligga böra ovannämnda regler för statligt stöd av nätupp- rustningar kunna tillämpas retroaktivt beträffande upprustningar, verkställda efter det att detta förslag blivit offentliggjort.

I likhet med vad som gäller beträffande nyelektrifieringsbidragen bör elbered- ningen för lämpliga tidsperioder utverka beslut rörande storleken av de belopp, som innefattas i ovannämnda regler.

Förslag till principiella ändringar i bestämmelserna för statslån och statsbidrag

För att underlätta företagens möjligheter att finansiera en upprustning av distributionsnäten bör som nämnts statliga räntebärande lån och statliga ränte- fria kapitaltillskolt kunna ifrågakomma. Båda dessa stödformer tillämpas redan' nu, dock i begränsad utsträckning. De räntefria kapitaltillskotten ha för när- varande för nyelektrifieringar formen bidrag utan preciserad återbetalningsskyl- dighet medan de enligt föreliggande förslag vad beträffar upprustning av befint- liga distributionsnät böra utgöras av räntefria lån med preciserad återbetalnings- skyldighet.

Även om en omedelbar övergång från bidrag till räntefria lån för nyelektrifie- ringar icke föreslås i detta sam-manhang bör för framtiden räntefria lån kunna utdelas jämväl i dylika fall av statligt stöd. En övergång helt eller delvis kan behöva förberedas av elberedningen.

Statsbidrag i nuvarande form bör för såväl nyelektrifiering som upprustning enligt elberedningens bedömning kunna tillämpas för smärre fristående kapital- behov.

Räntebärande lån för bestridande av kostnader för kraftledningsnät kan för närvarande erhållas ur kraftledningslånefonden. Villkoren äro emellertid icke så gynnsamma, att möjligheterna att erhålla statslån utnyttjas i nämnvärd omfatt- ning. Den 1 juli 1952 uppgick de utestående lånen från kraftledningslånefonden till sammanlagt 2 832 000 kronor och de för ytterligare utlåning disponibla kapi- taltillgångarna till 3 955 000 kronor.

Det kan, som framhölls i elkraftutredningens skrivelse den 27 november 1950, antagas, att lånevägen skulle utnyttjas i stor omfattning och vara tillräcklig för att tillgodose finansieringsbehoven i flertalet fall, därest gällande bestämmelser för kraftledningslånefonden ändrades i vissa avseenden. För att möjliggöra ett

rationellt utnyttjande av kraftledningslånefonden även för upprustning av distri- butionsnät i enlighet med de principiella riktlinjer beträffande räntebärande lån, som föreslagits i föregående avsnitt av denna skrivelse, får elkraftutredningen härmed föreslå en modifiering av bestämmelserna för fonden enligt följande principer: 1) Kretsen av de läneberättigade bör ej vara begränsad på det sätt, som nu for-

2)

3)

4)

mellt är stadgat, utan varje distributionsföretag, som befinnes vara för ända- målet lämpligt organiserat, bör kunna beviljas län. De ändamål, vartill lånemedlen mä användas, böra ej vara begränsade till enbart anläggande på landsbygden av distributionsnät för elektrisk energi, utan lån bör även kunna beviljas för förnyelse, omläggning eller förstärkning av dylika nät. Säkerhetsbestämmelserna för lånen böra göras för låntagaren gynnsammare utan att för den skull förlustrisken för långivaren-staten i'realiteten ökas. I regel bör härvid såsom säkerhet kunna godtagas _ bortsett från borgen av kommun _ inteckning i den fastighet, vartill anläggningen anses höra efter registrering enligt lagen den 22 juni 1920 med vissa bestämmelser om registre- ring av elektriska anläggningar samt om rätt till elektrisk kraft m. m.

Med hänsyn till att flertalet distributionsnät icke äro registrerade på detta sätt och den omständliga procedur det utgör att registrera elektriska anlägg— ningar enligt nämnda lag bör, i avvaktan på att registrering hinner verkställas, dylik inteckning i stationsfastighet kunna godtagas, även om det ekonomiska värdet därav till en början är obetydligt, under förutsättning att säkerheten kompletteras genom annan enklare form av garanti enligt elberedningens bedömande. Den omständigheten att lånet icke överstiger den del av det för upprustningen totalt erforderliga kapital, som genom företagets verksamhet beräknas kunna göras räntabelt, samt att lånemedlens användning för upp- rustningen ävensom företagets taxor och verksamhet i övrigt kontrolleras av elberedningen eller av denna anlitad, sakkunnig person, bör därvid under den tid det tar att ordna registrering kunna vara tillfyllest. Låntagaren bör dess- utom förbinda sig att enligt elberedningens anvisning vidtaga åtgärder för nätets registrering, att icke utan elberedningens godkännande sälja anlägg- ningen eller del därav samt att ställa sig till efterrättelse elberedningens anvis- ningar beträffande tariffsättningen.

Säkerhetskraven böra vara oberoende av om företaget erhåller råkraft från statens ledningar eller från ledningar tillhörande annan råkraftleverantör.

Med hänsyn till det ovan sagda synes det även lämpligt att lagen den 22 juni 1920 beträffande registrering överses genom kommerskollegii försorg. Läneräntan utgör enligt nu gällande bestämmelser fyra procent. I skrivelsen ' den 27 november 1950 föreslog elkraftutredningen, att låneräntan i dåvarande

5)

6)

läge skulle sänkas med omkring en halv procent. Med hänsyn till de nu något ändrade förutsättningarna anser elkraftutredningen dock, att anledning för närvarande saknas att ändra räntebestämmelserna för denna lånefond. Återbetalningen av länet bör kunna ske efter en mellan elberedningen och låntagaren överenskommen amorteringsplan, möjliggörande anpassning till företagets amorteringsförmäga. Prövningsmyndigheten bör, som föreslagits i skrivelsen den 27 november 1950, utgöras av elberedningen ensam. I bifogade bilaga — har elkraftutredningen närmare preciserat de föreslagna ändringarna i bestämmelserna för kraftledningslånefonden.1

1 överensstämma i huvudsak med utkast till kungörelse, s. 40.

m_s-_ Uzaiufn.fu maar—_. : .

Räntefritt kapitaltillskott har sedan tolv år tillbaka utgått i form av statsbidrag från nionde huvudtitelns reservationsanslag till Befrämjande av landsbygdens elektrifiering, men dessa bidrag avse som nämnts i princip endast nyelektrifie- ring. Som nämnes i förutnämnda nådiga brev den 30 maj 1952 har Kungl. Maj:t dock, i avvaktan på det förslag vartill elkraftutredningens utredning kan giva anledning, möjlighet att i särskilda fall bevilja bidrag för upprustning av befintligt distributionsnät.

För närvarande, under budgetåret 1952/53, gälla de grunder för beviljande av statsbidrag från nämnda anslag, som finnas fastställda i nådigt brev till stats- kontoret den 31 oktober 1952 med hänvisning till elektrifieringsberedningens skrivelse till Konungen den 4 juni 1952.

Elkraftutredningen får härmed av skäl som i det föregående angivits föreslå, att från och med den 1 juli 1953 förutom dylika stats-bidrag räntefria lån för *, understödjande av såväl nyelektrifiering som upprustning av befintliga distribu- ' tionsnät må kunna utgå från en särskild för ändamålet inrättad lånefond, för— . slagsvis benämnd >>elnätstödlånefonden». För denna lånefond bör kunna gälla i . huvudsak lika bestämmelser som för kraftledningslånefonden med den väsent- i ligaste skillnaden att räntan här sättes lika med noll.

I bifogade bilaga _— har elkraftutredningen närmare preciserat de föreslagna riktlinjerna för bestämmelser för clnätstödlånefonden.1 För åtnjutande och lyftande av statsbidrag för nyelektrifiering gälla för när— ? varande av elberedningen den 19 november 1952 fastställda villkor. Analoga vill- , kor för statliga lån från ovannämnda båda lånefonder höra, i enlighet med i denna skrivelse lämnade principer, utarbetas av elberedningen i samråd med kommerskollegium och statskontoret samt framläggas för Kungl. Maj:t.

Elkraftutredningens skrivelse den 26 januari 1953 utmynnade sålunda i förslag till åtgärder i syfte att snarast få till stånd en vidgad statlig medver- kan för en förbättrad elkraftförsörjning på landsbygden med en förstärkt elektrifieringsberedning som tillfälligt verkställande organ under en över- gångsperiod, benämnd provisorietid. Härför skulle, förutom nödiga anslag, bl. a. erfordras ändring av bestämmelserna för lån från kraftledningslåne- fonden, inrättande av en ny stödlånefond samt översyn av lagen den 22 juni 1920 med vissa bestämmelser om registrering av elektriska anläggningar samt om rätt till elektrisk kraft m. m.

I remissutlåtandena vitsordas samstämmigt behovet av omfattande upp— rustningsarbeten samt av statliga åtgärder av i allt väsentligt den beskaf- fenhet, som elkraftutredningen föreslagit. Elkraftutredningen finner icke anledning att närmare referera remissutlåtandena härutinnan.

I olika delfrågor framföras även kritiska synpunkter och motförslag. Detta gäller i första hand sättet för de statliga, finansiella stödåtgärderna, dvs. stöd genom lån, vilket till viss del skulle kunna bli räntefritt. Man ut- talar sig i ett flertal fall för statligt bidrag av den typ, som nu förekommer som stöd för nyelektrifieringar, i stället för de räntefria lånen.

Kommerskollegium framhåller olika fördelar respektive nackdelar med ränte- fritt lån jämfört med bidrag men stannar vid att åtminstone tills vidare under

1 Överensstämma i huvudsak med utkast till förordning, s. 37.

provisorietiden bidragsformen bör användas. Vad som främst talar mot räntefria lån med årliga amorteringar är enligt kollegium att denna form av stöd icke är tillräcklig i många fall samt dessutom att den medför ökat arbete för den nöd- vändiga kontinuerliga kontrollen över företagens ekonomiska förhållanden. Kolle— gium förutsätter dessutom, att skattetekniska faktorer icke skola behöva vara utslagsgivande.

Statskontoret tillstyrker statligt stöd genom såväl räntebärande som räntefritt län men anser, att bidragsformen då bör avvecklas (för att undvika onödig splittring av de statliga stödåtgärderna). Genom att icke strängt fixera maximi— gränsen för grundavgiften skulle man kunna undvika alltför små, räntefria lån.

Vattenfallsstyrelsen anser, att formen räntefritt lån icke har några sakliga för- delar, som kunna motivera komplikationerna i formellt och administrativt hän- seende, och föreslår därför i stället bidrag. Styrelsen anser ej att det förhållandet, att lånet medför avskrivningsmöjlighet, har någon praktisk betydelse.

Länsstyrelsen i Hallands län framför synpunkten att de räntefria lånen kunna utbytas mot räntefria avskrivningslån, som avskrivas med exempelvis 1/1o årligen, då enbart amorteringslån icke synas kunna lämna erforderlig hjälp.

Genom länsstyrelserna i Västerbottens och Norrbottens län kommer den åsikten fram att det i vissa fall, speciellt för många distributionsföretag i övre Norrland, blir nödvändigt att avstå från kravet på amortering av de räntefria kapitaltill- skotten.

Elektrifieringsbere(Intrigen ifrågasätter lämpligheten av att under en provisorie- tid införa nya former för bidragsverksamheten (räntefritt lån i stället för rent bidrag), särskilt som en omläggning kommer att innebära en komplikation och medföra ökat administrativt arbete. Beredningen påpekar därför att en omlägg- ning bör göras endast under förutsättning att uppenbara fördelar vinnas här- igenom. Beredningen pekar på uppgiften att övervaka amorteringsskyldighetens fullgörande och att vidtaga åtgärder i de fall då allt icke går planenligt. Det framhålles, att det räntefria lånet till sitt absoluta belopp blir större än det dl- rekta bidraget.

Riksförbundet landsbygdens folk föreslår, att företagen skola få möjlighet att insätta medel för förnyelse av anläggningarna på spärrkonto i bank, varvid med- len (även om de icke utgjorde avskrivningsmedel) skulle vara skattefria under vissa förutsättningar.

Elverksföreningen och vattenkraftföreningen anse icke att tillräckligt starka skäl föreligga att nu tillämpa en ny stödform, dvs. räntefria lån, och rekommen- dera därför i stället rena bidrag vid behov. Ur beskattningssynpunkt anses inga olägenheter föreligga, enär det mottagande företaget kan göra en mot bidragsbe- loppet svarande, omedelbar nedskrivning av anläggningskostnaden (upprustnings- kostnaden), som nästan undantagslöst torde investeras i lös egendom. Efter en sådan nedskrivning, säga föreningarna i sitt gemensamma yttrande, blir behovet av fortsatta, årliga avskrivningar vid anläggningens successiva förslitning i mot- svarande mån minskat. Föreningarna påpeka att lånebeloppet måste bli större än bidragsbeloppet vid samma stödeffekt, vilket för staten skulle medföra en onödigt stor risk.

Ångpanneföreningarnas centralorganisation anser det lämpligare med bidrag än med räntefritt lån, åtminstone under den ifrågasatta provisorietiden, men fram- håller dock starkt nödvändigheten av att göra tillräckliga avskrivningar och åstadkomma erforderliga förnyelsefonder.

... _ .. f. 4..._._—...4_...._—1.>.

J...-...a. . . -

. : ('.: 'a'-FL": —w.' 'MC-Luaän

Med hänvisning till vad som sagts beträffande företagens självkostnader och kostnadstäckningen i kap. 4 (s. 119—124) får elkraftutredningen fram- hålla följande.

En statlig ekonomisk stödverksamhet på elkraftförsörjningens område kan och bör syfta till att kraftförsörjningen snarast möjligt blir självbä- rande under sunt affärsmässiga former. Stödverksamheten kan baseras på såväl ränte- och amorteringsfria kapitalbidrag som räntefria lån —— även ; andra stödformer kunna tänkas, exempelvis årliga driftbidrag med möj- l lighet att i de olika fallen uppnå samma reella ekonomiska stödverkan. De £ olika formerna för en stödgivning kunna erbjuda olika fördelar och nack— delar med hänsyn till bl. a. den ekonomiska risken för stödgivaren och det administrativa arbetet men även med hänsyn till de rent psykologiska faktorer, vilka sammanhänga med att en affärsverksamhet — som i prin- cip bör vara självbärande och där de för verksamheten ansvariga höra till- fullo känna även det ekonomiska ansvaret —— under en längre eller kortare tid avlastas från en del av sina kostnader.

Det har redan i kap. 4 (s. 122) framhållits, att det enligt elkraftutred— ningens uppfattning är av icke oväsentlig betydelse att stödet endast om det är nödvändigt får sådan form, att det kan sammanställas med en ka- pitalförbrukning. Även bland ovannämnda kritiker synes en allmän upp— fattning vara 1) att företagen skola räkna kostnaden för den fulla förnyelsen av sina anläggningar som en sådan kostnad, som i princip skall täckas genom de årliga kraftförsäljningsinkomsterna, 2) att detta skall gälla även om anläggningarna helt eller delvis finansie— rats med hjälp av kapitaltillskott från staten, 3) att ovanstående skall kunna ske utan tillkommande beskattning.

Med hänsyn till de rent ekonomiska faktorerna har elkraftutredningen samma uppfattning, som kommit till uttryck i ovannämnda remissvar, näm- ligen att stödverksamheten med likvärdigt resultat kan bygga på kapitalbi- drag i stället för räntefritt län. I lånealternativet måste det utbetalade stöd- beloppet bli större än ett bidrag med samma stödverkan. Detta är ur vissa synpunkter en nackdel. På längre sikt blir dock statens uppoffring i de båda fallen densamma. I bidragsalternativet kan staten få räkna med att till- skjuta nytt bidrag för förnyelse av anläggningarna sedan dessa blivit ut- slitna, medan i lånealternativet staten kan få räkna med att tillhandahålla nytt räntefritt lån efter hand som en väsentligare del av det förra återbetalats och företaget är i behov av förnyelsemedel. Att lånebeloppen äro större än bidragsbeloppen kompenseras av att lånen successivt återbetalas. Skattefri avskrivning kan i princip icke göras för en med bidrag bekostad anlägg- ning (eftersom den redan från början betraktas som avskriven). Något skatteproblem behöver dock i realiteten icke uppstå i någotdera stödfallet så länge icke verksamheten, totalt sett, lämnar något överskott, vilket emel-

lertid betyder att man i bidragsalternativet icke räknar med förnyelsekost- nader för den del av anläggningen, som finansierats med bidrag. Lånefor- men medför givetvis större administrativt besvär än bidragsformen. Besvä- ret torde dock icke bli större för de statliga räntefria lånen än det är för de redan löpande statliga räntebärande länen. Genom det ökade administra- tiva arbetet erhålles också åtminstone en viss kontroll på hur företagens ekonomi skötes efter nätens byggande respektive upprustning.

Dikussionen kan närmast anses gälla frågan om det är lämpligast att stöda verksamheten genom ett gåvokapital, för vilket stödtagaren icke har några kapitalkostnader och vilket, när det är förbrukat, skall efterföljas av ett nytt likadant kapital (om fortsatt stöd erfordras), eller genom ett större lånekapital, för vilket räntan är noll men återbetalningsskyldighct finnes och vilket, när det är återbetalat, skall efterföljas av ett nytt likadant lån (om fortsatt stöd erfordras; eljest av ett normalt lån). Med de ut— gångspunkter beträffande självkostnader och kostnadstäckning, som el— kraftutredningen angivit i kap. 4, och med beaktande av att den statliga stödverksamheten i största möjliga utsträckning bör få karaktären av en temporär hjälp till elkraftförsörjningen att bli självbärande, har utred- ningen den uppfattningen att det räntefria länet är en i princip lämpligare stödform än bidraget, ehuru i de enskilda fallen bidrag mycket väl kunna vara såväl lämpliga som många gånger nödvändiga.

Det må observeras att för en stor del av den distributionsverksamhet, som enligt förslaget skall kunna bli föremål för statligt upprustningsstöd, kommande rationalisering av större omfattning, med möjlighet att ytterli- gare sänka de specifika självkostnaderna, äro högst sannolika. Med ratio— nalisering åsyftas i detta sammanhang framför allt en ombildning av fö- retagen till större enheter med större ekonomisk bärkraft och större möj- ligheter till kostnadsutjämning mellan goda och mindre goda områden. Som framhållits i elkraftutredningens skrivelse och som närmare behand- las i detta betänkande räknar utredningen kommande rationalisering i större skala som absolut ofrånkomlig. De ekonomiska stöd som lämnas till distributionsföretagen komma därigenom i flertalet fall att kunna vara av övergående karaktär. För att stödgivningen i minsta möjliga mån skall inverka på ett företags möjligheter att beräkna och täcka sina självkost- nader på ett affärsmässigt riktigt sätt är det lämpligt att i första hand stöda genom räntefritt lån, även om detta är administrativt mera kompli- cerat än ett engångsbidrag. Genom det räntefria lånets amortering upphör successivt det statliga stödet. Förnyelsekostnaden för anläggningen i dess helhet, vilken kostnad huvudsakligen bestämmes av anläggningens tekniska utförande och livslängd, kan emellertid medtagas i företagets kostnadskal- kyler redan från början liksom även de verkliga räntekostnaderna, vilka tid för tid äro beroende av vad slags kapital anläggningarna äro finansierade med.

.:.» .w. ml.—.a; ...-m= . ,,...yv.

_: 1! ...a-::.. 'I : =».

Den stödverkan, som kan erhållas genom räntefria men amorteringsplik— tiga län, är emellertid begränsad. I första hand är den beroende av amor— teringsvillkoren. Eftersom stödet, räntefriheten, automatiskt upphör efter- hand som lånet återbetalas är det givet att möjligheten att få önskad stöd- verkan med tillämpning av ett räntefritt lån, vars belopp är begränsat till i huvudsak anläggnings— eller upprustningskostnaden, ökar ju längre låne— tiden är och ju gynnsammare amorteringsvillkoren i övrigt äro. För låne- tiden har i provisorieförslaget — i bestämmelserna för lånefonden före- slagits samma villkor som i kraftledningslånefonden, dvs. maximalt 30 år. Beträffande amorteringen har förutsatts en årlig amortering efter två amor- teringsfria år men det har lämnats elberedningen en viss handlingsfri- l het ifråga om amorteringstakten. Det kan dock ifrågasättas om det med

hänsyn till andra omständigheter är lämpligt att avvika från annuitets— principen, vilken här innebär amortering med lika belopp varje år, bortsett från de två första åren. En förlängning av den maximala lånetiden till 40 ; år skulle emellertid kunna vara motiverad, speciellt med hänsyn till den ' i jämförelse med förhållandena när kraftledningslånefonden instiftades _— förbättrade standarden på ledningsnäten och den därigenom ökade ge- nomsnittliga livslängden. I vilken utsträckning stödformen räntefritt län är användbar är givetvis också beroende av hur långt staten bör sträcka sig i stöd, dvs. till vilken gräns stödet avses kunna nedbringa den erforder- liga grundavgiften.

Vid särskilt dyrbara anläggningar är det sålunda uppenbart att ränte— fria lån icke kunna utgöra tillräckligt stöd för en upprustning, enär före- tagens årskostnader, om lån av maximistorlek skulle utlämnas, ändock skulle bli orimligt höga. På grund av områdenas karaktär finnes ofta ej heller någon möjlighet till rationalisering genom sammanslagning med an- nat företag, utom möjligen råkraftleverantören. Där lån icke ge tillräckligt stöd kan det bli nödvändigt med amorteringsfritt bidrag om en upprustning skall kunna genomföras.

Elkraftutredningen är sålunda av den uppfattningen att den statliga ekonomiska stödverksamheten för ifrågavarande ändamål i första hand bör bestå i att lämna lån, som till erforderlig del efter vederbörlig prövning lämnas räntefritt. I den mån distributionsverksamheten icke är och ej heller genom rörelsens utveckling, blivande rationalisering i större skala etc. be- räknas kunna komma i det ekonomiska läge att låneamortering kan ske med tillämpning av rimliga tariffer, bör emellertid stödet kunna utgå såsom bidrag. De tre formerna räntebärande lån, räntefritt län samt bidrag böra sålunda kunna tillämpas. Det bör ankomma på den prövande myndigheten att, med beaktande av den principiella huvudregeln att distributionsverk- samheten inom hela företaget skall hjälpas att bli självbärande, utarbeta så enkla detaljregler som möjligt för stödverksamheten. Eftersom stödgiv— ningen skulle bl. a. bygga på en bedömning av rörelsens möjligheter att

utvecklas till ökad ekonomisk bärkraft, bör möjlighet finnas att, sedan nå- gon tid förflutit, på begäran av stödtagaren och efter vederbörlig prövning göra en överflyttning av lånemedel till bidragsmedel.

Även ifråga om de ekonomiska gränserna för den statliga stödverksam- heten samt ifråga om räntefoten för de räntebärande lånen ha avvikande uppfattningar framförts.

Kommerskollegium föreslår att de ekonomiska gränsvärdena icke skola fixeras förrän senare när erfarenhet från verksamheten vunnits. Till en början anses det tillräckligt att fastslå att summan av statligt räntebärande och räntefritt kapital- tillskott ej skall få överstiga summan av upprustningskostnaden och företagets äldre lån för den upprustade anläggningen eller anläggningsdelen.

Vattenfallsstyrelsen anser, att den taxenivå, som skall utgöra riktpunkt för be— stämningen av räntefritt kapitaltillskott, icke skall fixeras nu, eftersom inflytandet därav på stödverksamhetens effektivitet ännu är oklar. Icke heller bör, enligt styrelsen, maximigränsen för de räntefria kapitaltillskotten fastställas, innan upp- rustningsstödets funktioner kunna fullständigt överblickas. Styrelsens åsikt synes grundad på uppfattningen, att verksamheten från början skall bindas så litet som möjligt av definitivt utformade föreskrifter och att Kungl. Maj:t sedermera, efter förslag av elberedningen, skall fastställa de detaljerade låne- och bidrags- normerna.

Länsstyrelserna i Stockholms, Östergötlands, Hallands och Örebro län samt Riksförbundet Landsbygdens folk anse, att den valda gränsen för grundavgiften. 12 kr/Nte/år, är för hög och sålunda medför otillräckligt stöd. Man synes förorda en gräns för grundavgiften, som motsvarar det för orten normala priset, eller den grundavgift, som tillämpas av de ledande kraftföretagen, t. ex. vattenfalls- verket. RLF framhåller, att följden av att tillämpa för högt gränsvärde torde bli dels att distributionsföreningarna finna det fördelaktigare att upplösa sina för- eningar och överlåta distributionen till vattenfallsverket eller något annat stor- företag, som håller lägre grundavgift än 12 kr/Nte/år, dels att önskvärda upprust- ningar, om en dylik överlåtelse icke kan komma till stånd, uppskjutas på en obestämd framtid.

Länsstyrelsen i Norrbottens län framhåller, att den övre subventionsgränsen, 200 kr/Nte, är för låg för att man verksamt skall kunna hjälpa företagen i länets inland. Länsstyrelsen ifrågasätter emellertid också, om icke många av dessa företag böra övertagas av staten, varigenom en utjämning med övriga, i dessa avseenden gynnsammare landsdelar kan åstadkommas.

Elelctrifieringsberedningen anser att lämnandet av statligt stöd vid upprustning icke bör åtföljas av någon bestämd förutsättning att >>övertaxor>> skola tillämpas —— anser troligen 12-kronorsgränsen olämplig jämförd med exempelvis vatten- fallsverkets 9:50 kr/Nte/år. Beredningen åberopar bl. a. reglerna för nyelektrifie- ringsbidrag, som icke grunda sig på årskostnader och erforderliga taxor. Bered- ningen påpekar också att sammanslagning av ett mindre och ett större företag (det större förutsättes ha en förhållandevis låg grundavgift) kommer att bli svå- rare att genomföra ju högre gränsvärdet väljes.

Elektrifieringsberedningen kritiserar vidare maximeringsreglerna. Beredningen påpekar att stödet (räntefria lånet), omräknat till direkt bidrag, blir vid normala antaganden betr. räntefot och amorteringstid begränsat till maximalt cirka 65 % av upprustningskostnaden och att 200 kr/Nte som räntefritt lån endast motsvarar cirka 130 kr/Nte som direkt bidrag. Dessutom ställer sig beredningen undrande till vad som skall göras när spärrvillkoren verka. Beredningen anser, att spärr-

...a—___... .... .../...",.-1

:).-'.»..- R.H.—.:nnul.m1;.T-.r.g . '.'—"_;=_L=:m Hm.-'n

", min.-::.!

villkoren innebära principiell avvikelse från tanken att åstadkomma bedömning efter räntabilitetskalkyl med given taxa och framhåller att den praktiska effekten av det föreslagna subventionssystemet med spärrvillkoren blir mycket egenartad. För företag där driftsekonomin redan under normala förhållanden än vansklig,

blir hjälpen otillräcklig. Beredningen anser emellertid att en spärregel för bidrag - bör gälla nämligen »maximalt upprustningskostnaden jämte (om så erfordras)

företagets eventuellt befintliga skulder». Det framhålles att spärrvillkoret på lämpligt sätt måste omfatta lån och bidrag gemensamt. I detta sammanhang påpekar elberedningen att vad som skall göras i de fall, då villkoret ej medger nödigt bidrag, måste tillsvidare lämnas öppet.

Elverksföreningen och vattenkraftföreningen anse dels att grundavgiftsgränsen borde höjas från 12 till ca 15 kr/Nte/år, dels att en maximigräns i kr/Nte är olämplig. Begränsningen av bidragsgivningen bör kunna ligga enbart däri att visst belopp per år ställes till den prövande (beviljande) myndighetens förfogande. Även Ångpanneförem'ngarnas centralorganisation ifrågasätter en höjning av grund— avgiftsgränsen.

Låneräntan för de räntebärande lånen bör enligt några förslag sänkas med ungefär %> %.

Emedan grundavgiften i normaltariffen ingalunda är standardiserad (ex— empelvis till det belopp, som vattenfallsverket tillämpar, f. n. 9: 50 kr/Nte/ år), är det i och för sig fullt naturligt, att olika distributionsföretag, med olika självkostnader för distributionsverksamheten, tillämpa olika grund- avgifter. För att icke olikheten i strömkostnader i olika landsdelar skall bli alltför stor är det dock önskvärt med en viss utjämning. Man torde sålunda kunna säga att, om grundavgiften håller sig inom vissa gränser, strömkost- naderna få anses vara normala och anledning saknas då att medelst statligt stöd åstadkomma någon ändring. Med tanke på att en grundavgift på 9 å 10 kr/Nte/år tillämpas inom tämligen stora delar av landet —— speciellt inom de större företagens detaljdistribution, som på grund av rationella distri- butionsförhållanden uppvisar jämförelsevis låga specifika kostnader har elkraftutredningen ansett, att den övre gränsen för en normal grundavgift borde kunna sättas till 12 kr/Nte/år, varigenom en rimlig utjämning borde kunna åstadkommas. En justering av denna gräns är självfallet motiverad i den mån de genomsnittliga kostnaderna för landsbygdsdistributionen mera väsentligt avvika från angivna utgångsvärden. Elkraftutredningen vill här- vidlag åter hänvisa till sitt principnttalande i kap. 4 beträffande självkost- nader och kostnadstäckning.

Att maximera stödet till ett bestämt belopp per normaltariffenhet är i och för sig onödigt vid det föreslagna subventionssystemet. Att elkraftut— redningen ändock i förslaget angivit en dylik >>normal>> övre subventions- gräns 200 kr/Nte, beror på en önskan att under provisorietiden, då behovet av rationaliseringar icke kunde förväntas alltid bli helt beaktat, automatiskt få en signal för särskilt dyrbara projekt, vilka borde ge anledning till mera ingående behandling. Vid en stödverksamhet, som är fastare samordnad med en samtidig rationalisering i vidsträckt bemärkelse, är det tillräckligt

att, som bl. a. kommerskollegium och elberedningen föreslå, maximera låne- och bidragsbeloppen gemensamt till upprustningskostnaden jämte. (om så erfordras) företagets eventuellt befintliga skulder.

För ett stort antal företag i övre Norrland erfordras med säkerhet stöd- åtgärder, som gå utöver vad som kan lämnas med direkt tillämpning av de framlagda reglerna. Som framhållits i elkraftutredningens förslag finnas emellertid specialfall, som fordra särskild behandling, och dessa norrlands- företag böra räknas dit. Det är icke givet, att dessa företag böra konserveras genom omfattande statligt stöd, utan en »sammanslagning» med råkraft- leverantören kanske är ur alla synpunkter det bästa.

Att vid stödgivningen hänsyn skulle tagas till tidigare finansiering och tillämpade taxor kritiseras också i någon mån av länsstyrelserna i Hallands och Älvsborgs län.

Länsstyrelsen i Älvsborgs län anser, att de undersökningar som erfordras för detta kunna bli mycket betungande samt att syftet med hänsynstagandet är delvis förfelat och kan i övrigt uppnås på annat sätt. Någon ökad rättvisa olika företag och konsumenter emellan kan sålunda enligt länsstyrelsen icke uppnås härigenom. Åtgärderna (reducering av det statliga stödet) få karaktär av straff, som går ut över nuvarande och framtida konsumenter. Risken att företagen avsiktligt skola låta näten förfalla i förhoppning att därefter få nytt räntefritt lån anser läns— styrelsen obetydlig. Det påpekas att utebliven årsamortering av det räntefria lånet ger tillräckligt klart besked, huruvida taxorna hålles så låga, att nätets underhåll försummas. Dessutom erinrar länsstyrelsen om att det förutsättes att ny under- sökning göres beträffande det låntagande företaget innan detta erhåller fyllnads- lån motsvarande amorterad del av stödlånet.

Principen att hänsyn skall kunna tagas till de faktorer, som varit orsaken till nätets bristfälliga tillstånd, liksom till sociala förhållanden etc. torde få anses vara av betydelse dels för att få stödverksamheten i mesta möjliga mån rättvis. dels och kanske framför allt för att minska risken för ett fram- tida försummande av nätunderhållet.

Den ytterligare kritik, som framfördes över elkraftutredningens >>proviso— rieförslag», var av mindre principiell betydelse.

Vattenfallsstyrelsens övrenorrlandsntredning 1952—1953

I enlighet med beslut den 30 juni 1952 uppdrog Kungl. Maj:t åt vatten- fallsstyrelsen att verkställa en skyndsam utredning rörande det ekonomiska läget inom de enskilda företagen för elektrisk detaljdistribution inom Väs- terbottens och Norrbottens läns skogsbygder. Ur direktiven till utredningen må följande anföras.

Utredningen bör syfta till att klargöra, huruvida de nu återstående enskilda distributionsföretagen äga möjligheter att på längre sikt tillhandahålla sina kunder elektrisk kraft på villkor, jämförliga med dem, som tillämpas vid övrig kraft- distribution inom berörda område. Därest av utredningen skulle framgå, att de enskilda företagen icke kunna uppfylla en sådan målsättning ens med hjälp av

..w Mir.—ef...

redan vidtagna eller nu planerade åtgärder till stöd för landsbygdens elektrifie- ring, bör en plan upprättas för ett övertagande från vattenfallsverkets sida av de nämnda företagen. Till planen bör därvid fogas uppgifter dels rörande de årliga kostnader, som verket, vid tillämpning av dess vid övrig distribution gällan- de taxor, skulle åsamkas genom övertagandet och dels rörande storleken och finansieringen av de investeringar, som vid ett övertagande kunna erfordras för upprustning av kraftstationer och ledningsnät. I samband med planen bör även framläggas förslag till åtgärder ägnade att förhindra att underhållet av de en- skilda distributionsanläggningarna eftersättes i avvaktan på att anläggningarna övertagas av vattenfallsverket.

Utredningen har verkställts av särskilda av vattenfallsstyrelsen förord- nade utredningsmän, vilka den 28 maj 1953 till styrelsen överlämnade ett ' betänkande. Utredningsresultatet jämte vattenfallsstyrelsens förslag till åt- ? gärder överlämnades av styrelsen i underdånig skrivelse den 27 juni 1953. Utredningsmännens betänkande sammanfattas enligt följande.

Vi förorda, att Vattenfallsstyrelsen under de närmaste 5 51 10 åren och enligt en förslagsvis upprättad plan övertager anläggningar och distribution från ett flertal av de undersökta företagen — de undersökta företagen utgöras av, inom Norrbottens län alla företag, som icke ligga i själva kustlandet och i Västerbottens ! län företag liggande väster om gränsen mellan landskapen Lappland och Väster- * botten —, varvid både urval och ordningsföljd äro betingade av dels graden av föreliggande ekonomiska vanskligheter för företagen, dels resp. företagsägares villighet att överlåta verksamheten, dels verkets resurser ifråga om personal m.m. för åtföljande arbetsuppgifter. Köpeskillingarna bestämmas med beaktande av distributionens bristande räntabilitet men dock så, att företagen kunna avvecklas utan att enskilda personer, kreditinrättningar och allmänna organ tillskyndas direkta penningförluster. Efter övertagandet genomföras upprustning och förstärk— ningar till den vid verkets detaljdistribution normala standarden. Engångsavgif— ter som bidrag till upprustningskostnaderna begäras icke och Styrelsens normal- lariff för detaljdistribution på landsbygden tillämpas efter övertagandet, för så- vitt icke särskilda förhållanden göra annat motiverat.

Till förhindrande av att företagen under tiden intill överlåtelsen av anläggning- arna till Vattenfallsstyrelsen avsiktligt eftersätta underhållet av dem och därmed tillföra konsumenterna oberättigad ekonomisk fördel, klargöres för företag, som fortsätta sin verksamhet kortare eller längre tid, att sådan överlåtelse längre fram i tiden kommer att vara möjlig enligt de ovan angivna villkoren endast i den mån företagen efterkommit resp. kraftverks anvisningar beträffande distributionsta- riffer och anläggningsskötsel.

Då den av verket sålunda övertagna detaljdistributionen kommer att i det långa loppet innebära en ekonomisk belastning. föreslå vi, att Vattenfallsstyrelsen begär räntefria statsmedel, alltså investeringsanslag med åtföljande avskrivningsanslag, för att täcka köpeskillingar och upprustningskostnader. Styrelsen bör vidare söka få konstaterat, att bidrag ur de för reglerade sjöar fastställda regleringsavgifterna skola kunna utgå till Vattenfallsstyrelsen lika väl som till lokala företag o. dyl. för täckning av årskostnader vid i och för sig oräntabel detaljdistribution eller engångskostnader för nyelektrifieringar.

Motiveringen till förslagen är i korthet den, att förutsättningarna för lands- bygdsdistributionen inom området äro så ogynnsamma, att verksamheten till över- vägande delen icke är ekonomiskt självbärande på längre sikt vid de praktiska

begränsningar av distributionstarifferna, som föreligga, och speciellt icke om resp. företag skola beträffande såväl tariffer som driftsäkerhet och kvalitet >>tillhanda— hålla sina kunder elektrisk kraft på villkor jämförliga med dem, som tillämpas vid övrig kraftdistribution inom berörda område». Att området elektrifierats trots de ekonomiska vanskligheterna, får anses vara riktigt med hänsyn till den nuva— rande stora angelägenheten av att så många som möjligt få tillgång till elektrisk kraft. Att lokala distributionsföretag använts för ändamålet i den utsträckning, som skett, har varit motiverat av de bidrag till begynnelsefinansieringen, som därvid kunnat erhållas från de blivande konsumenterna och vissa allmänna lokal— intressen. Tack vare denna starthjälp kunna de lokala företagen också under någon tid efter elektrifieringens genomförande fungera som företag med normal ekonomi. Men i och med att distributionsnäten kräva mera underhåll och för- nyelser, stiga kostnaderna för en tillfredsställande distribution utöver vad som motsvarar det ekonomiska underlaget. I detta läge tvingas företagen, ifall bistånd utifrån med eller utan ändring av organisationsformen icke kan erhållas, att begränsa anläggningsskötseln med åtföljande värdeförstöring och nedsättning av kraftförsörjningens kvalitet. För några av nuvarande företag är detta läge aktuellt redan nu eller inom den omedelbara framtiden, för andra dröjer det ännu någon tid, innan det inträder.

Vid sidan om distributionens övertagande av Vattenfallsstyrelsen eller andra större företag föreligger den möjligheten, att de lokala företagen kvarstå och upprätthålla sin verksamhet med hjälp av bidrag från det allmänna, varvid när- mast ifrågakommer statligt upprustningsstöd analogt med förefintlig bidragsverk- samhet för nyelektrifiering. Vi ha också räknat med detta alternativ för de före- tag, som av ena eller andra anledningen beräknas kvarstå, men anse det icke vara fullt likvärdigt med överlåtelse till större företag, även bortsett från att mera generell möjlighet för upprustningsbidrag ännu icke föreligger. Om sådana bidrag, som sannolikt är, bli engångssaker, beroende av behovsprövning, blir det periodiska nedgångsperioder för näten, vilket medför en genomsnittlig standard— sänkning för konsumenterna. Väsentligast är emellertid, att inom stora delar av det undersökta norrländska området skötseln av distri'butionsanläggningarna visat sig vara en så krävande uppgift, att den bör handhavas av organ med stora tek- niska och ekonomiska resurser. Lokala företags handhavande av den blir mindre effektivt och torde medföra större materiella uppoffringar än behövligt.

Enligt vattenfallsstyrelsens uppfattning klargör utredningen, att bety- dande delar av detaljdistributionen på landsbygden icke äro ekonomiskt självbärande, ifall icke konsumenternas betalning för kraften skall bli högst skiftande.

Styrelsen framhåller, att även om man i princip skulle arbeta med alltefter självkostnaderna väsentligt varierande tariffer, skulle dessa på åtskilliga håll komma upp i en praktiskt icke tillämpbar nivå. Elektrifieringen av landsbygden har under senare tid ansetts vara en så allmänt önskvärd och gagnelig åtgärd, att bland annat omfattande ekonomiskt stöd från det allmänna _ inklusive i stor utsträckning statsbidrag _— lämnas till de första nätutbyggnaderna. Som av utred- ningen framgår och väl delvis stått klart redan tidigare, erfordras analog hjälp för att den utbyggda elektrifieringsapparaten skall bevaras i tillfredsställande skick och fungera på avsett sätt även i fortsättningen. För det vid utredningen undersökta området gäller vidare, att stödet från det allmänna lämpligen kombi- neras med en genomgripande organisationsomläggning, så att huvudparten av de

självständiga lokala företagen ersättes med tekniskt och ekonomiskt bättre utrus- tade organ, i första hand råkraftleverantörerna.

Vattenfallsstyrelsen har beslutat godtaga utredningsmännens förslag och räknar med att under en period om 5 a 7 år framåt övertaga detaljdistribu- tion från 30 51 35 av de undersökta företagen. Styrelsen framhåller, att ställ- ningstagandet att normalt icke begära nya engångsavgifter av konsumen- terna i samband med övertagandet av distributionen och icke heller årliga avgifter utöver de vid all styrelsens egen detaljdistribution tillämpade stan— dardtarifferna är begränsat till det nu undersökta området i övre Norrland och därvid har betingats bland annat av de betydande engångsprestationer, som konsumenterna där i regel redan ha fullgjort.

Styrelsens beslut har i anslutning till de anförda synpunkterna influerats av att vattenfallsverket är ett statligt organ. Styrelsen anser emellertid, att verket såsom varande affärsdrivande icke eller i varje fall icke helt bör belastas med den uppoffring, som sammanhänger med att distributionsövertagandet innefattar ekonomiskt stöd till ifrågavarande i genomsnitt icke självbärande verksamhet. I anslutning till utredningsmännens förslag avser vattenfallsstyrelsen att i sam- band med övriga anslagsfrågor för de nästkommande budgetåren hemställa om partiell avskrivning av de med distributionsövertagandena och följande nätupp- rustningar betingade kostnaderna.

Styrelsen hemställer, att det i den form så är möjligt klargöres och fastställes, att bidrag ur de av sjöregleringsföretagens regleringsavgifter bildade medlen skola kunna utgå till statens vattenfallsverk enligt samma grunder och i lika mån som till lokala distributionsföretag.

Vattenfallsstyrelsens sålunda framlagda förslag till upprustning och ra— tionalisering av detaljdistributionen i övre Norrland inom områden, där vattenfallsverket är råkraftleverantör, synas i huvudsak stå i linje med el— kraftutredningens tidigare framförda synpunkter på upprustning och ra- tionalisering samt statligt stöd härför. Det måste nämligen beaktas, att det i detta fallet räder så speciella förhållanden, att man icke genom ett ekono- miskt stöd bestående av lån, som till större eller mindre del lämnas ränte- fritt men dock återbetalningspliktigt, kan få de berörda företagen självbä- rande. Ej heller går detta genom sammanslagningar av angränsande, lokala företag till större enheter. För att en utjämning av självkostnaderna med bättre lottade områden skall kunna komma till stånd, måste sådana sam- manslagningar ske, som spänna över områden med gynnsammare distribu- tionsförhållanden, och detta är möjligt endast genom »sammanslagning» med råkraftleverantören. Med hänsyn till geografiska förhållanden vore det måhända icke oriktigt att trots detta betrakta vattenfallsverkets norrlands— distribution som en självständig verksamhet, för vars handhavande avse— värt större statligt stöd än det av styrelsen begärda vore erforderligt. Enär målet för elkraftförsörjningens rationalisering i hela landet måste vara att göra denna självbärande får det emellertid anses riktigare att utnyttja

de möjligheter till utjämning inom hela företagets detaljdistributionsverk- samhet som finnas. Det kan naturligtvis ifrågasättas om det statliga stödet i detta fall, när det gäller statens vattenfallsverk, skall få annan form än det skulle få, om det gällde ett annat storföretags övertagande av en icke självbärande distributionsverksamhet.

Det är naturligt att hänsynen till tidigare finansiering och tillämpade ta- riffer i dessa fall icke skulle resultera i förnyade engångsavgifter eller där- emot svarande förhöjda tariffer. Något missbruk genom »alltför låga ta- riffer» torde nämligen icke ha förekommit, enär avgifterna för elkraft, in— klusive engångsavgifternas inverkan, av givna skäl som regel ha varit vä- sentligt högre än i andra delar av landet. De föreslagna åtgärderna till för- hindrande av att underhållet av enskilda distributionsanläggningar efter- sättes i avvaktan på överlåtelse till annat företag synas vara lämpliga.

De av utredningsmännen framförda synpunkterna att de lokala företagen tack vare den starthjälp. som de fått — bidragen till begynnelseelektrifie- ringen, som erhållits från de blivande konsumenterna och vissa allmänna lokalintressen — kunna >>under någon tid efter elektrifieringens genom- förande fungera som företag med normal ekonomi» och att >>i och med att distributionsnäten kräva mera underhåll och förnyelse, stiga kostnaderna för en tillfredsställande distribution utöver vad som motsvarar det ekono— miska underlaget» delas i princip icke av elkraftutredningen, som anser att kostnaderna för underhåll och förnyelser skola beaktas redan från distribu— tionsverksamhetens början och helst utjämnas över anläggningens hela livs- längdsperiod. I de aktuella fallen, med de onormalt höga distributionskost- nader, som här råda, har emellertid dessa principiella synpunkter inget avgörande inflytande.

Landsbygdsdistributionen och jordbruket

I det föregående ha berörts olika förhållanden inom detaljdistributionen av elkraft på landsbygden varvid konstaterats bristfälligheter, som kunna begränsa distributionsföretagens möjligheter att hålla verksamheten på en tekniskt-ekonomiskt tillfredsställande nivå. Härvid har betonats bl. a. bety— delsen av konsumentstockens sammansättning särskilt för företag inom rena jordbruksbygder, där användningen av elkraft ännu är tämligen be- gränsad. En ökad användning av elkraft inom jordbruket, inberäknat jord— brukshushållen, påkallas bland annat av bristen på mänsklig arbetskraft inom detta område samt av önskemålet att befria, kanske icke minst kvin- norna, från tyngre arbete och därmed överhuvudtaget skänka större trivsel. Även om elkraft finnes tillgänglig så gott som överallt på landsbygden, om man bortser från en del utpräglade glesbygder, så är en intensifierad jord- brukselektrifiering fortfarande ett allvarligt distributionsproblem. En vid- gad eldrift inom jordbruket ställer successivt ökande krav på landsbygds—

:..-»,ku .

distributionen särskilt i fråga om nätens överföringsförmåga, och det synes därför önskvärt att i detta sammanhang ytterligare något belysa hithörande frågor.

En undersökning av eldriften inom jordbruket har på elkraftutredningens föranstaltande skett genom en tidigare nämnd särskild kommitté, Jordbru- kets elinventering, vars resultat publicerades år 1947 såsom Jordbrukstek— niska institutets meddelande nr 208. Undersökningens ändamål var att genom direkta studier vid ett antal jordbruk göra en ungefärlig bestämning av eldriftens omfattning och därmed förenade kostnader samt att söka fast— ställa vilka faktorer, som främst kunna anses hämma fortsatt utveckling av jordbrukets eldrift. Undersökningen verkställdes under åren 1945—1946 och omfattade över 400 gårdar av olika storlek (dock med minst 2 ha åker— areal) och med en sådan fördelning över hela landet, att ett någorlunda representativt material erhölls. Nämnda undersökning har refererats i el— kraftutredningens redogörelse nr 3 under rubriken jordbrukets eldrift (s. 55 —-76, 113—120). Därvid ha även framlagts resultaten av en kompletterande undersökning angående utvecklingen av jordbrukets eldrift under perioden 1945—1950 samt vissa synpunkter på den framtida utvecklingen. Dessa synpunkter ha för övrigt beaktats av CDL i dess prognos rörande den totala belastningstillväxten under 1950-talet, refererad i kap. 4.

De undersökningar på konsumtionssidan, som elkraftutredningen sålunda ombesörjt eller genomfört beträffande jordbrukets eldrift, äro givetvis icke tillräckliga för att ge en fullständig bild av frågan om elkraftens använd- ning på landsbygden nu och under den närmaste framtiden. Härför skulle erfordras tämligen omfattande undersökningar icke blott inom det egent— liga jordbruket utan även inom dess binäringar samt inom andra lands- bygdens konsumtionsområden, såsom de övriga hushållen, småindustri och hantverk m. m. De refererade undersökningarna torde emellertid, genom att de avsett den alltjämt viktigaste näringen på landsbygden, ha givit en antydan om elkraftens betydelse för landsbygden samt vilka anspråk på elkraft man kan vänta sig för den närmaste framtiden.

Elenergin hade i mitten av 1940-talet tagits i bruk för omfattande upp- gifter inom jordbruket och blivit en faktor av största betydelse. Enligt el- inventeringen hade jordbrukets eldriftfrågor vid denna tid fått en i huvud- sak god lösning i Sverige men markanta brister funnos. Särskilt de små går- darna hade icke kunnat införa eldrift i nämnvärd omfattning. Bland de arbeten, som endast i obetydlig grad voro elektrifierade, märktes lastning och lossning, inomgårdstransporter, utfodring av djur, rykt, utgödsling samt vattenpumpning. Belysningen ansågs vara långt ifrån tillfredsställande. Elvärme för matlagning och vattenvärmning hade gjort framsteg men ut— nyttjades blott i ringa grad. De oenhetliga tarifferna skapade osäkerhet och irritation. Skötseln och underhållet av de elektriska anläggningarna voro ofta bristfälliga.

Elinventeringen ansåg det vara angeläget att elenergin kunde komma till större användning. Starka hämmande faktorer existerade och bland dessa märktes främst de ekonomiska svårigheterna, sammanhängande med jämförelsevis höga energipriser och höga kostnader för installationer, moto- rer och arbetsmaskiner etc. De viktigaste åtgärderna för förbättringar på eldriftens område ansåg elinventeringen vara:

1. Upplysningsverksamhet, riktad till jordbrukare, distributörer, kraftpro- ducenter, installatörer och tillverkare av elmateriel.

2. Teknisk utveckling av materielen.

3. Minskning av kostnaderna för eldrift. Genom de undersökningar, som elkraftutredningen sedermera verkställt, har utvecklingen av jordbrukets eldrift åren 1945—1950 i någon mån kun- nat belysas. Elektrifieringsgraden för den egentliga landsbygden ökade un— der nämnda tidsperiod från 83,5 % till 93 %. Elmotordriften ökade rätt avsevärt i omfattning, dock icke mera än att år 1950 antalet elektrifierade gårdar utan elektrisk motordrift var för gårdar inom storleksgruppen 2—5 ha åker 43 % och inom storleksgruppen 5—10 ha 22 %. Elektrisk matlag— ning i jordbrukshushållen samt elektrisk vattenuppvärmning i ladugårdar ökade väsentligt i betydelse. Antalet elektriska spisar var år 1950 för de mindre gårdarna fortfarande lågt — ca 5 % av de elektrifierade gårdarna med åkerarealen 2—5 ha använde elspis — men inom denna grupp använ- des 1 stället ett rätt stort antal elektriska kokplattor — över 50 % av dessa gårdar använde dylika. Av de elektrifierade gårdarna över 30 ha hade år 1950 45 % elektrisk spis och 40 % elektrisk kokplatta. Motsvarande siffror år 1945 voro 17 respektive 42 %. Ett visst utbyte av kokplatta mot spis kun- de således förmärkas. Beträffande vattenvärmningen i ladugårdar låg ök- ningen helt inom gårdar på över 10 ha åker, då de mindre gårdarna år 1950 fortfarande ej uppvisade någon användning av elkraft för detta ända- mål. Riksmedeltalet av den sammanlagda elförbrukningen ökades från ca 70 kWh/ha åker år 1945 till något över 100 kWh/ha åker år 1949. I fråga om såväl elektrifieringens utbredning som elkraftens användning inom jordbruket konstaterades vid de olika undersökningarna icke obe— tydliga variationer olika landsdelar emellan. Södra Sverige har härvidlag legat efter de övriga delaina av landet i utvecklingen. Elkraftutredningens försök till bedömning av den fortsatta utvecklingen under 1950 -talet har gjorts med utgångspunkt från att bristen på arbets- kraft fortsätter, att elkraftpriset icke förändras mera påtagligt i förhållande till priset på andra aktuella drivmedel och bränsleslag samt att helt nya användningsmöjligheter för elenergi icke i väsentlig grad. komma att göra sig gällande. Utredningen har därvid ansett sig kunna förutse krav på vä- sentligt effektivare belysning i såväl den rena jordbruksdriften som i hem- men, en väsentlig ökning av motordriften i samband med mekanisering av

mqa-, ,

T—_ 5 . Jil—:..- ”, '

inre transporter t. ex. av hö, säd, halm, rotfrukter och gödsel, betydande ökning av den maskinella mjölkningen, av elektrisk vattenpumpning, av luftblåsningcn i spannmålstorkar och för ventilation i bostäder och stallar 111. m. Den stationära tröskningen räknar man emellertid skall trängas till- baka genom skördetröskningen.

Av största betydelse för ökningen i elektrisk energiförbrukning torde värmealstring på elektrisk väg bli. I fråga om elektrisk matlagning, inklusive kylning och frysning, samt vattenvärmning i bostad och ladugård är en fortsatt stark utveckling att vänta. Man kalkylerar även med ett visst behov i samband med torkning av spannmål men anser det icke sannolikt att elenergin i större omfattning kommer att kunna tagas i anspråk för denna uppgift. För lokaluppvärmning räknar man med att elenergi ej skall utnytt— jas i någon högre grad. För elektrisk svetsning förutses någon frammarsch.

Den sammanlagda årliga energiuttagningen inom jordbruket med till— hörande bostadshushåll, som uppskattats till 360 miljoner kXVh år 1949, har under antagna förutsättningar beräknats komma att uppgå till ca 1 300 miljoner kNVh år 1960 varav 30 % för jordbruksdriften och 70 % för bo- stadshushållen. Därvid har endast brukningsdelar med över 2 ha åker med- räknats. Nämnda siffror innebära en exponentiell tillväxt av elkraftbehovet för denna näringsgren motsvarande en fördubbling på 6 a 7 år.

Upplåtande av mark för elektriska ledningar

Frågan om markägares medgivande till dragning av elektrisk ledning över hans mark samt om ersättning för intrång genom sådan ledning, vilken fråga berörts i en inom 1954 års riksdag väckt motion (nr I:20), bör enligt elkraftutredningens uppfattning undersökas särskilt. Nämnda fråga, som omspänner ett stort antal delproblem av stor principiell betydelse och som delvis beröres även 1 kap. 12 (s. 264), anses icke ligga inom ramen för el- kraftutredningens uppdrag.

Kap. 12. Speciella problem

I detta kapitel kommer elkraftutredningen att behandla tre särskilda problem, som beröra elkraftförsörjningen såväl inom städer som på lands— bygd, nämligen rättsförhållandet mellan leverantör och abonnent, kommu- nernas inflytande på elkraftförsörjningen och utvidgning av prisregle- ringsnämndens kompetens.

Rättsförhållandet mellan elkraftleverantör och abonnent

Rättsförhållandet mellan elkraftleverantören och abonnenten regleras i allmänhet av ett avtal, varigenom leverantören åtager sig att tillhanda— hålla kraft och abonnenten att betala kraften.

Svensk lagstiftning berör i mycket ringa utsträckning avtalen om leve- rans av elkraft. Någon rättspraxis har icke utvecklats på området och inom rättsvetenskapen äro hithörande problem knappast alls behandlade. Tvister i anledning av avtal mellan leverantör och abonnent få i brist på direkta bestämmelser avgöras med ledning av 1915 års lag om avtal och 1905 års lag om köp och byte av lös egendom.

I en del författningar på elkraftområdet — 1902 års lag, 1939 års stadga och 1920 års registreringslag — finnas emellertid vissa bestämmelser av betydelse för rättsförhållandet mellan leverantör och abonnent. Enligt 24 & registreringslagen kan anläggningsägare, som underlåter att >>fullgöra ho- nom enligt avtal eller eljest åliggande skyldighet att från anläggningen till- handahålla kraft» av överexekutor föreläggas att vid vite fullgöra skyldig— heten. Enligt 25 5 1939 års stadga, som är utfärdad med stöd av 15 å i 1902 års lag, är innehavare av koncessionspliktig anläggning skyldig att iakttaga de allmänna bestämmelser i fråga om leverans av elektrisk kraft, vilka kunna bli i laga ordning meddelade.Detta villkor, som numera finnes intaget i praktiskt taget alla gällande koncessioner, ansågs t. ex. vid införandet av prisregleringsinstitutet innefatta åliggande för anläggnings innehavare att underkasta sig prisreglering.

I det följande begränsas framställningen i huvudsak till att avse avtal rörande detaljleverans av elkraft på landsbygden, där leverantören är bolag eller enskild person, sålunda icke statligt, kommunalt eller kooperativt före- tag. Stat och kommun intaga nämligen i viss mån en särställning såsom företrädare för det allmänna. Även om avtalet ej innehåller någon uttryck- lig bestämmelse därom kunna de anses ha leveransskyldighet på av det stat- liga verket resp. den kommunala myndigheten fastställda villkor till prin- cipiellt alla stats— resp. kommunmedlemmar som för rimliga kostnader

...... m..— _qs'a x ha.-x.; -

'... 144-A. Ga.

l l l l

kunna anslutas till nätet. Principen om kommunmedlemmarnas inbördes likställighet är grundläggande för all kommunal förvaltning. De kommu— nala verken ha även en starkare monopolställning inom sitt område, grun- dad på rätten att bestämma över gatumarken och markerad av den för kommunala företag vanliga områdeskoncessionen. De kooperativa företa- gens särställning sammanhänger med att den ena av de avtalsslutande par- terna, förbrukaren, äger andel och medbestämmanderätt i leverantörsföre- taget. För avtal med abonnenter, som ej äro medlemmar, gäller emellertid liksom för bolags och enskilda distributörers avtal med förbrukarna, att leverantören har en friare ställning. Detsamma gäller kommunala elverk i förhållande till abonnenter utanför kommunen.

Avtalen om leverans av elektrisk kraft ha vanligen formen av en skriftlig förbindelse, undertecknad endast av abonnenten, som däri förpliktar sig att följa de föreskrifter, som anges i leverantörens reglemente med tillhörande taxebestämmelser. Reglementen och taxor innehålla vanligen förutom upp- gift om de avgifter, som skola utgå enligt vederbörande tariff, bestämmelser om anslutningsavgift, om leveransform (spänning, strömart), leveransplats tt. ex. »vid husväggen») och uppmätning, om leverantörens rätt att verk— ställa taxehöjning, att besiktiga abonnentens anläggningar, att framdraga och bibehålla kraftledningar över abonnentens fastighet och att avbryta leveransen samt om abonnentens skyldighet att tillse sina elanläggningar, att ersätta uppkommen. skada och att på anfordran ställa borgen eller annan säkerhet för riktiga fullgörandet av abonnentens åligganden. Åtskil— liga av dessa bestämmelser äro ofta så allmänt hållna, att en för abonnenten obillig tillämpning är möjlig. Här lämnas några exempel på dylika bestäm- melser.

»För nytillkommande tariffenheter erlägger Abonnenten anslutningsavgift. Den- na avgift, som utgår per tariffenhet och bestämmes av Kraftbolaget, differentieras med hänsyn till Kraftbolagets kostnader för ledningar till och inom den trakt, där Abonnenten är bosatt.

Därest utökning av befintlig anläggning med motorer och apparater medför förhållandevis stor belastning av Kraftbolagets ledningar och transformatorer, äger Kraftbolaget i sådana speciella fall rätt att uttaga viss engångsavgift, om vars storlek överenskommelse i varje särskilt fall träffas mellan Abonnenten och Kraft- bolaget.

Kraftbolaget äger i förekommande fall påfordra att större motorer för jord- bruksändamål icke användas så att de störa belysningen. —-- — —

Det åligger Abonnenten: —— — —

att, där anslutning kan ske till ett ledningsnät, som finansierats av en förening, en kommun eller annan sammanslutning av intressenter, om Kraftbolaget så ford- rar, ingå som medlem i föreningen och fullgöra sina skyldigheter mot den- samma; — —— —

Kraftbolaget har rätt att vid inträffande av force majeure enligt nedanstående helt avbryta energileveransen. — — -— Skulle Socialstyrelsens levnadskostnads- index inklusive skatter och sociala förmåner (juli 1914 = 100) överstiga 300, betraktas även detta som force majeure. —— — —

Brister Abonnenten i fullgörandet av något som enligt taxa med reglemente åligger honom, eller bryter han däremot, äger Kraftbolaget rätt att utan avdrag å enligt taxan uppgående avgifter avbryta encrgileveransen till dess rättelse vun- nits ävensom att åtnjuta ersättning för de omkostnader och utgifter, Abonnentens underlåtenhet medför.»

»Vid förstärkning av äldre distributionsnät eller enskilda SCI'ViSCI' t. ex. från enfas till trefas, utgår i regel särskild förstärkningsavgift.»

»Leverantören påtager sig icke något ansvar och är icke ersättningsskyldig för skador, förluster eller olägenheter, som kunna förorsakas Abonnenten genom för- ändringar i spänning och periodtal.»

>>I den utsträckning ledningsnätet medger detta må Abonnenten efter Kraft- bolagets hörande förutom belysning ansluta motorer och andra apparater, varvid Abonnenten har att iakttaga den begränsning ifråga om uttaget och de bestäm- melser om driften i övrigt, som enligt Kraftbolagets bedömande erfordras för en fullgod strömleverans till Abonnenten själv och närliggande abonnenter.»

»Abonnent medgiver bolaget rätt att kostnadsfritt över Abonnent tillhörigt om- råde framdraga elektriska ledningar för kraftdistribution till andra abonnenter.»

Av de anförda exemplen framgår, att icke blott de taxemässiga avgifterna utan även andra av leverantören uppställda villkor i avtalet kunna vara av den art att de verka betungande för abonnenten. Detta gäller kanske sär- skilt leverantörens möjlighet att uttaga särskilda, till beloppet icke på för- hand bestämda avgifter i samband med att abonnenten ökar sin energi— uttagning även om utökningen sammanhänger med en fullt normal och kontinuerlig belastningsutveckling. Ett annat villkor, som kan bli betungan— de för abonnenten, är bestämmelsen om rätt för leverantören att avgifts— fritt draga fram ledningar över abonnentens mark. Krav på att abonnenten skall ställa säkerhet, som godtages av leverantören, har stundom utnyttjats så, att underskrift krävts jämväl av vederbörande fastighetsägare när en hans hyresgäst tecknat abonnemang.

Abonnentens beroende ställning framträder särskilt därigenom, att leve- rantören vid uppkommande tvistigheter kan säga upp avtalet och sedan avbryta leveransen och på så sätt framtvinga iakttagande av ett villkor, även om detta kan betraktas som oskäligt. Ofta är avtalet utformat så att leveransen kan avbrytas utan uppsägning.

I här angivna fall har leverantören på grund av ett ingånget avtal haft skyldighet att leverera elkraft men villkoren ha vanligen icke varit särskilt betungande för honom. Vilka skyldigheter har leverantören att träffa avtal med sådana som önska bli abonnenter eller att medge en ökning av en strömleverans?

En leverantör har i allmänhet, åtminstone de facto, företrädesrätt till leverans inom sitt distributionsområde. Med denna rätt följer emellertid ingen formell skyldighet att leverera elkraft till alla abonnenter inom om- rådet. Bortsett från bestämmelserna om bygdekraft och ersättningskraft i vattenlagen finnes nämligen för närvarande icke något författningsstad- gande, som ålägger en elkraftdistributör'att tillhandahålla elkraft för

”män.-=.- Län.-"—

...-mum _l— '» A.-

_71.

...-_ ån.—”m

615 ,. E' :i" i

ännu icke anslutna elektrifieringsobjekt, t. ex. en oelektrifierad fastighet. Distributören är ej heller pliktig att svara för skäligt underhåll av nätet och han kan förhindra en normal utveckling av elförsörjningen inom om— rådet genom att underlåta att öka nätets belastningsbarhet. I de fall då en leverantör vägrar att träffa avtal om leverans av elkraft till en fastighet har fastighetsägaren ingen annan möjlighet än att söka få elkraft från en annan leverantör utanför distributionsområdet. Även om denne leverantör skulle kunna få koncession för en dylik ledning lär han i praktiken icke vara villig att svara för elektrifieringen med hänsyn till de stora kostnader, som en dylik enstaka ledning skulle draga. Möjligheterna att utan medver— kan av den ordinarie distributören få en förbättring av leveransförhål— landena äro likaledes praktiskt taget obefintliga.

Vattenfallsstyrelsen och andra större kraftleverantörer bruka dock nu- mera i kontrakten om råkraftleverans till distributionsföretag på landsbyg— den intaga villkor enligt vilka distributören måste förbinda sig att inom ett bestämt område leverera elkraft till var och en som skriftligen anhåller därom. Härigenom ha förhållandena förbättrats inom vissa områden.

Elkraftutredningen anser det otillfredsställande att en distributör, som fått koncession för ett ledningsnät och därmed i allmänhet företrädesrätt för distribution inom ett område, icke har en mot denna rätt svarande skyl- dighet att distribuera elkraft inom området. Den som erhållit tillstånd att bedriva elkraftdistribution bör i princip vara skyldig att inom ett bestämt distributionsområde på skäliga villkor tillhandahålla elkraft för normala ändamål åt envar som erhållit anslutning eller därom gör skriftlig fram— ställning. Möjligheterna att i koncessionen införa bestämmelser härom skulle bli större om områdeskoncession kunde meddelas i större utsträck- ning än som f. n. är möjligt.

Kostnadsfördelning vid ändring av strömart och spänning i distributionsnät

Frågan om införande av bestämmelser, som ålägga strömleverantör att bestrida vissa kostnader vid ändring av spänning på lågspänningsnät. har upptagits av riksdagsmannen H. Kärrlander i framställning till Konungen den 2 december 1948. Efter remissbehandling beslöt Kungl. Maj:t den 13 januari 1950 att överlämna ärendet till elkraftutredningen för att tagas under övervägande vid utredningsuppdragets fullgörande. I anledning härav har utredningen upptagit denna fråga till särskild behandling.

Som tidigare framhållits synes utvecklingen i Sverige gå mot ett allt mera enhetligt lågspänningssystem, nämligen trefas växelström av frekven— sen 50 perioder per sekund och spänningen 380/220 volt. Vad beträffar frekvensen är den sedan flera år pågående omläggningen till 50-periodigt system, huvudsakligen gällande delar av Trollhätte och Norrbottens kraft- verks försörjningsområden, i det närmaste avslutad. Frågan om övergång

från likström till växelström berör numera endast ett fåtal nät, huvudsak— ligen i vissa städer. Ändring av distributionsspänning är däremot en fråga av aktuell betydelse inom ett stort antal distributionsområden såväl i städer som på landsbygd. Vid behandlingen av sistnämnda fråga framträder spe— ciellt spörsmålet om gäldandet av kostnaderna för sådana ändringar av abonnent tillhöriga elektriska anläggningar och apparater, som bli nöd— vändiga i samband med en spänningsomläggning.

Svenska elverksföreningen framlade i december 1948 ett »Förslag till normalbestämmelser för fördelning av kostnaderna för omläggning av abon- nentinstallationer i samband med spännings- och strömartsändring på dist- ributionssystem för lågspänning i städer och samhällen», vilket i huvudsak innehåller följande.

Allmänt

1. Installationer i alla nybyggnader samt alla utvidgningar av befintliga installa- tioner skola anslutas till det distributionssystem, som elverket i varje särskilt fall bestämmer.

2. Elverket äger rätt att, när verket så påfordrar, av abonnenten erhålla upp— gift om de bruksföremål, som av honom innehas och äro avsedda för använd- ning inom hans installation. Om elverket vid planeringen av en omläggning av distributionssystemet företar en inventering av abonnenternas innehav av bruksföremål och motorer, skola om elverket så bestämmer — de appa- rater som anskaffas efter denna inventering, anmälas till elverket. Om abon- nenten underlåter att göra sådan föreskriven anmälan eller om abonnenten icke följer de anvisningar, som elverket i samband med gjord anmälan lämnar i fråga om inkopplingssätt m. m., är abonnenten icke berättigad till ersättning enligt efterföljande bestämmelser.

3. Där så är lämpligt kan elverket i stället för att utbyta eller ändra ledningar och apparater installera omformare, likriktare eller transformatorer. Dessa anslutas efter abonnentens mätare, då de avse enstaka motorer eller bruks- föremål.

4. Ägare av installation eller bruksföremål, som skall ändras, utbytas eller inlösas, har — om elverket så begär att skriftligen godkänna härom träffad upp- görelse med elverket.

5. Elverket lämnar icke ersättning till abonnent, som flyttar från område med ett distributionssystem till område med annat distributionssystem och som till följd härav kan bliva nödsakad att anskaffa nya apparater eller vidtaga ändringar av gamla.

6. Elverket lämnar icke ersättning till abonnent, som övergår till att köpa hög- spänd växelström.

7. I speciella fall eller där tvekan kan råda, äger elverket att med abonnenten träffa avgörande om kostnadsfördelningen.

Fasta installationen 8. Vid omläggning av nuvarande distributionssystem till annan spänning eller strömart bestridas omläggningskostnaderna för den fasta installationen i en fastighet på följande sätt. a. De omläggningsarheten, som äro betingade av spännings- eller ström— artsändringen, bekostas av elverket.

b. Om i anläggningen finnas brister, som bero antingen på att vid dess ut— förande gällande säkerhetsföreskrifter och installationsbestämmelser icke iakttagits eller på att anläggningen icke blivit på lämpligt sätt underhållen, skola de extra kostnader, som uppstå genom att dessa brister i samband med omläggningen skola avhjälpas, erläggas av fastighetsägaren.

Anm. I detta sammanhang bör påpekas, att sådan förstärkning av den fasta installationen i en fastighet, som är erforderlig eller önskvärd, med fördel kan ske i samband med omläggning. Sådan förstärkning skall bekostas av fastig— hetsägaren.

Motorer och bruksföremål

9. Med motorer och bruksföremål skola sådana åtgärder vidtagas, att de efter spännings- och strömartsändringen äro i stort sett lika användbara som före densamma. Motorer eller bruksföremål, som icke äro användbara eller av annat skäl icke användas, bliva i regel icke föremål för dylik åtgärd. Elverket äger rätt att bestämma vilken av följande metoder, som skall till- lämpas för att vid en omläggning anpassa motorer och bruksföremål till den nya spänningen eller den nya strömarten. a. Genom omlindning, omkoppling eller annan ändring av befintlig ut- rustning. b. Genom utbyte av befintlig utrustning mot begagnad apparat eller motor i motsvarande skick, varvid den utbytta utrustningen tillfaller elverket med full äganderätt.

c. Genom utbetalande av bidrag till eller infordrande av bidrag från abon- nenten för anskaffande av ny utrustning.

Anm. Elverket har rätt att på motorer eller bruksföremål, för vilka elverket erlagt utbytesbidrag, genom ingravering av lämplig beteckning eller på annat sätt markera, att dylikt bidrag utgått. Dylika motorer eller bruksföremål få icke genom försäljning etc. ånyo bli föremål för elverkets omläggningsarbete. Abonnent har att till elverket lämna skriftlig försäkran härom, innan bidraget utbetalas. (Bruksföremål, för vilka utbytesbidrag lämnats och för vilka prov— ningstvång föreligger, få icke försäljas, om de icke äro S-märkta).

d. Genom kostnadsfri utlåning och installation av omformare, likriktare eller transformator.

Anm. Dylik utlånad omformare, likriktare eller transformator skall åter- lämnas till elverket, då den icke längre användes för den apparat, för vilken den utlånats eller då abonnenten flyttar. Tillämpningsbesiämmelser för punkt 9

I regel bör för vanligen förekommande motorer och bruksföremål de i det följande angivna bestämmelserna tillämpas.

Glödlampor utbytas av elverket utan kostnad för abonnenten. Förutsätt- ningen härför är, att befintliga lampor äro användbara. Ej använda reserv- lampor utbytas också.

Radioapparater omkopplas av elverket utan kostnad för abonnenten. Vid icke omkopplingsbara apparater lämnar elverket ett bidrag till apparatbyte med 50 kr/apparat.

Motorer samt alla härovan icke nämnda bruksföremål, dvs. elspisar, kok- och värmeapparater, kylskåp, dammsugare, golvbonare, butiksmaskiner, kon- torsmaskiner, elektromedicinska apparater för hem och yrkesbruk, tandläkar- utrustningar, friserapparater (t. ex. torkhuvar och permanentondulerings- apparater) etc. ändras utan kostnad för abonnenten genom omlindning, om-

koppling eller utbyte av element såvida motorn eller apparaten är ny eller i fullgott skick.

I fråga om äldre motorer och apparater, som äro i mindre gott skick eller där omlindning, omkoppling eller utbyte av element ej lämnar önskat resultat. lämnar elverket antingen skäligt utbytesbidrag till abonnenten, beräknat i i direkt proportion till den befintliga utrustningens värde, eller också i utbyte ! annan begagnad motor eller apparat i samma skick. ?

Anm. 1. Apparater, för vilka provningstvång föreligger men som icke äro S-märkta, ändras eller utbytas efter ovan angivna regler endast under förut- ! sättning att de, när provningstvånget för apparattypen trädde i kraft, voro i ; bruk i den anläggning, i vilken de befinna sig vid omläggningstillfället. ]

Anm. 2. Abonnent kan i samband med omläggningen utbyta motor eller apparat mot en eller flera andra av annan storlek eller också ersätta mindre motorer eller apparater med större. Om kostnaderna härigenom ökas, skall abonnenten betala ökningen.

Förtidsomläggning

10. Abonnent, som önskar övergå till ny strömart eller spänning, innan elverket verkställer planerad omläggning av hans anläggning, kan i vissa fall efter överenskommelse med elverket få dylik omläggning genomförd omedelbart.

För att utröna vilken praxis som på hithörande områden tillämpas vid landsbygdsdistributionen har elkraftutredningen begärt uppgifter härom från ett flertal huvudsakligen större kraftföretag. Enligt de inkomna sva- ren tillämpas uppenbarligen ganska skiftande metoder, vilket bl. a. sam- manhänger med att man i många fall icke ansett elverksföreningens för- slag tillämpbart inom landsbygdsdistributionen. På något håll tillämpas exempelvis förbehållslöst den principen att hela kostnaden för ändringar inom abonnentens installation skall gäldas av abonnenten. På andra håll åter bekostar distributören endast omkoppling eller omlindning av motorer för hantverk, industri och jordbruk. Flertalet större företag synas dock i stort sett tillämpa regeln att ändringar eller utbyte av abonnents installa- tioner och apparater, som erfordras för att dessa skola kunna brukas på samma sätt som före omläggningen, bekostas av leverantören. Denna regel är sålunda densamma, som ligger till grund för elverksföreningens förslag till normalbestämmelser för städer och andra tätorter. Vid spänningsomlägg— ningar inom distributionsföreningars och andra smärre företags områden tillämpas mycket skiftande villkor.

Vid bedömandet av förevarande fråga utgår elkraftutredningen från, att i avtal mellan leverantör och abonnent icke intagits några bestäm- melser, som direkt syfta till att reglera rättsförhållandet mellan parterna vid en framtida ändring av strömart eller spänning. Regelmässigt har vid in- gående av det avtal, som under olika former träffas mellan leverantör och abonnent, frågan om framtida ändring av distributionsspänning icke varit på tal och abonnenten måste anses ha haft rätt förutsätta, att den vid abon- nemanget gällande distributionsspänningen och strömarten framgent skall passa hans installationer och apparater. Han skall sålunda icke behöva

mc.: -

Em . .".—' tv.—:::.

äe m_s

'. ***—Mmm

räkna med att på egen bekostnad nödgas ändra dessa därför att leveran- tören finner en ändring av spänningen eller strömarten påkallad. Vanligen sker en omläggning i första hand i leverantörens intresse och gäller icke enstaka utan en hel grupp av abonnenter. Omläggningen måste i prak- tiken ske genom leverantörens försorg. För alla abonnenter böra i princip tillämpas lika villkor. Det synes naturligt, att frågan om kostnadsfördel- ningen bedömes enligt allmänna rättsregler. En analog tillämpning av köplagens skadeståndsregler leder till att abonnentens kostnader för instal- lationsändringar och dylikt i princip helt skola gäldas av leverantören.

Även om huvudregeln sålunda bör vara att leverantören skall svara för kostnaderna för ändring av abonnentens installationer är det klart att skä- lig hänsyn skall tagas till de fördelar eller vinster, som abonnenten får ge— nom omläggningen. Det är exempelvis ofta tekniskt omöjligt att omändra befintliga installationsobjekt eller utbyta dem mot likvärdiga sådana. Den värdeökning, som genom utbytet sker på abonnentens anläggningsdelar, bör betalas av abonnenten. Dessutom kunna gällande säkerhetsföreskrifter under alla omständigheter nödvändiggöra utbyte eller ändring, som helt eller delvis bör bestridas av abonnenten.

Det synes uppenbart att behov föreligger av enhetliga regler för gäldandet av kostnaderna för ändring eller utbyte av abonnenterna tillhöriga installa- tioner och apparater i samband med omläggning av distributionssystem för ett flertal abonnenter. Möjligheterna att reglera denna fråga genom konces- sionsmyndighetens försorg äro begränsade och skulle i varje fall först på lång sikt leda till önskat resultat.

Elverksföreningens ovan återgivna förslag anges uttryckligen avse städer och liknande tätorter. Det har som nämnts gjorts gällande, att normal— bestärnmelserna ej skulle vara lika lämpliga för landsbygdens del. Denna mening synes grunda sig på antagandet, att en landsbygdsabonnent, som i motsats till stadsabonnent har att erlägga engångsavgift, avsedd som bi— drag till leverantörens anläggningskostnader, jämväl bör deltaga i kostna- den för omläggning av leverantörens distributionsanläggning och att detta bör ske genom att abonnenten svarar för större andel av ändringskostna- derna beträffande hans privata installation och elapparater. Någon anled- ning att för landsbygdens del frångå huvudprincipen att leverantören en- sam skall i första hand svara för ifrågavarande kostnader föreligger icke enligt elkraftutredningens uppfattning. Abonnentens rätt gentemot leve— rantören i förevarande hänseende synes icke lämpligen böra påverkas av om engångsavgift uttagits eller ej. För övrigt är det ej heller på landsbyg- den ovanligt, att engångsavgifter icke utgå, och i de fall avgifter uttagas äro de bestämda enligt mycket skiftande grunder. I varje fall kan ej änd- rings- eller utbyteskostnaden för vederbörande abonnenters egna installa- tioner och apparater anses vara en rättvis fördelningsgrund för abonnen- tens andel i kostnaderna för distributionsnätet, för vilka i princip leveran-

tören i första hand skall svara. Om omläggningskostnaden eventuellt skulle föranleda leverantören att uttaga nya engångsavgifter av förbrukarna, böra dessa fördelas enligt enhetliga grunder i proportion till antalet tariffenheter. Eventuellt- kunna kostnaderna motivera en taxehöjning.

Det är ej uteslutet att en strängare tillämpning av principen att leveran- tören, där annat ej avtalats, skall stå för alla kostnader i samband med en ändring av strömart eller spänning på sina håll kan föranleda dröjsmål med genomförandet av önskvärda omläggningar. Detta bör emellertid be— dömas på samma sätt som underlåtenhet att vidtaga rationaliseringsåtgär- der i allmänhet.

Elverksföreningens normalbestämmelser äro närmast att betrakta som tillämpningsregler för leverantörens ersättningsskyldighet med de jämk- ningar dåri, som äro nödvändiga av praktiska skäl eller betingas av gäl- lande säkerhetsföreskrifter. Elkraftutredningen finner bestämmelserna skäliga och i allt väsentligt lämpliga och vill förorda att de tillämpas i nor- mala fall vid omläggning av distributionssystem icke blott i städer och andra större tätorter utan även på landsbygden.

Kommunernas inflytande på elkraftförsörjningen

Historiskt sett har elektrifieringen på landsbygden icke på samma sätt som i städerna knutits till kommunen i dess helhet utan elektrifieringen har till en början endast omfattat tätbebyggda eller eljest lättelektrifierade delar av kommunen. Inom en och samma landskommun har som följd härav ofta uppkommit ett flertal små distributionsföretag.

Kommunerna ha vissa lagliga möjligheter att göra sig hörda innan en elektrifiering inom deras gränser kommer till stånd. Enligt bestämmelse i 3 & 1 mom. andra stycket av 1902 års lag skola de kommuner eller muni— cipalsamhällen, inom vilkas områden ledning skall framdragas eller anlägg— ning eljest utföras, lämnas tillfälle yttra sig över koncessionsansökningen. Såsom senare skall påvisas ger detta stadgande dock tämligen begränsade. möjligheter för kommunen att göra sina särskilda intressen gällande i den mån de strida mot koncessionssökandens.

För en viss grupp av kommuner, nämligen städer och liknande tätorter, har möjligheten till kommunalt inflytande på den lokala distributionen av elkraft däremot redan från början varit mycket stor genom stadgandet i 1 5 andra stycket av 1902 års lag. Detta lyder: >>Menighet vare ej pliktig att utan synnerliga skäl inom område, för vilket finnes stadsplan eller byggnadsplan, eller inom fastställt hamnområde avstå eller upplåta gata, torg, allmän plats eller vattendrag». Orden >>utan synnerliga skäl» tillades genom lagändring, som trädde i kraft den 1 januari 1942. Då upplåtelse av gatumark är en nödvändig förutsättning för samhällselektrifiering inne- bär i praktiken detta stadgande, åtminstone enligt lydelsen före 1942, att

L..-...ma-

*|.'051”IM.Ju|-4l_m-_u-

m Hamn-Hu -= ”p.—l. rn.

vederbörande kommuner tillerkänts ett faktiskt distributionsmonopol (veto- rätt) inom det planlagda området.

Stadgandet åsyftar i första hand en inskränkning i expropriationsrätten för att ge en kommun möjlighet att förhindra åtgärder, som äro olämpliga med hänsyn till användningen av kommunens gatusystem för trafik m. rn. Enligt proposition (nr 9) till 1902 års riksdag, varigenom lagförslaget framlades, motiverades stadgandet sålunda.

På grund af de olägenheter, som för städer och stadsliknande samhällen kunna följa af ett intrång på gator och dermed jemförliga områden, synes deremot mc— nighet böra fritagas från skyldighet att tvångsvis afstå eller upplåta dylika om- råden.

Det särskilda utskott, som vid 1902 års riksdag behandlade ifrågavarande lagförslag, anförde i sitt utlåtande bl. a.

Emot denna inskränkning i expropriationsrätten kunde vid första påseende synas vara åtskilligt att anmärka, enär just i städer och municipalsamhällen be— hofvet för industriella anläggningar, spårvägar m. m. att för erhållande af drif- kraft utlägga elektriska ledningar säkerligen kommer att blifva mest känbart. Efter noggrant öfvervägande af denna fråga har utskottet emellertid med afseende å de olägenheter, som kunna förorsakas städer och dermed jemförliga samhällen genom elektriska ledningar, kommit till den åsigt, att det icke kan anses tillrådligt att införa expropriationsrätt beträffande de nyss berörda områdena.

Utskottet hyser heller icke ringaste tvifvel derom, att stad och municipalsam- hälle i regel best sjelf inser fördelarne af samhällets industriella utveckling samt vigten af att befordra och underlätta allt, hvad som dertill kan bidraga; och anser utskottet derför att man med full tillförsigt bör kunna öfverlemna frågan om elektriska ledningars framdragande öfver allmänna platser åt ifrågavarande kommuners eget afgörande.

En jämkning av vetostadgandet kom till stånd genom lag den 19 decem— ber 1941. Lagändringen tillkom efter proposition (nr 317) till 1941 års höst— riksdag i anledning av framställda önskemål angående bl. a. ändrade be- stämmelser om rätt att framdraga elektriska ledningar över annans mark. I sitt yttrande över en inom justitiedepartementet upprättad promemoria i ärendet berörde kommerskollegium även frågan om expropriationsrätt för område med stadsplan eller byggnadsplan eller hamnområde och anförde härom följande.

I prememorian har framhållits, att den föreslagna utvidgade expropriations- rätten borde, liksom fallet är med den expropriationsrätt, som är medgiven i 1 5 i dess nu gällande lydelse, icke gälla i fråga om område, för vilket finnes stads- plan eller byggnadsplan eller inom fastställt hamnområde, där fråga är om avstå- ende eller upplåtelse av gata, torg, allmän plats eller vattendrag.

Kollegium vill angående denna fråga bringa i erinran, hurusom den vetorätt, som sålunda tillkommer kommun, huvudsakligen tillkommit för att bereda kom- mun möjlighet att förhindra dylika ledningars framdragande, därest detta med hänsyn till användningen av kommunens gatusystem för trafiken samt för an- bringande av anordningar för belysning, vattenledning och markens torrläggning

m. ni. skulle visa sig mindre lämpligt. Med den avfattning stadgandet ifråga kom att få har emellertid den kommunala vetorätten fått en större omfattning.