SOU 1995:104

Skattereformen 1990-1991

Till statsrådet och chefen för Finansdepartementet

Genom beslut den 7 juni 1990 bemyndigade regeringen statsrådet Åsbrink, som inom regeringen hade ansvaret för skattefrågor, att tillkalla en kommitté med högst sex ledamöter med uppdrag att utvärdera 1990-1991 års skattereform.

Med stöd av bemyndigandet förordnades generaldirektören Lennart Nilsson som ordförande och som ledamöter ekonomen Per-Olof Edin, landshövdingen Ingemar Eliasson, numera finans- rådet Ingemar Hansson, riksdagsledamoten Anita Johansson, professorn Sven-Olof Lodin och familjeekonomen Pia Nilsson. Ingemar Eliasson entledigades från sitt uppdrag från den 1 februari 1995. Till sakkunniga utsågs numera generaldirektören Claes Ljungh samt från den 22 maj 1991 professorn Sten Johansson. Att som experter biträda kommittén förordnades genom beslut den 22 maj 1991 avdelningsdirektören Håkan Malmer och från den 25 januari 1995 departementsrådet Anders Kristoffersson. Till sekrete- rare i kommittén utsågs avdelningsdirektören Annika Persson.

Kommittén har antagit namnet kommittén för utvärdering av skattereformen (KUSK).

Som underlag för utvärderingen har initierats forskningsprojekt som syftar till att belysa olika aspekter på reformen. Tyngdpunkten i denna forskning ligger på skattereforrnens samhällsekonomiska effekter och har hållits samman av Ekonomiska Rådet. En förteckning över av Ekonomiska Rådet i anslutning till utvär- deringen separat utgivna forskarrapporter återfinns i slutet av bilaga 1.

Forskarnas huvudresultat samt kommitténs slutsatser och bedömningar redovisas i detta betänkande.

Särskilt yttrande har lämnats av sakkunnige Sten Johansson. Uppdraget är därmed slutfört.

Stockholm i november 1995

Lennart Nilsson Per-Olof Edin Ingem ar Hansson A nita Johansson Sven-OlofLodin Pia Nilsson

/A nnika Persson

31532. HET na...-.it 115!

' ' "' .. ' '» ...v. .. ' ' " .. ,.. ,.. ,' ._ . : | __" ' . 1" _ '. F |_. ._ ,rrh. | . THI- . . .. . ._ .L11'.%.' '.., MPH”??? »? ,'. * ,,,_ '.”.l _1.11ui||___|_ , .... 'H|1___'_||_f .. 41 1|4| U:”, TL. HUL— ,_.. ", ,| ...,. - _a... .....,.,._

, . »; -. __*._.__'T'" . '_'_'|u_"l_' __ __ '

"'-'| _.__1-

.".'""'.'.'. """"' _m"*_1,u|u. ..4.-hd..." m. mm...... få! h'ol'JbMähL'

”h**lM #5le mm:...

HH".

,*' ”Lät—ä;! WH?) w"!

.1' | _ -.. '*"'_".*'1_' " '- _mnzv nm».

. TE'W ..,uu , - 'g'-E'! fläk?" Munn. . .,*,_ ,, -,,. '_1L' _ ' ' _'-.L " ' "; ' .ileinwma' mmm

_ . -_'.*__* _1____ (_ '___._ ,_______' "",'t'*.-",_._ '_,*_*. '!lewmä ",'_" _ ._ , __|_ "."” * 1, * -_ _ namnkunnin,

-" ':'-', '|'"|.'— .||-11:11 . -- " " '. _. ..:,_,___,_.'*_|'___ HL'I,"i".:1D»I..-.|lud ' ' ” "f * . ' ”"...". "_,'. "Him."..w mo... _ , ___.___H|._.__'1_r_å|n'|fw.'m _mv_|._:|_b___| _. _ ”...”. AM.-a' mäta - , . .|,'_'1*,,,'.'|"'|.' "L'a..1f,H..&11,M,,gc.m|.m51 '|'". »' 1 ..' "-'."'=""7'*,|';|'.. på.-_a. mm.]: |__' _-__|' '__'_ ,__ ____|.._1'| ___—___ ' T tall.!” . '.,:'-".""'" .'._'.'.' '.'- "._'."_'-| EWLLÅF'M'MQTMUÄ

'- ,, '.;_,—-.' __». . -

, ._|_ *L*:uhgk .||r.giv_l_mmubed

w -. m'v'g' Man.?

l_'.'."..'r_l1_ |"'%br!..'|r.*'r4'

'|, ': '.. | A_l"

.. ..1

- ||1. ,_'.u

* 11113".- .- ..f- +|- ." '* '%- _ || _ _

- '_---.. tvn-.vm'H —a'-.||_uz-_.=,'.4.'.

InnehåH Sammanfattning 9 Summary 15 1 Inledning 22 1.1 Sammanfattning av direktiven 22 1.2 Utredningsuppdragets genomförande 23 2 Bakgrunden till skattereformen 27 3 Utvänden'ngens huvudresultat 31 3.1 Inledning 31 3.2 Reformens beteendeffekter 32 3.2.1 Skatteplanering och skattefusk 32 3.2.2 Sparande och konsumtion 40 3.2.3 Företagen 46 3.2.4 Arbetsutbudet 50 3.3 Effekter på de samhällsekonomiska målen 52 3.3.1 Stabilisering och skatteintäkter 52 3.3.2 Inkomstfördelningen 55 3.3.3 Blev reglerna enklare? 63 3.3.4 Samhällsekonomisk effektivitet 66 3.4 Allmänhetens inställning till skattereformen 68 4 Kommitténs avslutande synpunkter 73 4.1 Val av tidpunkt för reformen Hade man kunnat göra annorlunda? 73 4.2 Skattereformen — en långsiktig investering 76 4.3 Skattereformens finansiering 77 4.4 Reformens fördelningseffekter 83 4.5 Likfonnighet, stabila skattebaser och kontrollproblem 85 4.6 Refonnens beständighet 87 4.7 Slutbedömning 90

Säiskilt yttrande av Sten Johansson 93

8 Innehåll Bilagor:

Bilaga ] (separat volym)

Jonas Agell, Peter Englund och Jan Södersten

(Ekonomiska Rådets rapport till kommittén): Svensk skattepolitik i teori och praktik. 1991 års skattereform.

Bilaga 2 ......................................................................................... 99 Håkan Malmer och Annika Persson:

Effekter på skattesystemets driftskostnader, skatteplanering och skattefusk

Bilaga 3 ........................................................................................ 159 Rune Åberg: Politik och opinion kring 1991 års skattereform

Bilaga 4 ........................................................................................ 193

Basuppgifter om hushållens inkomstutveckling 1989-1992 Appendix: Grunddata om hushållens inkomster 1989-1992.

Bilaga 5 ........................................................................................ 307 Bengt Eklind, Joakim Husse'nius och Rolf Johansson: Fördelningseffekter av skattereformen

Bilaga 6 ........................................................................................ 349

Kommittédirektiv Överenskommelse mellan KUSK och Ekonomiska Rådet

Sammanfattning

Den skattereform som genomfördes 1990-1991 var unik till sin omfattning. Den förändrade de ekonomiska villkoren för hushåll och företag på ett i flera avseenden genomgripande sätt. Den utvärdering som nu föreligger visar att reformens målsättningar på flertalet punkter blivit väl uppfyllda. Skattesystemet har blivit mera robust och mindre manipulerbart genom skatteplanering. Skattesys- temet styr hushållens och företagens handlande på ett mindre godtyckligt och mera samhälllsekonomiskt riktigt sätt. Det refor- merade systemet kan fungera med den ökade intemationalisering som skett i ekonomin. Skatteadministrationen har blivit enklare. Däremot har de villkor som uppställdes för reformen att den skulle vara statsfinansiellt och fördelningspolitiskt neutral inte uppfyllts fullt ut på kort sikt. Reformens bidrag till ökad spridning i ekonomisk standard är dock begränsad. På längre sikt bedöms underfrnansieringen minska.

Trots att det har gått fem år sedan reformen genomfördes är det ännu inte är möjligt att göra en definitiv och slutlig bedömning av reformens effekter. Den ekonomiska depressionen under början av 1990-talet gör att det inte blev så stora kortsiktiga effekter som väntat. Det dröjer också innan vissa av effekterna ger full av- kastning. Det gäller t.ex. långsiktiga beslut av investeringskaraktär såsom valet att utbilda sig, och effektivitetsvinster av en på sikt bättre kapitalallokering. De allmänna förväntningarna då reformen genomfördes var att effekterna av reformen skulle få ett snabbare genomslag än vad som faktiskt blivit fallet. Lågkonjunkturen och en vikande efterfrågan är huvudorsakerna till att förloppet blivit mer utdraget.

Om reformen inte kommit till stånd skulle svaghetema med det gamla skattesystemet förstärkts genom ökad internationell rörlighet och friare kredit- och valutamarknader. Det nya skattesystemet bör därför inte jämföras med det gamla systemet såsom det verkade i slutet av 1980-talet utan snarare hur det skulle ha fungerat under 1990-talet om det hade varit kvar. Reformen var nödvändig. Det är bra att reformen är genomförd och att vi har övergångspro— blemen bakom oss.

En kort sammanfattande karaktäristik av de resultat som kommit fram i utvärderingen ges nedan.

S katteplanen'ngen

Som förväntat minskade skattereforrnen möjligheterna till skatte- planering och omfattningen på skatteplaneringen minskade. Detta gäller både för privatpersoner och för skatteplaneringen inom företagssektorn. Skattereformen bedöms också ha dämpat de incitament till internationell skatteplanering som uppstått efter avregleringen av valutamarknaden. Svårigheterna att finna enkla och effektiva kontrollmetoder gör dock att internationell skattepla- nering och skattefusk även med det nya skattesystemet är ett orosmoln inför framtiden.

Utvärderingen visar att inget tyder på ett ökat skattefusk under perioden 1980-1992. I den mån skattereforrnen i sig haft någon effekt på fusket bedöms denna effekt vara sänkande.

Sparande och konsum tion

Skattereformen har haft ganska liten betydelse för den minskning av hushållens konsumtion och den ökning av hushållssparandet som inträffat under början av 1990-talet. Det är främst andra faktorer som spelat in. Däremot har reformen helt klart lett till att sparandet ändrat inriktning. Hushållen har kraftigt ökat sitt finansiella sparande medan det reala sparandet har minskat. Det är dock svårt att ange hur mycket av förändringarna som beror på reformen. En stor del av sparandeförändringen skulle ha ägt rum också utan reformen som en följd bl.a. av ett väsentligt högre ränteläge och en minskad inflationstakt. Reformen beräknas ha orsakat ett fall i villapriserna på ca 15 procent vilket motsvarar ungefär hälften av det reala fallet i priserna på sm åhus under åren 1990-1993. Andra hälften av prisfallet beror på andra politiska beslut samt de allmänna följderna av lågkonjunkturen och det stabiliseringspolitiska läget. På lång sikt bör den ändrade in- riktningen av sparandet innebära att kapitalet kanaliseras i mer produktiva former. De långsiktiga allokeringsvinstema har dock köpts till priset av att reformen kom att fördjupa konjunktumed- gången och förstärkte omställningsproblemen på fastighetsmarkna- den.

Företagen

De första åren efter Skattereformen har från konjunktursynpunkt varit extrema och företagens anpassning till den nya bolagsbe- skattningen är inte avslutad. Allt tyder dock på att det nya systemet ger en bättre och mer förutsättningslös prövning av olika investeringsprojekt.

Oj ämnhetema i skatteeffektema av olika handlingsaltemativ har minskat, liksom systemets inlåsningseffekter. Skatteöverväganden har fått betydligt mindre utrymme. Överensstämmelsen mellan verklig och skattepliktig vinst har blivit bättre. Systemet bedöms också ha blivit internationellt konkurrenskraftigt bl.a. genom att dess genomskinlighet har ökat. Det nya systemet kan också verka jämnare mellan företag av olika storlek och karaktär.

Effekter på arbetsutbudet

Förväntningarna då Skattereformen beslutades var att reformen skulle påverka arbetsutbudet positivt. Bedömningen grundades bl.a. på resultat från en rad utländska undersökningar som gav vid handen att skatterna spelade en viktig roll för hushållens arbetsut- bud. Senare studier på svenska data föreligger nu och indikerar att man kan förvänta sig en effekt på arbetsutbudet på ett par procent som en följd av skattereforrnen. Detta är något mindre än vad de internationella studierna pekade på, men ganska väl överensstäm- mande med de mera försiktiga bedömningar som gjordes i ut- redningen som föregick reformen (RINK). Även om effekterna inte är så stora är de ändå viktiga, visar utvärderingen, med hänsyn till att skattekilama var mycket höga före Skattereformen och fort- farande är höga för vissa grupper. Även små förändringar i arbetsutbudet kan ge betydande effektivitetsvinster. Den svaga efterfrågan i ekonomin åren efter skattereforrnen gör dock att man inte kan räkna med större effekter på faktiskt arbetad tid i det korta perspektivet. Inget motsäger emellertid att reformen långsiktigt kommer att få den förväntade effekten.

En annan dimension på arbetsutbudet än antalet arbetade timmar är kvalitétsaspekten i form av arbetskraftens utbildning. Avkast- ningen på utbildning har fått en bättre skattebehandling. Skattere- formen har medfört att utbildning och karriärval lönar sig bättre. Detta kan bidra till att fler avstår från låg lön tidigt i livet för att istället utbilda sig och få en högre lön längre fram. Men in- citamenten till resultatgivande utbildning eller andra karriärsats- ningar ökar även för personer som redan är etablerade i yrkeslivet

inklusive i yrken med relativt hög lön. Underlag saknas emellertid för att kvantifiera dessa effekter.

Skattereform en och lågkonjunkturen

Genomförandet av skattereformen kom att sammanfalla med en mycket kraftig nedgång i ekonomin. Denna lågkonjunktur var på väg oberoende av skattereformen. Reformen som sådan hade både expansiva och kontraktiva inslag. Underfinansieringen verkade stimulerande på ekonomin medan reformens inverkan på det finansiella sparandet gav en negativ effekt. Sammantaget indikerar utvärderingen att skattereformen sannolikt har bidragit till att fördjupa lågkonjunkturen. Reformen synes dock inte vara en primär faktor i det ekonomiska krisförloppet. Skattereformen uppskattas kortsiktigt ha skapat ett produktionsbortfall som motsvarar knappt en procent av bruttonationalprodukten (BNP).

Reform ens finansiering

Utvärderingen visar att reformen på kort sikt (1991 och 1992) kan beräknas ha varit underfinansierad med i genomsnitt 25 miljarder kronor per år. Därtill kommer en mer osäker effekt på uppskatt- ningsvis 10 miljarder kronor på grund av att reformen torde ha bidragit till att fördjupa lågkonjunkturen. Även om reformen är underfinansierad på kort sikt är det viktigt att slå fast att den på intet sätt är en huvudorsak till de stora underskotten i statsfinans- erna under början av 1990-talet. Det finns vidare indikationer på att underfinansieringen minskar efter 1992. Finansieringen genom ändrad kapitalbeskattning blir allt större på grund av en mera positiv utveckling av aktiekurserna. En annan orsak är ökade skattepliktiga vinster i exportföretagen och i företag med ex- portrelaterad verksamhet (som till viss del kan bero på minskad skatteplanering). De anpassningar som hushållen nu gör av bostadsefterfrågan och av sin skuldsättning liksom hushållens minskade skatteplanering medför på sikt att skatteintäkterna ökar. Med ett förbättrat konjunkturläge kan även ett ökat arbetsutbud och andra effektivitetsvinster bidra till att minska underfinans- ieringen. Om reformen är underfinansierad även på sikt är en fråga som inte går att säkert besvara idag. Hur som helst rör sig den _ mera bestående underfinansieringen sannoliktom väsentligt mindre belopp än vad som gäller för skattereformens första år.

Reformens fördelningseffekter

Skattereformen var en stor och tekniskt sett genomgripande omläggning. Ett av reformens huvudsyfte var att få ett system som ökar den samhällsekonomiska effektiviteten. Reformens för- delningseffekter bör ses och bedömas utifrån denna övergripande målsättning.

De beräkningar av reformens fördelningseffekter som gjordes i samband med reformbeslutet byggde på framskrivningar och be— dömningar av olika slag bl.a. av en rad basbreddningar. Vid en så stor omläggning kommer kalkylerna alltid att innehålla ett visst mått av osäkerhet. Utvärderingen har kunnat baseras på den faktiska utvecklingen av skattebasema och ger därmed en säkrare bild av reformutfallet. Men det finns fortfarande osäkerheter kvar. Utvärderingen visar att den bild av reformens fördelningseffekter som gavs inför genomförandet av reformen håller för de allra flesta grupper. Resultatet av de nya beräkningarna ligger mycket nära de kalkyler som gjordes i reforrnpropositionen. Men på en viktig punkt underskattade de gamla beräkningarna reformutfallet. Hushållen med de högsta inkomsterna och högre tjänstemän har fått ett högre utfall än vad de tidigare kalkylerna visade på. Utfallet för de 10 procent av hushållen med högst ekonomisk standard ligger i de nya beräkningarna nära genomsnittet för samtliga hushåll, vilket innebär en ökning av den disponibla inkomsten med ca 3 procent som en följd av reformens regelför- ändringar mot 0,2 procent enligt kalkylerna i propositionen.

Det finns en rad andra aspekter på reformen som också bör finnas med i bilden vid värderingen av fördelningseffekterna. Sverige har fått ett mera tåligt och robust system som inte på samma sätt kan utnyttjas för skatteplanering. Skattereformen minskade skatteplane- ringen, och detta har i sin tur ökat träffsäkerheten i fördelnings- politiken. Utvärderingen visar att spridningen i faktiskt betald skatt vid samma arbetsinkomst minskat Väsentligt för personer i högre inkomstlägen i samband med skattereformen. Den s.k. horisontella rättvisan har således ökat. Beskattningen av förmåner och bas- breddningar i kapitalinkomstbeskattningen har gjort särskilt högin- komsttagamas inkomster mera synliga. Skattesystemet är enklare och lättare att förstå för den enskilde.

Många förändringar har gjorts av skatte- och transfereringssyste- men efter reformen. Det blir allt svårare att avgränsa och skilja ut reformens roll i sammanhanget och det blir med tiden mindre intressant. Av reformutfallet går inte att dra några mer bestämda slutsatser om inkomstfördelningen såsom den ter sig idag.

Hanteringen av skattesystemet

Skattereformen medförde att den tid och de kostnader de skattskyl- diga lägger ned på att redovisa och betala skatter minskat totalt sett. I den bemärkelsen har skattesystemet blivit enklare. Det är främst fysiska personer som fick det enklare. Skatteredovisningen är relativt sett mest betungande för de minsta företagen. Strävan bör vara att förenkla reglerna.

Samhällsekonom isk effektivitet

Det nya skattesystemet bör på sikt ge en rad effektivitetsvinster även om dessa kan vara svåra att kvantifiera. Effektivitetsvinster följer av minskade skattekilar och ökat arbetsutbud. Andra vinster är att reformen skapat incitament för en effektivare kapitalalloke- ring. Minskad skatteplanering skapar också förutsättningar för en ökad samhällsekonomisk effektivitet.

Re glernas stabilitet

Skattesystemet fick inte den stabilitet som det fanns uttalade förhoppningar om. En mängd regelförändringar har gjorts efter reformen. Men trots alla ändringar så är kommitténs bedömning att fundamenten är kvar. Det är viktigt att regelsystemet hålls mer stabilt och att huvudprincipema värnas framöver om reformen skall ge de åsyftade och förväntade effekterna.

Summary

The tax reform that took place in 1990-1991 was unique in its scope. lt changed the economic circumstances of private in- dividuals and business enterprises in ways that were fundamental in several respects. The evaluation now available shows that the reform in most areas has achieved its objectives very well. The tax system has become more robust and less exposed to manipulation as a result of tax avoidance schemes. The tax system determines the actions of private individuals and companies in a less arbitrary and more economically sound manner. The reformed system is capable of functioning in the more international environment into which the economy has moved. lt has become simpler to ad— minister the tax system. The conditions upon which the reform was based that it should be neutral in terms of public finances and distribution policy have not been fully satisfied in the short term. However, the role of the reform in broadening the dispersion of economic standards is limited. On the long-term horizon, the element of under-financing is expected to decrease.

Though it is now five years since the tax reform was implemented it is still not possible to arrive at a definite and final evaluation of the effects. The economic recession at the beginning of the nineties meant that the short-term effects were not so evident as expected. It also takes time before some of the effects work their way through to the full. This is true, for example, of long-term decisions of an investment character, such as decisions to take further training and education, and, eventually, efficiency gains from the more efficient allocation of capital. The general expec- tations when the reform was carried out were that its effects would show through more quickly than what in the event turned out to be the case. The recession and the weakness of demand are the main reasons why the course of events have become more prolonged. If the reform had not been implemented the shortcomings of the old tax system would have been underlined due to greater in- ternational mobility and deregulated credit and currency markets. The new tax system should therefore not be compared with the old system as it was at the end of the eighties, but rather with the way it would have functioned in the nineties if it had not been refor-

med. The reform was necessary. It is a good thing that it has been implemented and that the transitional problems are now behind us.

A brief description of the principal results which emerged from the evaluation is provided below.

Tax planning

As expected, the tax reform reduced the opportunities for tax planning and the extent of tax planning declined, both among private individuals as well as within the corporate sector. The tax reform is also believed to have reduced the incentives to engage in international tax planning which emerged in the wake of the deregulation of currency markets. The problems associated with finding simple and effective means of control do mean, however, that even with the new tax system, international tax planning and tax evasion is still a dark cloud on the horizon.

The evaluation shows that there is nothing to indicate any increase in tax evasion during the 1980-1992 period. In so far as the tax reform as such has had any effect on tax evasion, it was probably to reduce it.

Household savings and consumption

The tax reform is not the main factor behind the reduction in private consumption and the increase in the overall level of household savings that occured in the beginning of the nineties. Other factors have been of more importance. On the other hand, it is quite clear that the reform has led to a change in the character of savings. Consumers have dramatically increased their financial savings, whilst the real savings have declined. However, it is difficult to state how much of the change is due to the reform. Much of this change in savings would have taken place in any case, without the reform, due, for example, to the markedly higher level of interest rates and the lower inflation rate. The reform is estimated to have caused a reduction of some 15 per cent in the price of private houses, which represents approximately half of the total fall in real house prices between 1990 and 1993. The other half of the price reduction is due to other political decisions and the general consequences of the recession. In the long term, the change in the character of savings will probably mean that capital is channelled along more productive lines. These long-term allocation benefits have, however, been bought at a price: the

reform has tended to intensify the recession and accentuate the problems of adjustment on the property market.

Companies

The first few years after the tax reform were extreme in cyclical terms, and the process of adaptation by companies to the new system of corporate taxation is not yet complete. Everything suggests, however, that the new systern will result in better quality and more neutral consideration of investment projects.

The differences in tax effects of different altematives of action have diminished, and so have the locking in effects of the system. The scope for tax considerations is less. The correspondence between actual and taxable profit has become better. The systern is also assessed to stand international competition due to among other things the transparency of the system. The new system is also believed to work more even between companies of different size and character.

Effects on supply of labour

Expectations at the time the tax reform was decided were that it would have a positive effect on the supply of labour. This assessment was based partly on the results of a number of foreign studies, which indicated that taxes played an important role in persons' willingness to work. Later studies of Swedish data are now available and these indicate that an effect on the supply of labour of a couple of per cent or so may be expected as a result of the tax reform. This is a slightly lower level than the international studies suggested, but fairly closely in line with the more cautious assessments made by the tax commission prior to the reform (RlNK). Even if the effects are not especially extensive, they are none the less important, according to the evaluation, in the light of the fact that tax wedges were wide before the tax reform, and still are for certain groups. Even quite modest changes in the supply of labour can lead to significant efficiency gains. The weakness of demand in the economy during the years since the tax reform does, however, mean that no significant effect on the actual worked hours may be expected in the short term. There is nothing though contradicting that the reform in the long term will have the expected effect.

Another dimension of labour supply than number of worked hours is its quality in terms of skill. The return on education is

now given more favourably treatment in tax terms. The tax reform means that a longer education and a career choice are now more rewarding. This could be one reason why more people might be willing to refrain from accepting a low wage early in their working life in favour of undergoing further training to earn a higher wage later. But the incentive to acquire a vocational training or to invest in other ways in a career will also improve for individuals who have already entered working life, including those in occupations that pay relatively high wages. There is not however, enough evidence for quantifying these effects.

The tax reform and the recession

The implementation of the tax reform coincided with a very severe economic recession, a recession that would have come, regardless of the tax reform. The reform as such contained both expansionary and depressive features. The under-financing tended to stimulate the economy, whilst the effect of the reform on the level of financial savings had the opposite effect. Overall, the evaluation indicates that the tax reform probably tended to increase the severity of the recession. However, the reform does not appear to have been a primary factor influencing the course of the economic crisis. In the short term, the tax reform is believed to have caused a production shortfall corresponding to just under one per cent of gross domestic product (GDP).

The financing of the reform

The evaluation shows that in the short term (1991 and 1992) the reform was probably under-financed by an average of 25 billion kronor per year, to which may be added more uncertain effects amounting to some 10 billion kronor due to the role of the reform in intensifying the recession. Even though it was under—financed in the short term, it is important to emphasise that the reform was by no means the main reason for the heavy deficit in the central government budget at the beginning of the nineties. There are in- dications that the level of under-financing began to decline after 1992. The financing through changes in taxes on capital is growing due to a stronger trend in the prices of shares. A further factor is the higher taxable profits of exporters and companies in export- related sectors of the economy which in part could depend on less tax planning. The adjustments that households are now making in their demand for housing and in their indebtedness will, in the

long term, lead to a further increase in tax revenues. With a generally stronger economic situation, an increase in the supply of labour and other efficiency gains could help to reduce the degree of under-financing. Whether or not the reform remains under— financed in the long term is a question that cannot be answered with certainty at present. ln any case, the under-financing is probably far less in extent than was the case during the years immediately following the tax reform.

Distribution ejfects of the reform

The tax reform was both extensive per se and very far reaching in its structural aspects. One of the principal objectives of the reform was to create a system that would improve the functional efficien- cy of the economy. The distribution effects of the reform should therefore be seen and judged in the light of this overall objective.

The estimates of the distribution effects of the reform that were made in connection with the decision on the reform were based on projections and estimates of various types, including the broade- ning of several tax bases. In the case of such a far-reaching reform, estimates always involve some degree of uncertainty. The evaluation, on the other hand, has been based on the actual changes in tax bases, and thus provides a more accurate estimate of the outcome of the reform, although some areas of uncertainty still remain. The evaluation shows that the description of the distribution effects of the reform presented before it was in- troduced still apply to the great majority of groups in society. The result of the new calculations is very close to the estimates made in the tax reform bill. However, the earlier calculations under- estimated the outcome of the reform in one respect. In the case of households with the highest incomes, and senior salaried employe- es the results are rather higher than the earlier estimates foresaw. In the new calculations, the result for the top decile of households with the highest incomes, is very close to the average for all households, which represents an increase of some three per cent in disposable incomes due to changes in the rules brought about by the tax reform, compared with the estimate of 0.2 per cent in the bill.

There are several other aspects to the reform which should also be included in an overall equation when evaluating its distribution effects. Sweden now has a more resilient and robust systern which is less liable to exploitation for tax planning than in the past. The tax reform has reduced the extent of tax planning, and this in tum

has improved the accuracy of distribution policy. The evaluation shows that variations in the amount of tax actually paid by individuals eaming a given income has been significantly reduced for persons in the upper income brackets as a result of the tax reform. Horizontal faimess has thus improved. Taxation of perquisites and the broader bases for taxation of income from capital have made incomes more transparent, especially in the case of high income earners. The tax systern is simpler, and individuals will find it easier to understand.

The system of taxation and transfer payments has been altered frequently since the reform. It is becoming increasing difficult to identify and separate out the role of the reform in this context, and it will be of less interest with the passing of time. It is not possible to arrive at any definite conclusions regarding the effects of the tax reform on the distribution of incomes as it appears to today.

The handling of the tax system

Seen overall, the tax reform has reduced the amount of time that taxpayers devote to reporting and paying their taxes, as well as reducing what it costs them. ln that sense the tax system has been simplified, and in this regard primarily for physical individuals. In relative terms, the reporting of taxes is most burdensome for the very smallest companies. Attention should be focused on simpli- fying the rules.

The efficiency of the economy

In the long run, the new tax system should generate a number of efficiency gains, even though it may be difficult to express them in quantitative terms. These gains are due to the narrower tax wedges and the increase in the supply of labour. A further benefit is that the reform has improved the incentives to allocate capital more efficiently. Less tax planning have also given rise to conditions that will help to improve the efficiency of the economy as a whole.

Stability of the rules

The tax system did not acquire the stability that had been explicit- ly hoped for. A number of changes in the rules have been made since the reform, but despite all these changes the view of the committee is that the fundamental features of the reform are still in place. It is important that greater stability be given to the rules of the tax systern and that the underlying principles are safeguar- ded in the future, if the reform is to produce the effects that were intended and expected.

1. Inledning

1.1. Sammanfattning av direktiven

Skattereformen 1990—1991 var mycket omfattande och förutsågs i väsentliga avseenden påverka hushållens och företagens ekono- miska situation och därigenom förändra förutsättningama för ekonomins funktionssätt på ett genomgripande sätt. Effekterna av reformen skulle därför följas noggrant. ljuni 1990 bemyndigade regeringen statsrådet Åsbrink, som inom regeringen hade ansvaret för skattefrågor, att tillkalla en kommitté med uppdrag att utvärdera 1990-1991 års skattereform.

Enligt direktiven skall kommittén samordna de olika aktiviteter- na och gentemot regeringen ha det övergripande ansvaret för utvärderingen. En väsentlig del av utvärderingen skall ske i form av forskning om skattereformens samhällsekonomiska effekter. I direktiven anges att det är naturligt att denna forskningsinriktade del av utvärderingen sker under ledning av Konjunkturinstitutet och Ekonomiska Rådet.

Enligt direktiven bör en förstärkning göras av statistikunderlaget för utvärdering av skattereformen genom särskilda undersökningar och genom att redan planerade undersökningar kompletteras för att bättre belysa främst hushållens ekonomiska förhållanden.

Direktiven återfinns i sin helhet i bilaga 6.

l direktiven anges det som viktigast att belysa effekterna på nedanstående områden.

Effekterna på fördelningen av inkomster och förrn egenheter är en central fråga. Skattereforrnens övergripande syfte är att ge en samhällsekonomiskt mera effektiv beskattning samtidigt som de fördelningspolitiskamålen uppfylls. Även effekterna av de särskilda fördelningspolitiska åtgärder som vidtogs i samband med skatte-

reformen i form av höjda barnbidrag, bostadsbidrag, pensions- tillskott och kommunala bostadstillägg borde beaktas.

Frågan om i vilken mån skattereformen påverkar utbudet och allokeringen av arbetskraft borde belysas bl.a. mot bakgrund av att två underlagsrapporter som redovisades av inkomstskatteutred- ningen (SOU 198933, del IV) gav väsentligt olika resultat. En intressant delfråga är därvid hur reformen påverkar rörligheten på arbetsm arknaden.

Effekter på lönebildningen borde studeras. Lönestrukturen kan påverkas av skattereformen bl.a. genom att lägre marginalskatter kan leda till en minskad spridning av lönerna före skatt. Det var därför viktigt att belysa skattereformens effekter på arbetskraftsut- bud och inkomstfördelning både vid givna löner och vid beaktande av möjliga effekter via förändrad lönestruktur.

De nya reglerna för beskattning av kapitalavkastning inom företag och för hushåll blev väsentligt mera likformiga jämfört nred tidigare regler och kunde därför väntas påverka fördelningen mellan olika typer av investeringar och olika sparformer. Även hushållens och företagens skuldsättning liksom de totala investe- ringarna och det totala sparandet kunde komma att påverkas. Det var därför av vikt att reformens effekter på sparande och kapital— allokering blev föremål för studier. Ett intressant delområde var därvid effekter på företagens finansiering och investeringar.

Skattereformen beräknades ge påtagliga effekter på bostads- marknaden. Efterfrågan på bostäder, boendekostnadema och deras andel av hushållsbudgeten samt prisbildningen på småhus och bostadsrätter var områden som borde bli föremål för analys. Effekter på rörligheten på bostadsmarknaden borde också studeras.

Skattereformens effekter för jämställdheten mellan könen borde beaktas. Olika aspekter på denna fråga aktualiseras inom flera av ovan beskrivna områden.

Vid sidan av dessa områden anges i direktiven en rad andra områden, bl.a. skatteplanering, för vilka det ankom på kommittén att avgöra om det var lämpligt att genomföra särskilda analyser av skattereformens effekter.

1.2. Utredningsuppdragets genomförande

KUSK:s uppdrag avviker från det som är normalt för statliga kommittéer. Uppgiften har varit att på ett mera övergripande plan se till att en utvärdering kommer till stånd av effekterna av en genomförd reform. Det normala för statliga kommittéer är att inom ramen för kommittén utarbeta förslag till förändringar i olika

regelsystem m.m. I fokus för KUSK har i stället stått de samhälls- ekonomiska effekterna och en uppföljning av fattade beslut.

Kommittén har haft drag av forskningsråd. Med utgångspunkt i direktiven har KUSK som sin främsta uppgift haft att initiera att en vetenskaplig utvärdering med god kvalitet kommit till stånd inom de områden som utpekas i direktiven. Forskningsarbetet har skett fristående från kommittén. Kommittén har aktivt följt det arbete som bedrivits bl.a. genom särskilda avrapporteringar från de projektansvariga. För de resultat och slutsatser som redovisas i rapporterna till KUSK svarar författarna helt själva. '

Som en del i det övergripande ansvar KUSK haft för utvär-' deringen gentemot regeringen, har kommittén som sitt uppdrag sett att sammanfatta de huvudresultat forskarna presenterat i rapporter till kommittén. Därvid har kommittén i en del fall funnit anledning att komma med kompletterande synpunkter.

Medel för förbättring av statistikunderlaget

Redan innan kommitténs arbete började hade förberedelser vidtagits för att få fram underlag för att bedöma behovet av förbättringar av statistiken. På uppdrag av Ekonomiska Rådet hade en arbetsgrupp utrett vilka typer av data som borde samlas in för att bättre belysa främst hushållens ekonomiska förhållanden. En ram om 10 miljoner kronor hade avsatts särskilt för detta ändamål. Genom denna satsning skulle statistikunderlaget förbättras även för andra projekt än kommitténs. I enlighet med direktiven skulle kommittén mot bakgrund av arbetsgruppens rapport och i samråd med Konjunkturinstitutet och Ekonomiska Rådet avgöra hur medlen skulle användas. Det var med hänsyn till planeringen av statistikinsamlingen viktigt att snabbt fatta beslut i denna fråga.

Kommittén beslutade i oktober 1990 att medlen för förbättring av statistikunderlaget skulle fördelas enligt följande:

Utbyggnad av Statistiska Centralbyråns årliga inkomstfördelningsundersökning ("HINK") 4,75 mkr

Delfinansiering av undersökning om hushållens ekonomiska levnadsförhållanden ("HUS") ledd av nationalekonomiska institutionen vid Göteborgs universitet 3,5 mkr

Delfinansiering av en levnadsnivåundersökning (LNU) vid Institutet för social forskning vid Stockholms Universitet 1,75 mkr

HINK är en undersökning av hushållens inkomster som görs årligen inom ramen för den officiella statistiken. De extra medel som anvisats har i första hand använts för ett extraurval avseende höginkomsttagare och förmögna hushåll, för en mera fullständig panelansats samt viss kvalitetsförbättring av löneuppgiftema.

Projektet HUS drivs i samarbete mellan nationalekonomiska forskare vid flera olika institutioner. Uppgiftsinsamling för hushållen har gjorts vid tre tidgare tillfällen: 1984, 1986 och 1988. Med stöd av delfinansieringen från kommittén har genomförts HUS-undersökningar för 1991 och 1993.

Levnadsnivåundersökningar (LNU) har genomförts 1968, 1974 och 1981 — den första undersökningen skedde på uppdrag av låginkomstutredningen. Till databasen har dessutom knutits registerdata för mellanliggande år samt bakåt i tiden till 195 O-talets början. Databasen är värdefull bl.a. för studier av förändringar i ett längre perspektiv. En ny levnadsnivåundersökning har genom- förts 1991. Delfinansieringen från KUSK har varit ett sätt att garantera att de för en utvärdering av skattereformen relevanta frågorna kom med i den senaste undersökningen.

F orskningsom råden

Utvärderingen av skattereformens samhällsekonom iska effekter skall enligt direktiven i huvudsak ske under ledning av Kon- junkturinstitutet och Ekonomiska Rådet. En överenskommelse träffades under hösten 1990 mellan kommittén och Konjunkturin- stitutet och Ekonomiska Rådet om formerna för detta arbete (bilaga 6). Ekonomiska Rådet utsåg i sin tur professorerna Jonas Agell, Peter Englund och Jan Södersten som ledare för projektet. Arbetet har för deras del inneburit att initiera studier inom olika delom- råden, följa dessa, att sj älva utföra kompletterande studier så att det sammantagna underlaget blev fullödigt samt utarbeta en samman- fattande slutrapport. Denna återfinns som helhet i bilaga 1. Bilagan föreligger i form av separat volym. De tre professorerna har engagerat ett stort antal forskare som har belyst olika delområden. Totalt har det rört sig om ett forskningsprogram omfattande ett tjugotal separata studier med ett trettiotal involverade forskare. Dessa forskarrapporter publiceras i en särskild serie "Tax Reform Evaluation Reports" utgiven av Ekonomiska Rådet och Kon- junkturinstitutet inom ramen för institutets publikation av s.k. Working Papers. Det kan också nämnas att tidsskriften Swedish Economic Policy Review under hösten 1995 har ett temanummer kring vissa av forskningsresultaten.

I syfte bl.a. att få ett svar på frågan om skattesystemet blev enklare till följd av skattereformen har KUSK också initierat en kartläggning av skattereformens effekter på "skattesystemets driftskostnader" dvs adm inistrationskostnader för myndigheter och skattskyldiga. Ett annat område som kommittén valt att låta analysera särskilt är reformens effekter på skatteplanering och skattefusk. En separat rapport om dessa frågor publicerades våren 1994]. En sammanfattning av huvudresultaten återfinns i detta betänkande som bilaga 2.

En undersökning av allmänhetens attityder till skattereformen har på uppdrag av KUSK gjorts vid sociologiska institutionen vid Umeå universitet. Undersökningen har letts av professor Rune Åberg som sammanfattar resultaten i bilaga 32.

Kommittén har också gjort en särskild sammanställning av basuppgifter om hushållens inkomstutveckling 1989—1992. Denna finns fogad till betänkandet som bilaga 4.

En uppföljning av de fördelningseffekter av skattereform en som angavs i propositionen om skattereformen har på uppdrag av KUSK gjorts av Bengt Eklind, Joakim Hussénius och Rolf Johans- son. Denna återfinns i bilaga 5.

Kommittén sammanfattar i det följande utvärderingens huvud- resultat (kapitel 3). På det hela taget ställer sig KUSK bakom de bedömningar som görs av författarna i bilagorna. I de fall KUSK funnit anledning att göra kompletterande överväganden har dessa i första hand tillfogats i ett särskilt avsnitt (kapitel 4).

IMalmer H; Persson A; Tengblad Å. Århundradets skattereform. Effekter på skattesystemets driftskostnader, skatteplanering och skattefusk. 1994. Fritzes. 2Sammanfattningen bygger på en hösten 1993 publicerad rapport: Åberg R. Århundradets skattereform? Politik och opinion kring 1991 års skattereform. Fritzes.

2. Bakgrunden till skattereformen

Kritiken mot skattesystemet ökade under l980-talet3. Det ansågs komplicerat och orättvist. De höga fördelningspolitiska ambitioner som uttrycktes av de formella skatteskaloma visade sig inte ge full effekt i praktiken. Olika studier visade att inkomsttagarna på olika sätt anpassade sig så att den faktiska skatt man betalade i genomsnitt var lägre än vad skattesatserna gav uttryck för. En viktig förklaring var beskattningen av boendet och underskottsav- dragen. Systemet gynnade skatteplanering och "skattetänkandet" var utbrett. Höginkomsttagare som "trollade bort" hela sin skatt s.k. nolltaxerare uppmärksammades i massmedia. De som kunde tog hellre ut en löneökning i form av lågt beskattade eller skattefria förmåner. Skattesystemet ansågs inflationsdrivande och inflationen medförde i sin tur godtyckliga omfördelningseffekter.

I syfte att komma tillrätta med dessa problem genomfördes en relativt omfattande marginalskattereform 1982, varvid även underskottsavdragens värde begränsades på ett sätt som då ansågs mycket radikalt. Trots dessa åtgärder fortsatte kritiken mot systemet. I fokus för kritiken stod nu även systemets skadeverk- ningar på resursutnyttjandet och den ekonomiska tillväxten.

En rad länder initierade och genomförde skattereformer under 1980-talet. Den gemensamma nämnaren för dessa reformer var breddade skattebaser och sänkta marginalskatter samt en för- skjutning av skatteuttaget från direkta till indirekta skatter. Sverige var inte det första i raden av reforrnländer och inte heller det sista. Sverige var däremot det land som gjorde den mest omfattande och genomgripande omläggningen. Reforrnerna motiverades i alla

3En beskrivning av den skattepolitiska debatten under hela efterkrigstiden återfinns i bilaga 3.

länder med förenkling, större symmetri och mera likformig behandling av inkomster av olika slag, lägre skattesatser samt . minskade möjligheter till skatteplanering.

Den svenska skattereformen utformades inom ramen för tre olika utredningar. Sommaren 1985 utfärdade regeringen direktiv för en översyn av företagsbeskattningen (URF Utredningen om Reformerad Företagsbeskattning). Därpå tillsattes sommaren 1987 dels en utredning (RINK Reformerad lNKom stbeskattning) med uppgift att göra en översyn av inkomstskattesystemet i de delar som inte behandlades av URF, dels en utredning (KIS —— Kommit— tén för lndirekta Skatter) om den indirekta beskattningens omfattning och utformning. Alla tre utredningarna avgav slut- betänkanden i juni 1989. Förslagen var att betrakta som ett samlat paket uppdelningen i tre utredningar var betingad av praktiska skäl. Förslagen antogs utan större förändringar av riksdagen och genomfördes i två etapper åren 1990 och 1991.

Skattereformen var mycket omfattande både i ett historiskt och in- ternationellt perspektiv. Den berörde på ett genomgripande sätt både den personliga inkomstskatten, företagsbeskattningen, socialavgiftema, mervärdesskatten och punktskatterna. Sänkningen av skattesatserna i den personliga inkomstskatten beräknades motsvara 6 procent av bruttonationalprodukten (BNP).

Det övergripande målet för skattereformen var (prop. 1989/90:110 sid 294):

"att åstadkomma en samhällsekonomiskt effektiv beskattning samtidigt som fördelningspolitiska mål uppfylls. Arbete och sparande skall ges en bättre skattemässig behandling medan villkoren för lånebaserad konsumtion och förmögenhetsupp- byggnad försämras. En likvärdig behandling av arbetsinkomster och inkomster av kapital skall komma till stånd. Skatteplanering och skatteflykt skall motverkas. Inte minst härigenom kommer den fördelningspolitiska träffsäkerheten att förbättras"

Ett annat viktigt mål med reformen var att åstadkomma långsiktigt stabila skatteregler.

De viktigaste grundelementen för att uppnå de angivna målen var en mer neutral och likformig behandling av olika slag av inkomster, lägre skattesatser och breddade skattebaser. Ändringar-

na var inbördes beroende av varandra t.ex. var breddningama av baserna både att se som ett inslag i den likformiga behandlingen av olika slags inkomster samtidigt som de var en förutsättning för att skattesatserna skulle kunna sänkas. En mycket viktig förändring var separatbeskattningen av inkomstslaget kapital. Avsikten var att

reformen skulle vara totalfinansierad. Liksom i andra länder innebar reformen en förskjutning från direkt till indirekt be- skattning.

Skattereformen utreddes och beslutades under en period då svenska ekonomin gick på högvarv och arbetsmarknaden var överhettad. Under slutet av 1980-talet ökade förvärvsfrekvensen till över 84 procent och arbetslösheten låg under 2 procent samtidigt som de arbetsmarknadspolitiska insatserna dragits ned. Det fanns en brist på arbetskraft särskilt yrkesutbildad. Presentationen av skattere- formen kom att präglas av dessa förhållanden. Att få folk att ställa upp på att arbeta mera och att minska problemet med "flaskhalsar" i vissa bristyrken var en viktig förutsättning för tillväxten. På lång sikt gäller detta argument fortfarande. Andra effektivitetsaspekter på reformen fanns också med i bilden men gavs inte samma utrymme i presentationen. En annan fråga som präglade andra hälften av 1980-talet var den kraftiga ökningen av hushållens upplåning som skedde i samband med avregleringen av kredit- marknaden. Sparkvoten sjönk och den ökade upplåningen bidrog till att hålla hushållens konsumtion och investeringar på en hög nivå. Värdet på fastigheter blåstes upp som en följd av de goda lånemöjlighetema.

I efterhand kan konstateras att den ekonomiska miljön då reformen genomfördes blev väsentligt annorlunda. 1 de ekonomiska bedömningar som gjordes i slutet av 1980-talet och under 1990 fanns dock inte detta scenario med i bilden. 1 utredningarna kring skattereformen diskuterades inte heller i någon större utsträckning vilka effekter skattereformen kunde tänkas få vid olika kon- junkturprofiler.

Den ovanligt långa högkonjunkturen vände och vändningen i det ekonomiska läget blev för svenska förhållanden dramatisk. Efter en rad år med höga löneökningar kom 1990 klara tecken på en kostnadskris i den svenska ekonomin. Konkurrenskraften hade urholkats och industriproduktionen föll. Valutautflödet ökade och räntorna höjdes. Ett åtgärdspaket tillkom i syfte att stärka eko- nomin och de offentliga finanserna. Ett tvåårigt löneavtal med låga löneökningar slöts för åren 1991 och 1992. Sommaren 1991 ansågs åtgärderna ha fått effekt. Förtroendet för den svenska ekonomins framtid hade förstärkts. Räntorna sjönk. Svenska kronan knöts till ecun och Sverige ansökte om medlemskap i EG.

Men under hösten 1991 återkom tecknen på problem i eko- nomin. Den höga räntenivå som etablerades för att motverka valutautflödet medförde en rad andra problem för ekonomin. Investeringsviljan, som med hänsyn till osäkerheten om framtiden redan var låg, knäcktes. De höga räntorna fick följder för fastig- hetsmarknaden och fastighetsprisema föll. Kostnadskrisen i företagen och höga räntor medförde rationaliseringar och be- sparingar i den privata sektorn och en betydande utslagning av

företag. Arbetslösheten och statens budgetunderskott ökade mycket kraftigt. Hösten 1992 kunde kopplingen till ecun inte längre försvaras med räntevapnet och kursen på den svenska kronan släpptes fri. Kronans kurs har därefter fallit kraftigt jämfört med 1992. Den svenska exportindustrin har efter rationaliseringar och sänkt kronkurs återhämtat sig starkt och snabbt, men produktionen för den inhemska marknaden är fortsatt svag. Hushållen har hållit tillbaka konsumtionen och investeringarna och betalat av på skulder. Skattereformen har bidragit till denna utveckling, men också den allmänna ekonomiska osäkerheten och den mycket höga arbetslösheten.

Skattereformens effekter måste i en utvärdering ses både i den roll den spelat i utvecklingen under de senaste åren och i ett längre perspektiv. Med andra ord är det viktigt att skilja på vad som är övergångseffekter och vad som kan förväntas och krävs av

skattesystemet på längre sikt.

3. Utvärderingens huvirdresultat

3.1. Inledning

En utvärdering av skattereformen bör ta som utgångspunkt de samhällsekonomiska mål och de förväntningar om beteende- förändringar som fanns. Dessa uttrycktes i mycket övergripande termer i utredningsbetänkanden och i propositioner. Professorema Agell-Englund-Södersten har i sin utvärderingsrapport (bilaga 1; separat volym) uttolkat dessa till storheter och variabler som går att följa upp och utvärdera. Kommittén ansluter sig i stort till den syn på skattereformen och dess effekter som presenteras i pro- fessoremas utvärdering. Därutöver har KUSK, efter diskussioner i kommittén, funnit anledning att särskilt ta upp vissa ytterligare synpunkter på reformen (kapitel 4).

Ett problem som funnits i samtliga studier är att definiera och avgränsa vad som skall avses med skattereformen. Man brukar säga att skattereformen genomfördes i två etapper, 1990 och 1991. Men vissa åtgärder som kan ses som led i skattereformen hade genomförts redan 1989. Detta gäller t.ex. bolagsskattesatsen som började sänkas redan 1989. Minskningen av skattereduktionen för kapitalunderskott från 50 till 30 procent inom personbeskattningen inleddes också 1989 med en sänkning till 47 procent. Andra inslag i skattereformen kom inte att genomföras fullt ut till 1991. T.ex. avskaffades vissa punktskatter som ett led i skattereformens förenklingssträvanden, men detta skedde först 1993. Avtrappningen av pensionäremas särskilda grundavdrag mot kapitalinkomster behölls fram t.o.m. 1992. För pensionärerna i avtrappningsskiktet var därför skatten på kapitalinkomst högre än 30 procent åren 1991 och 1992. Avtrappningen upphörde 1993 som ett led i fullföljandet av reformen. Det fanns också frågor som man inte hann med att ta ställning till i utredningarna. Utformningen av förmögenhets- skatten var en sådan fråga liksom den slutliga utformningen av beskattningen av egenföretagare. Många förändringar av skattereg- ler har gjorts efter 1991 till följd av nya beslut. T.ex. kom den enhetliga momsskattesatsen som infördes 1991 att differentieras

redan efter ett år. Ekonomiprofessorema har som huvudaltemativ i sin utvärdering de skatteregler som gällde för 1991 och jämför med förhållandena före 1990. I vissa fall har det varit möjligt att också redovisa effekterna av senare förändringar. I vissa andra fall spelar avvikelserna i förhållande till den urprungliga reformen inte någon avgörande roll för den ekonomiska utvärderingen beroende på att analysmetoderna är förhållandevis grova och slutsatserna i huvudsak av kvalitativ natur.

Ett annat problem är den tidsperiod inom vilken effekterna av reformen kan förväntas uppträda. Lågkonjunkturen under början av 1990-talet gör att det på vissa områden inte blev så stora effekter på kort sikt som väntat. Skattereformens fördelningspolitiska effekter för hushållen kan tämligen väl mätas med 1992 som jämförelseår för förhållandena efter skattereformen. Effekterna för företagen och dynamiska effekter av olika slag torde däremot kräva en längre period för att man empiriskt skall kunna belägga de mer långsiktiga effekterna av reformen.

Redovisningen i avsnitten 3.2-3.4 är ett koncentrat av de resultat som redovisas i bilagorna. Först behandlas reformens effekter på olika marknader och på olika ekonomiska beslut uppdelat på fyra områden nämligen skatteplanering och skattefusk, sparande och konsumtion, företagen samt arbetsutbudet. Därefter sammanfattas resultaten vad gäller effekterna på de samhällsekonomiska målen för den ekonomiska politiken: stabilitet, inkomstfördelning och samhällsekonomisk effektivitet. Ett särskilt avsnitt ägnas åt frågan om skattereformen medförde enklare regler. Slutligen behandlas allmänhetens inställning till skattereformen.

3.2. Reformens beteendeeffekter 3.2.1 Skatteplanering och skattefusk Skattereform en och skatteplanering

Skatteplanering är ett lagligt förfarande, skattefusk ett olagligt. Skatteflykt ett oklart begrepp däremellan.

Begreppet skatteplanering fick under 1980-talet en negativ klang, vilket till en del beror på att rådgivare som skatteplanering marknadsförde förfaranden vars rättsliga innehåll ifrågasatts av skattemyndighetema eller vid rättslig prövning föranlett beskatt- ning. Till denna attitydförskjutning kan också ha bidragit den massmediala exponeringen av skatteplaneringsråd och exempel på genomförd skatteplanering med mycket stora belopp.

Fem förklaringsfaktorer bidrar främst till skatteplanering: Olika inkomster beskattas olika, inkomstskatt tas ut efter en progressiv

skala, skattesubjekt beskattas olika, beskattningsunderlaget är inte entydigt bestämt samt möjligheterna till skattekredit. Skatteplane- ring går därför ut på att utnyttja asymmetrier i form av olika skatteprocenter och skilda beräkningsmetoder av inkomster samt att skjuta skatteuttaget på framtiden.

Under de gångna decennierna har statsmakternas kamp mot skatteplaneringen förts i en ständig växelverkan med skatte— planeramas jakt på nya möjligheter att undgå skatt. Nya kryphål har upptäckts och utnyttjats under en tid, för att sedan avbrytas genom en särskild stopplagstiftning. Processen har delvis varit sj älvförstärkande, genom att den successivt växande komplexiteten i regelverket skapade nya oförutsedda kombinationsmöjligheter. Skatteplaneringen bredde ut sig. Skatteplanering förekom inte bara hos privatpersoner och i företagen. Det finns exempel på att äv en kommuner och andra skattefria subjekt deltagit och dragit fördel av skatteplaneringen. Önskemålet att komma tillrätta med skatte- planeringen fick stor betydelse för skattereformens allmänna inriktning. Reformen representerar ett nytt angreppssätt för att förhindra skatteplanering genom att den slår mot de avgörande förutsättningama för skatteplaneringen.

En punkt där studierna är samstämmiga är att skattereformen levt upp till målet att motverka skatteplanering. Skattereformen minskade möjligheterna till skatteplanering och omfattningen på skatteplaneringen minskade. Detta gäller både för privatpersoner och för skatteplaneringen inom företagssektorn. Den minskade skatteplaneringen är av betydelse för träffsäkerheten i fördelnings- politiken, för den samhällsekonomiska effektiviteten samt för skatteintäkternas nivå.

1 massmedia uppmärksammas fortfarande 1995 en del fall av skatteplanering med stora belopp. Dessa fall sammanhänger i allmänhet med att den rättsliga prövningen dragit ut på tiden och är kopplade till det gamla skattesystemet.

Ett par exempel på hur skattereformen ändrat villkoren för tidigare vanligt förekommande skatteplanering ges här.

De familjetransaktioner av olika slag som utnyttjades för att dra fördel av skillnaderna i kapitalbeskattningen mellan olika individer blev meningslösa genom den nya enhetliga och separata kapital— skatten. Då alla familjemedlemmar betalar 30 procents skatt på kapitalinkomster utan några fribelopp blir beskattningen densamma oavsett hur inkomsterna fördelas mellan föräldrar, barn och makar med olika inkomster.

Som en effekt av skattereformen har intresset minskat för den typ av skatteplanering som utnyttjat skillnaderna i beskattning mellan olika företag. Med den halverade bolagsskattesatsen och begränsade avdragsrätten ger leasingavtal och andra arrangemang

mindre utbyte i form av minskad skatt, samtidigt som företagens skattesituation blir mer likartad då konsolideringsmöjlighetema är begränsade.

Med de nya reglerna blev det vidare mindre lockande att omvandla löpande kapitalinkomster till reavinster, eftersom skattesatsen är densamma. Det mesta av vinsterna på att systema- tiskt kvitta förluster på korta aktieinnehav mot vinster på längre uteblir, då skattereglerna inte längre skiljer mellan "yngre" och "äldre" aktier. Begränsningar i kvittningsmöjlighetema för icke börsnoterade aktier liksom i avdragsrätten för skuldräntor över 100.000 kronor har ytterligare beskurit tidigare möjligheter till lönande skatteplanering.

Vissa undantag från en enhetlig kapitalbeskattning kvarstår dock även efter reformen och under de senaste åren har ytterligare undantag både tillkommit och försvunnit. Bl.a. gavs pensionsspa- rande och placeringar via andra slag av institutionella mellanhän- der en viss särställning även efter 1991.

Ett viktigt problem, som diskuterades inför 1991 års reform och som fått förnyad aktualitet i samband med senare skatteom- 1äggningar, är möjligheterna att i skatteplaneringssyfte utnyttja skillnaderna i beskattningen mellan arbets- och kapitalinkomster. En uttalad målsättning med reformen var att uppnå en likformighet i skatteuttaget. Trots detta gäller att det i de högre inkomstskikten finns kvar en avsevärd skillnad. Det finns därför även efter skattereformen uppenbara incitament att överföra verksamhet till ett helägt bolag och begränsa löneuttaget till åtminstone den gräns där statlig inkomstskatt börjar utgå. Spärregler har införts i lagstift- ningen för att förhindra beteende av detta slag. Det är dock en kontroversiell fråga hur avvägningen skall göras mellan ett system som utgör ett effektivt hinder mot att skattemässigt omvandla arbetsinkomster till kapitalinkomster och ett system som stimulerar företagen till visst risktagande.

Trots svårigheterna att kvantifiera effekterna är det rimligt att hävda att skatteplaneringen haft stor betydelse för beskattningens fördelningspolitiska träffsäkerhet. Det står också klart, inte minst mot bakgrund av den ekonomisk-politiska debatten under åren före skattereformen, att skatteplaneringen i vida kretsar sågs som ett växande hot mot allmän skattemoral och samhällssolidaritet. Vetskapen om att vissa grupper i samhället genom mer eller mindre avancerad skatteplanering undviker skatt kan hos andra grupper vara ägnad att luckra upp moraliska och andra hämningar mot regelrätt skattefusk.

Ett uttalat syfte med skattereformen var att nå större likformighet och horisontell rättvisa i individbeskattningen, dvs att "lika skulle beskattas lika". En specialstudie har gjorts av de 10 procent av in- dividerna i aktiv ålder som har högst arbetsinkomst. Med denna

avgränsning omfattar denna grupp av höginkomsttagare ca 450.000 individer och de har en förvärvsinkomst som överstiger 246.000 kronor (1992). En simuleringsstudie (bilaga 2) visar att den skatt höginkomsttagarna betalar på sin arbetsinkomst efter skatterefor- men i högre grad svarar mot den formella skattesatsenjämfört med före reformen (se diagram 1). Inkomst-, avdrags- och förmögen- hetsförhållanden m.m. vid sidan av arbete ger en betydligt mindre "skatterabatt" än tidigare. Referensnivån är därvid den skatt som skulle utgått om personerna endast haft sin arbetsinkomst.

1.Diagram: Höginkomsttagare. simulerad fomrell skatt på förvärvsinkomst samt faktisk skatt uttryckt i % av förvärvsinkomsten.

5 E G

i 48%

m

,E 46%

i ., & 44/0 >

: 42% € : = 40% ......................................... Faktisk skatt ..... gap 13% ........... 552904 38% .............................................................................. ..; 16% | r | 1

1980 1985 1989 1990 1991 1992 Inknmstår

Diagrammet visar att simulerad formell skatt på förvärvsinkomst, uttryckt som andel av förvärvsinkomsten, minskat med 11,5 pro— centenheter mellan 1980 och 1991 (från 52,6 till 41,1%). Den faktiska skatten har under samma period "bara" minskat med 2,3 procentenheter (från 42,1 till 39,8% av förvärvsinkomsten). Detta innebär att skatterabatten till följd av inkomstförhållanden vid sidan av arbete har minskat kraftigt. Minskningen av rabatteringen uppgår till 9,2 procentenheter varav 4,1 procentenheter i samband med skattereformen och 5,1 procentenheter tidigare under 1980- talet.

Orsakerna till den minskade skatterabatteringen för högin- komsttagama förefaller för perioden före skattereformen i första hand vara förändringar i skatternas regelsystem. Förändringar i individernas ekonomiska beteende tycks inte givit något bidrag till den minskade differensen. För skattereformsåren 1990 och 1991 kan minskningen av gapet tillskrivas såväl förändringarna i skattesystemets utformning som beteendeförändringar hos in- dividerna.

Diagram 1 visar genomsnittssiffror för hela gruppen höginkom stta- gared. Rabatteringen varierade kraftigt mellan individerna. Andelen personer i höginkomstgruppen som mer än halverat skatten på arbetsinkomsten (i förhållande till den formella skatten) har minskat från 10 procent (42.000 personer) 1980 till ett par promille (ca 1.000 personer) 1992. Skatten "trollas" inte längre bort utan de formella skattesatserna i skatteskaloma slår igenom på ett helt annat sätt än tidigare. Skattereformens idé om horisontell rättvisa och att lika skall beskattas lika har fått synbart genomslag för personer med de högsta arbetsinkomstema. Det är att märka att även de skatteomläggningar som gjordes under första hälften av 1980-talet har bidragit till detta.

Denna beskrivning av hur skattesystemet verkat för höginkomstta- gama före och efter skattereformen ger indirekt en uppfattning om skattesystemets roll när det gäller att uppmuntra olika beteenden beteenden som i en del fall kan ha karaktär av skatteplanering.

En mera direkt indikation på att skatteplaneringen kunde ha stor betydelse med det gamla skattesystemet ges i en undersökning som Riksskatteverket genomförde 1987. Undersökningen omfattade ett 70-tal nyintroduktioner på Stockholms fondbörs som åtföljdes av försäljningar från de tidigare huvudägama. Försäljningama gav upphov till reavinster på drygt en miljard kronor. Enligt gällande regler motsvarade detta beskattningsbara reavinster på knappt 300 miljoner kronor. Efter olika kvittningsförfaranden kunde de gamla ägarna emellertid begränsa det belopp som faktiskt togs upp till beskattning till 15 miljoner kronor.

Skatteplaneringen påverkar också den samhällsekonomiska effektiviteten, både direkt och indirekt. Den direkta effektivi- tetskostnaden sammanhänger med att skatteplaneringen inkräktar på skattebetalarnas tid för samhällsekonomiskt sett produktiv verksamhet, underhåller en överdimensionerad kår av skattejurister och andra som svarar för experthj älpen samt skapar snedvridningar mellan verksamheter som i olika grad utnyttjar skatteplanering. Det indirekta effektivitetsproblemet skapas av statsmakternas behov av att ersätta det intäktsbortfall skatteplaneringen medför. Ju mer omfattande skatteplaneringen är, desto högre ställs kraven på att inom andra delar av skattesystemet kunna generera tillräckliga

*Med höginkomsttagare avses här inkomsttagare i decil 10. För att ge en uppfattning om vilka inkomstnivåer som fångas upp i denna grupp kan nämnas att nedre gränsen för denna decil år 1992 låg vid en förvärvsinkomst på ca 246.000 kr och genomsnittet för decilen på 341.000 kr.

skatteintäkter. Denna extrabeskattning kan i sin tur medföra effektivitetssänkande ekonomiska anpassningar.

Grunden för internationell skatteplanering och skattefusk är skillnaderna i skattesatser och svårigheterna att med enkla och effektiva metoder upprätthålla kontrollen av att den svenska skattelagstiftningen inte kringgås. Avregleringen av valutamarkna- den har medfört att det blivit enklare att göra transaktioner med utlandet vilket också underlättar internationell skatteplanering och skattefusk. Det som tidigare varit en fråga för de valutareglerande myndigheterna har i stället kommit att bli en fråga för skattelag- stiftningen och skattemyndighetemas kontroll. Det gamla skattesys- temet skulle i denna nya miljö fungerat allt sämre. Skattereformen med dess lägre skattesatser på kapital och företag får i detta perspektiv sägas ha genomförts vid rätt tidpunkt. Skattereformen har dämpat effekterna av de ökade möjligheter till internationell skatteplanering och skattefusk som uppkom i samband med valutaavregleringen. Bilden skulle annars ha varit mörkare.

Det nya skattesystemet lindrar problemen. Men problemen finns ändå kvar och kommer sannolikt att få ökad uppmärksamhet framöver. Frågan om att värna de svenska skattebasema kommer att vara av stor Vikt. Vissa regler i skattelagstiftningen är enkla att kringgå för de skattskyldiga och fusket är svårt att upptäcka för skattemyndighetema.

Före 1989 utgjorde valutaregleringar ett visst hinder för internationell skatteplanering och skattefusk. Valutaregleringen slopades i etapper med början 1989 när tillstånd inte längre behövdes för utlandsinvesteringar. År 1992 föll de sista restriktio- nerna när det blev tillåtet för privatpersoner att öppna bankkonton i utländska banker.

Den slopade valutaregleringen framtvingade lagstiftning för att kontrollera att svensk skattelagstiftning inte kringgås. T.ex. gäller detta lagstiftningen 1989 om definitionen av begreppet utländskt bolag och reglerna om att delägare i en utländsk juridisk person som inte utgör utländskt bolag i vissa fall skall beskattas i Sverige för sin andel i den utländska juridiska personens resultat. Kontrolluppgiftsskyldighet i vissa fall har också införts för banker och andra som förmedlar betalningar till eller från utlandet. Vidare infördes regler om att innehav av bankkonton utomlands skall anmälas av kontoinnehavaren men så sker i mycket liten ut- sträckning. Det finns också regler om att utländska banker där svenskar öppnar konton ska lämna uppgifter till de svenska skatte- myndighetema på i princip samma sätt som svenska banker är skyldiga att göra. Utländska banker är dock inte särskilt villiga att fullgöra denna skyldighet. Ett annat exempel på svårigheterna att

kontrollera att skattelagstiftningen följs är den premieskatt som skall tas ut på pensionssparande i utlandet i syfte att uppnå konkurrensneutralitet med inhemskt pensionssparande. Några enkla och effektiva kontrollmöjligheter finns inte och av allt att döma är mörkertalen betydande.

Skattereform en och skattefusket

Skadeverkningama av skattefusk uppkommer genom en omför- delning av skattebördan mellan olika inkomsttagare och från effekterna på den samhällsekonomiska resursanvändningen. Omfördelningen kan upplevas som orättvis och ha negativa effekter på skattemoralen, på det politiska systemet och samhällets funktionssätt. Ett av målen med skattereformen var att minska incitamenten till skatteplanering och skattefusk. Utvärderingen visar, vilket redovisats ovan, att skattereformen faktiskt lett till minskad skatteplanering. När det gäller skattefusket är det svårare att ge ett klart svar på frågan om skattereformen lett till minskat skattefusk.

Det ligger i sakens natur att det är förenat med betydande svårig- heter att kartlägga omfattningen av dold verksamhet och skatteun- dandragande. Man kan inte räkna med att få veta hela sanningen.

En metod att mäta svarta sektorn går ut på att för hushållssektorn i nationalräkenskapema jämföra inkomstanvändningen (inkluderar de svarta inkomsterna) med vad som faktiskt rapporteras i inkomstdeklarationer och företagsbokföring. I princip kan skillna- den betraktas som en grov uppskattning av den inkomst som inte har redovisats till skattemyndighetema. En sådan kalkyl har på uppdrag av KUSK gjorts av Åke Tengblad, f.d. chef för national- räkenskapema vid Statistiska Centralbyrån5 . Under perioden 1980- 1992 har den svarta sektorn mätt på detta sätt inte ökat utan förefaller vara relativt konstant eller svagt minskande. Kalkyler av detta slag är dock osäkra. Den svarta sektorn utgör enligt be- räkningsmetoden ca 5 procent av BNP varav 2,8 procentenheter är hänförligt till företagarinkomster.

1 den kalkyl som Åke Tengblad gjort kan särskiljas räntor/ut- delningar. Beräkningarna visar att andelen räntor och utdelningar som inte kommer fram till beskattning minskat, vilket bl.a. torde

5Åke Tengblad. Beräkning av svart ekonomi och skatteundandragandet i Sverige 1980-1991. Århundradets skattereform. Effekter på skattesystemets driftskostnader, skatteplanering och skattefusk. Del.ll. 1994. Fritzes.

sammanhänga med att ökad kontrolluppgiftsskyldighet införts under perioden.

Hur stort skatteundandragandet är på de oredovisade svarta in- komsterna går egentligen inte att beräkna. En kalkyl av skatte- undandragandet blir därför av flera skäl hypotetisk till sin karaktär. Det beror bl.a. på att den svarta verksamheten skulle ha skett i en annan omfattning och med andra priser om den varit beskattad. Om man bortser från dessa komplikationer kan de uteblivna skatteintäkterna år 1991 beräknas till ca 45 miljarder kr.

Det bör i sammanhanget påpekas att de kalkyler som gjorts, baserat på hushållssektom i nationalräkenskapema, inte fångar upp alla former av skatteundandragande. De fångar upp oredovisade inkomster i anslutning till den produktiva verksamheten samt oredovisade räntor och utdelningar. Däremot fångas inte upp det fusk som finns vid redovisning av skattepliktiga reavinster. Inte heller fångas sådant skatteundandragande hos hushållen — där inkomsterna är korrekt redovisade — men avdragen är felaktiga, t.ex. i form av överdrivna reseavdrag eller ränteavdrag. Arbets- byten som sker yrkesmässigt men där betalning i pengar inte förekommer torde också till stora delar ligga utanför skattningen av den svarta sektorn.

En metod baserad på nationalräkenskapema tyder på att den undandragna momsen motsvarar 12 a 13 procent av momsupp- börden. Denna s.k. momsdiskrepans har varierat kraftigt de senaste åren (bilaga 2). Variationerna är sannolikt inte ett uttryck för att momsfusket skulle växla på detta sätt mellan enskilda år. För- klaringama torde i stället vara att söka i periodiseringar m.m. i nationalräkenskapema, ändrade uppbördsrutiner och betalningsbe- teende eller att statistikunderlaget har andra brister. Sett i genom- snitt perioden 1989-1992 ärmomsdiskrepansen av samma storleks- ordning som tidigare under 1980-talet.

Sammanfattningsvis är det svårt att uttala sig om på vilken nivå det totala skattefusket ligger. Däremot finns inget som tyder på att skattefusket skulle ha ökat under perioden 1980-1992. Går det då att säga något om hur skattereformen isolerat sett kan ha påverkat fusket?

Med avseende på möjligheterna att skattefuska bedöms skattere- formen rent tekniskt inte ha inneburit några väsentliga förändring- ar. Vissa förbättringar som bedöms ha haft en sänkande effekt på skattefusket har gjorts, t.ex. ökad uppgiftsskyldighet och prelimi- närskatteavdrag på räntor och utdelningar.

Den sänkning av de formella skattesatserna som gjordes i skattereformen har gjort det mindre lönsamt att skattefuska. Minskad skatteplanering kan ha betydelse för hur man uppfattar att andra fullgör sin skattskyldighet och därmed benägenheten att skattefuska. Den samlade bedömningen är att skattereformen har haft en viss sänkande effekt på skattefusket. Det är dock fråga om en be- dömning —— beräkningsunderlaget är inte tillräckligt stabilt för att leda till en säker slutsats.

Statistiken över anmälda och dömda för skattebrott visar en minskning mellan 1988 och 1992. Utvecklingen såsom den ser ut enligt brottsstatistiken torde dock inte återspegla utvecklingen av den faktiska brottsligheten. Minskningen till 1992 är med all sannolikhet en effekt av att såväl skattereformen som en om- organisation av skatteförvaltningen, som genomförts samtidigt, temporärt krävt att resurser omprioriterats från kontrollverksamhet till information och utbildning. Denna omfördelning har bl.a. resulterat i en minskning av antalet revisioner av företag och ett minskat antal anmälningar av skattebrott. En annan orsak är att skattemyndighetema tagit hänsyn till arbetsbelastningen hos polis och åklagare och underlåtit att anmäla mindre allvarliga fall. Under åren 1993 och 1994 har antalet anmälningar om skattebrott successivt ökat till tidigare nivåer.

3.2.2. Sparande och konsumtion

Genom skattereformen infördes en separat och enhetlig kapitalskatt på 30 procent. Samtidigt försvann eller reducerades olika av- dragsmöjligheter, baserna för kapitalbeskattningen breddades och värdet av ränteavdragen reducerades till 30 procent. Förutom önskemålet att stimulera till sparande och minskad skuldsättning syftade den nya kapitalbeskattningen till att ge ett väsentligt bidrag till reformens finansiering och minska möjligheterna till manipula- tioner i skatteplaneringssyfte. Förändringarna i kapitalbeskattningen skulle också medverka till att göra reformen fördelningspolitiskt neutral samt minska de samhällsekonomiska snedvridningarna. Fiskala aspekter var ett viktigt motiv också för den översyn av den indirekta beskattningen som utgjorde en del av skattereformen. Före skattereformen berördes högst 60 procent av den privata konsumtionen av mervärdesskatt. I och med skattereformen breddades skattebasen för momsen, samtidigt som man skärpte olika punktskatter. Även miljöpolitiska överväganden fanns med i bilden.

Agell-Englund-Södersten ger i sin rapport en bred belysning av beteendeförändringar som sammanhänger med hur hushållen anpassat sig till den nya kapitalinkomstbeskattningen och omlägg- ningen av de indirekta skatterna.

En första huvudfråga de tre professorerna tar upp är i vilken ut- sträckning skattereformen påverkat hushållens sam lade sparande, dvs. valet mellan konsumtion i dag och i morgon. Eftersom skattereformen bidrog till att öka de reala lånekostnadema efter skatt gavs hushållen incitament att öka sparandet genom att minska sina skulder. De senaste årens exceptionella ökning av den konventionellahushållssparkvoten (m ätt enligtnationalräkenskaper- na, NR) indikerar att skattereformen kan ha lett till mycket betydande förändringar. Den gängse sparkvotsdefinitionen är emellertid av begränsat värde för att belysa utvecklingen av det totala hushållssparandet, eftersom den bara inkluderar en del av hushållens sparforrner (direktägt sparande i finansiella tillgångar och investeringar i egna hem). Däremot beaktas inte investeringar i varaktiga konsumtionsvaror, eller det sparande som sker inom ramen för olika kollektiva tilläggspensionssystem, vilka admini- streras av arbetsmarknadens parter på försäkringsmässiga grunder (det s.k. AMF-sparandet). I båda fallen handlar det om avsättningar som fyller samma funktion som vanligt banksparande —— genom att avstå från konsumtion idag kan hushållet öka sin konsumtion imorgon. Med en utvidgad spardefinition, som också inkluderar hushållens investeringar i varaktiga konsumtionsvaror och sparan- det i avtalsenliga pensionsförsäkringar, fram står sparandet som mer stabilt över tiden, och de senaste årens utveckling som mindre dramatisk. Dock skedde en påtaglig uppgång mellan 1989 och 1992 även med den utvidgade sparkvotsdefinitionen. De senaste årens uppgång i det totala hushållssparandet innebär att Sparkvoten nu ligger på ungefär samma nivå som under slutet av 1970-talet (se diagram 2).

2. Diagram: Hushållens sparkvot (sparande i % av disponibel inkomst) enligt NR och enligt en utvidgad sparkvotsdefmition, 1970-1993.

20%

15% i

Utvidgad sparkvotsdefinition

sparkvot,%

-5% » NR-sparkvot

40% ——

En utgångspunkt, som undviker många av de problem som är för- knippade med att mäta sparandet, är att direkt studera hushållens konsumtion. Ett sådant angreppssätt ger enligt ekonomiprofessorer- na inga tydliga belägg för att skattereformen skulle vara en viktig faktor bakom det kraftiga fallet i hushållens samlade konsumtion under början av 1990-talet. I den mån som reformen spelat roll för den minskade konsumtionen handlar det inte om direkta effekter till följd av ändrad avkastning på sparandet. Däremot finns en indirekt konsumtionsanpassning till följd av att reformen är en delorsak till de sjunkande värdena på fastigheter under inledningen av 1990-talet. De förmögenhetsförluster som hushållen gjort på sina fastigheter har forcerat fram ett finansiellt sparande (amorte- ringssparande) för att återställa balansen mellan tillgångar och skulder. Den i tiden sammanfallande konjunktumedgången (arbetslöshet, osäkerhet om framtida inkomster) spelade dock långt större roll för minskningen av hushållens konsumtion än skattere- formen. Det hör till saken att det förhållande mellan konsumtion och disponibel inkomst som fanns under senare delen av 1980-talet var långsiktigt ohållbar. Hushållen konsumerade betydligt mer än de löpande disponibla inkomsterna. Man lånade således för konsumtionsändamål. Värdestegringama på fastigheter och en allmän optimism i rådande högkonjunktur var troligtvis motorn för detta beteende. Utvecklingen under början av 1990-talet återställer de mer normala förhållandena mellan disponibel inkomst och konsumtion.

3. Diagram: Hushållssektoms disponibla inkomst och konsru'ntion. Fasta priser (1991 års nivå).

Källa: SCB Nationalräkenskapema (NR)

Mdkr 850

800 Privat konsruntion

750

700

Disponibel inkomst 6 50

600. . . . | | | . | 1 t t i 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993

En annan huvudfråga professorerna tar upp är hur hushållens spann önster anpassats till de nya reglerna. Skattereformen har som framgått ovan inte haft någon avgörande betydelse för den förändring i hushållens konsumtion och i den samlade sparnivån som inträffat under början av 1990-talet. Däremot har reformen helt klart lett till att sparandet ändrat inriktning. Före skatte- reformen belastades avkastningen på det finansiella sparandet i hushållssektom med en högre effektiv skattesats än vad som gällde för investeringar i reala tillgångar. Skattereformen bidrog också till att öka lånekostnadema efter skatt vilket bör ha givit hushållen incitament att öka det finansiella sparandet genom att minska sina låneskulder. Genom skattereformen ändrades skattebehandlingen av olika sparformer och blev mera likformig. Utvärderingen visar här på tydligare samband. De senaste årens kraftiga ökning av hushållens finansiella sparande (amorteringssparandet i synnerhet) och den samtidiga minskningen av sparandet i reala tillgångar som egna hem och varaktiga konsumtionsvaror beror till del på reformen (diagram 4). Det är dock svårt att ange hur mycket som är att tillskriva reformen. En stor del av förändringen skulle ha ägt rum också utan reformen. Ett väsentligt högre ränteläge och en snabb minskning av inflationstakten efter 1991 har nämligen också bidragit till att öka den relativa avkastningen på finansiellt sparande. Baserat på ett räkneexempel som renodlar effekterna av skattereformen gör ekonomerna bedömningen att mellan tre och fyra procentenheter av ökningen av hushållens finansiella sparkvot, och mellan två och tre procentenheter av minskningen av den reala Sparkvoten kan hänföras till skattereformen. Eftersom den finans- iella Sparkvoten ökade med inemot 13 procentenheter mellan 1989 och 1992 implicerar detta att mellan en fjärdedel och en tredjedel

av uppgången av den finansiella Sparkvoten skulle kunna bero på skattereformen.

4. Diagram: Hushållens finansiella och reala sparkvot (sparande i %av disponibel inkomst),

1970—1993. 20% » 15% * Real sparkvot 10% * >". 'ö' > % u,. e. m : O%i"å*.14 _l..l_ :4__1_ tft Nu.-':"? 1 "111 1 | 1,' 1970 1975 : 151980 19851 1990

_5%— /

Finansiell sparkvot

40% -—

På lång sikt skapar reformen förutsättningar för en samhälls- ekonomiskt effektivare allokering av hushållens sparande, eftersom det tidigare gynnandet av hushållens reala sparande i egna hem och varaktiga konsumtionsvaror har mildrats på väsentliga punkter. På kort sikt blir bilden en annan. De senaste årens konjunktumed- gång har förstärkts av ett efterfrågebortfall som delvis sammanhän- ger med hushållssparandets ändrade inriktning. Skattereformen har därför sannolikt bidragit till att fördjupa konjunktumedgången. I ett normalt konjunkturläge skulle förändringen inte behövt få några nämnvärda negativa effekter. I en djup konjunktumedgång, med lågt kapacitetsutnyttjande, blir bilden en annan. Agell-Englund-Södersten redovisar även resultat vad gäller portföljanpassm'ngama på hushållsnivå som indikerar att hushåll med olika marginalskatt redan åren före reformen anpassat sina tillgångar och skulder på ungefär samma sätt. Skillnader i margi- nalskatt tycks inte som under slutet av 1970-talet och första hälften av 1980-talet kunna förklara varför olika hushåll väljer att skuldsätta sig eller fördela sina tillgångar på olika sätt. Långt större roll spelas av andra faktorer, som ålder, inkomst och familjesam- mansättning. En rimlig förklaring är att de avdragsbegränsningar som infördes under första halvan av 1980-talet starkt bidrog till att minska skillnaden i den reala lånekostnaden efter skatt mellan

olika hushåll. Förändringarna i hushållens portföljsammansättning mellan 1989 och 1992 har också studerats. Analysen bygger på paneldata vilket innebär att det är samma hushåll som följs. Analysen indikerar att anpassningarna mellan de två åren inte skiljer sig åt mellan hushåll med olika marginalskatt 1989. När man i analysen kontrollerar för effekterna av andra förklarande variabler tycks hushållen med de högsta marginalskatterna ha anpassat sina tillgångar och skulder på ungefär samma sätt som de med de lägsta marginalskattema. Det finns således idag inga klara belägg för att skattereformen 1991 inneburit att hushåll med olika marginalskatt anpassat sina tillgångar och skulder på olika sätt. Detta innebär inte att reformen inte hade någon effekt på hus- hållens portföljval utan innebörden är att effekterna varit likartade för hushåll med olika marginalskatt.

En tredje huvudfråga gäller hur omläggningen av den indirekta beskattningen påverkat hushållens konsum tionsm önster. Ändringen av indirekta skatter fick utöver på boendet även priseffekter på t.ex. bensin, transporter, telefon, frisörbesök, hotell- och restau- rangbesök. Ett par undersökningar refereras som tyder på att reformen kan ha haft betydande effekt på efterfrågan på vissa specifika varugrupper, som t.ex. turism. Turismen kom genom de basbreddningar som gjordes i samband med reformen att beläggas med full moms och stor oro för effekterna uttrycktes från bransch- håll. Kostnads- och efterfrågeläget för turismtjänster i Sverige har efter reformen påverkats positivt av kronans depreciering och att momsskattesatsen för turismtjänster sänktes under 1993.

En marknad som fick i grunden ändrade förutsättningar i och med skattereformen var bostadsmarknaden. Omläggningen av den indirekta beskattningen innebar ökade drifts- och underhållskost- nader för hela bostadsbeståndet. Den mer enhetliga kapitalbe- skattningen, som minskade värdet av hushållens ränteavdrag, drev upp kapitalkostnadema för egnahemsägare och bostadsrätts- innehavare. För att upprätthålla kostnadsparitet mellan olika upplåtelseformer reducerades samtidigt räntesubventionema till hyresfastigheter. Sammantaget har detta inneburit väsentligt högre boendekostnader för alla upplåtelseformer. Analysen indikerar att skattereform en har minskat efterfrågan på bostadstjänster för nästan alla hushållstyper. På kort sikt, med ett givet fastighetsbestånd och en given fördelning av bostadslägenheter på olika upplåtelseformer, leder detta till prisanpassningar. Agell-Englund-Söderstens kalkyler indikerar att reformen minskat efterfrågan på egna hem med kanske 10-20 procent, och att detta efterfrågebortfall, med reserva— tion för en betydande regional variation, lett till ett fall i villapri- serna på ca 15 procent. Eftersom villapriserna föll med realt 28 procent mellan 1990 och 1993 skulle ungefär halva det observera-

de prisfallet bero på skattereform en, medan den andra halvan beror på andra politiska beslut samt de allmänna följderna av lågkon- junkturen och obalansema i samhällsekonomin. På lång sikt, när också bostadsmarknadens utbudssida anpassas, tenderar den totala bostadssektorn att krympa. Minskningen kommer dock inte att fördela sig jämt över olika fastighetstyper och upplåtelseformer; allt annat lika bör andelen smålägenheter öka. Det är också möjligt att andelen hyreslägenheter kommer att öka.

En fråga professorerna ställer är varför anpassningama av priserna på andrahandsmarknaden för småhus dröjde. Enligt etablerad ekonomisk teori skulle prisseffektema ha uppkommit redan mot slutet av 1989, då reformens huvuddrag, och implikatio- nema i synnerhet för boendekostnadema blev kända och upp- märksammade i massmedia. Så blev dock inte fallet. l nominella termer fortsatte villapriserna att öka både 1990 (plus 12 procent) och 1991 (plus 7 procent), och det är först 1992, året efter skattereformen, som priserna faller påtagligt i både nominella och reala termer. I princip kan man tänka sig två möjliga förklaringar. Den första bygger på den enkla tanken att marknaden trots allt snabbt beaktade informationen om skattereformen. l avsaknad av skattereformen hade villapriserna ökat ännu mycket mer 1990 och 1991. Den andra tänkbara förklaringen är att hushållen inte genomskådade skattereformens innebörd förrän i efterhand.

Sammanfattningsvis visar den utvärdering som gjorts av Agell- Englund-Södersten att skattereformen kan beräknas ha haft ganska liten betydelse för minskningen av hushållens konsumtion och den ökning av det totala sparandet som inträffat under början av 1990- talet. Det är främst andra faktorer som spelat in. Däremot har reformen helt klart bidragit till att ge sparandet en annan inriktning — det finansiella sparandet har ökat medan det reala sparandet, bl.a. i egna hem, minskat. Reformen uppskattas svara för ungefär hälften av det prisfall som inträffat på egna hem mellan 1990 och 1993.

3.2.3 Företagen

Det gamla bolagsskattesystemet med dess inriktning på konsolide- ring och investeringsstimulans uppfattades länge som tillväxtbe- främjande. I den ekonomisk-politiska diskussionen i det sena 1980- talet, med dess ökade betoning av marknadernas roll för ett effektivt resursutnyttj ande, kom systemetemellertid att alltmer ses som ett hinder för en nödvändig strukturomvandling inom näringslivet. Kritiken gällde framför allt kombinationen av hög

skattesats och smal skattebas, som förutsatte och stimulerade till en omfattande vinstnedplöjning i företagen. Ett nyckelord i debatten var skattebetingade inlåsningseffekter, med åtföljande risker för en ineffektiv fördelning av investeringsresursema mellan både företag och branscher. Till denna kritik kom en växande skepticism vad gäller både det önskvärda och möjliga i en konjunkturstyming av näringslivets investeringar.

Med skattereformen 1991 övergavs dessa gamla principer för företagsbeskattningen. Den grundläggande principen för reformen, dvs. lägre skattesatser och bredare skattebaser, tillämpades med stor konsekvens också vid utformningen av den nya företagsbe- skattningen. Skattesatsen halverades, och investeringsfondema och möjligheten att skriva ner lager togs bort. Reformen innebar att statsmakterna gav upp gamla ambitioner att aktivt styra investe- ringsverksamheten och att man tonade ner strävan att stimulera företagen till konsolidering. Regelförändringarna avvägdes också med målsättningen att uppnå långsiktigt oförändrade skatteintäkter.

Förhoppningarna på det nya systemet för beskattning av bolagsvinstema var stora. lnvesteringsincitamenten skulle förbätt- ras. Det fanns förväntningar om en ur tillväxtsynpunkt bättre hushållning med investeringsresursema genom reducerade in- låsningseffekter, och en övertygelse att reformen skulle ge ett enklare och robustare alternativ till det gamla systemet, som under efterkrigstiden blivit alltmer komplicerat. Ekonomiprofessorema ställer i sin utvärdering frågan om dessa förhoppningar uppfyllts, alternativt om de var väl grundade.

En utvärdering av den nya bolagsbeskattningen är, konstaterar de, svår av flera skäl. Genom att så kort tid förflutit sedan reformen är företagens anpassning till de nya reglerna sannolikt inte avslutad. Möjligheterna att avläsa och analysera företagens reaktioner på de nya reglerna är vidare kraftigt beskurna genom eftersläpningen i tillgänglig statistik. Därtill kommer att de första åren efter reformen var ur konjunktursynpunkt extrema. En speciell komplikation är slutligen att kunskaperna om hur det gamla bolagsskattesystemet verkade ännu är mycket ofullständiga. För att utvärdera det nya systemet måste man förstå hur det gamla fungerade. Utvärderingen av skattereformen handlar därför också om att ge en bättre förståelse av det gamla systemet.

Nya data som redovisas i rapporten från Agell-Englund- Södersten tyder på att de långtgående konsolideringsreglerna i det gamla skattesystemet bara i begränsad utsträckning kunde utnyttjas av företagen. Bara en femtedel av företagen har utnyttjat reglerna maximalt och därmed obetingat minimerat sina skattebetalningar. Forskarnas tolkning av detta är att redovisningen av beskattnings-

bar vinst i många fall har styrts av företagens önskemål om utdelning, snarare än av begränsade möjligheter till skattemässiga avdrag. Men också andra förklaringsgrunder finns såsom behovet att visa vinst inför banker och andra långivare eller att hålla en jämn vinstnivå. Den gamla bolagsbeskattningen tycks i all sin komplexitet till en del ha fungerat som en utdelningsbeskattning utan de negativa effekter på investeringsincitamenten som man tidigare föreställt sig. Bolagsskatten förefaller inte ha stimulerat företagen till lånefinansiering i den utsträckning många bedömare tidigare förutsatt. Övergången till den nya bolagsbeskattningen innebär därför en mera odramatisk förändring med avseende på de realekonomiska verkningarna än vad som föreställdes.

Även om de utgör en mindre del av företagen fanns det trots allt företag som i det gamla skattesystemet utnyttjade konsolide- ringsmöjlighetema fullt ut. Man kan, menar KUSK, spekulera i om dessa företag på något sätt till sin karaktär avvek systematiskt från övriga. KUSK har erfarit från näringslivshåll att man tror att det gamla skattesystemet kan ha missgynnat företag med humanka- pital relativt kapitalintensiva företag och att det gamla systemet kan ha verkat till de mindre företagens nackdel. Det nya systemet verkar i så fall jämnare mellan företag av olika karaktär och storlek.

Aktuell forskning tyder på att skattereformen inte haft någon betydelse för det drastiska raset i företagens investeringar under krisåren. Den långsiktiga effekten av reformen på kapitalbildningen torde också vara liten. Effekterna går emellertid åt olika håll beroende på vilka typer av realkapital företagen investerar i, och verkningarna blir också med all sannolikhet olika för olika grupper av företag. För de företag som kunnat finansiera alla, eller nästan alla, sina investeringar via investeringsfondssystemet under de år fonderna var permanent frisläppta, blir investeringarna avgjort dyrare. Till bilden hör emellertid också att skillnaderna mellan företagen och mellan olika investeringsprojekt vad gäller olika skatteeffekter kommer att minska, vilket bör kunna betyda att pro- jekten får en mer förutsättningslös och enhetlig prövning. KUSK:s bedömning är att kvalitén på gjorda investeringar ökar.

Kommittén vill för sin del särskilt peka på det positiva i att skattesystemet blivit enklare och mera överskådligt. Företagen behöver inte längre ägna tid och kraft åt konstlade övervägande för att få ned skatten utan man kan ägna sig åt mer produktiv verksamhet. Lagerinvesteringar och leasing ingick tidigare i företagens arsenal av skatteplaneringsinstrument. Efter reformen är Skatteöverväganden av detta slag av liten betydelse, vilket ger ökad

handlingsfrihet och bättre kvalitet i företagens investeringsbeslut. Klimatet har på så sätt blivit sundare i företagen. Men även om det nya systemet medför mindre skatteplanering är det likväl fort- farande tekniskt komplicerat.

Den kraftiga ökning av bolagsskatteintäktema som skett de allra senaste åren torde inte bara bero på exportföretagens ökade lönsamhet. KUSK vill här peka på ett par faktorer som samman- hänger med skattereformen som kan ha betydelse. Eftersom företagen inte längre har samma anledning att skjuta upp skatten med hjälp av skatteplanering bör den samlade effekten också bli ökade skatteintäkter. Den lägre formella skattesatsen bör ha gjort det attraktivare för internationellt verksamma företag att redovisa vinster till beskattning i Sverige jämfört med läget före skatterefor- men och den då internationellt sett mycket höga svenska beskatt- ningen (ca 57 procent inklusive vinstdelningsskatt) på marginella intäkter. Å andra sidan hade marginalskatten på vinster i fullt konsoliderade företag varit ca 57 procent med det gamla skattesys- temet att jämföra med 21 procent med dagens systern. KUSK gör bedömningen att den sammanvägda effekten på skatteintäkterna av ovan nämnda faktorer är positiv.

Småföretagandets ekonomiska villkor har rönt ett betydande intresse i den ekonomisk-politiska debatten under senare år. Diskussionen har gällt beskattningen av enskild näringsverksamhet. Frågan aktualiserades också i samband med utredningen inför skattereformen. Man hann dock inte av tidsskäl behandla frågan fullständigt. Omedelbart efter 1991 års skattereform påbörjades dock en översyn av skattereglerna, med syftet att erbjuda enskilda näringsidkare skattevillkor som var likvärdiga med de som gäller för personer som bedriver sin verksamhet i aktiebolagsform. De nya reglerna för beskattning av egenföretagama gäller från 1994. Reglerna ger sänkt skatt för enskilda näringsidkare. Kalkyler visar att förräntningskraven på investeringar i enskild firma, med de skatteregler som gäller 1995, har blivit mer likartade eller t.o.m. något lägre än för fåmansbolag. Det hör emellertid också till saken att skattefördelama för de enskilda näringsidkama och den approximativa neutraliteten i beskattningen av bolagen vunnits till priset av en avsevärt ökad komplexitet. Kostnaderna för hantering av skatteredovisning och skattebetalning, som redan före dessa förändringar föll relativt sett tyngst på de små företagen, har därmed fått en ännu snedare profil.

3.2.4 Arbetsutbudet

Föreställningar om att skattereformen skulle påverka arbetsutbudet positivt var centrala i det utredningsarbete som föregick reformen. Det fanns hos många förhoppningar om kraftiga ökningar av arbetsutbudet som en följd av skattereformen. I utredningen som föregick reformen (RINK) gjordes en försiktig bedömning av effekterna. Den utvärdering som nu gjorts av de tre professorerna visar på en förväntad effekt på arbetsutbudet på ett par procent vilket stämmer ganska väl överens med den bedömning som gjordes av utredningen. Den svaga efterfrågan i ekonomin åren efter skattereformen gör dock att man inte kan räkna med större effekter på faktiskt arbetad tid i det korta perspektivet. Inget motsäger emellertid att reformen långsiktigt faktiskt kommer att få den av RINK förväntade effekten.

Sedd i ett längre perspektiv framstår 1990-1991 års skattereform som en ovanligt stor omvälvning i de svenska hushållens ekono— miska miljö. Mellan 1989 och 1991 minskade marginalskatten med 14 procentenheter för en genomsnittlig industriarbetare och med 22 procentenheter vid en typisk tjänstemannalön. Därmed hade skattekilama i ett slag kommit tillbaka till de nivåer som gällde i slutet av 1960-talet. Med en så stor reform var det inte orimligt att vänta sig vissa synliga positiva effekter på arbetsutbudet även på kort sikt. I stället kom den ekonomiska krisen och antalet arbetade timmar i den svenska ekonomin började minska från det nya systemets första år för att falla med sammanlagt 9 procent mellan 1990 och 1993. En fråga som ställs i rapporten av Agell-Englund- Södersten är om man ändå mitt i den stora krisen kan se några tecken på att skattereformen påverkat arbetsutbudet, även om sådana effekter inte kan realiseras fullt ut i form av fler arbetade timmar förrän den dag när efterfrågan kommit tillbaka.

Nedgången i faktisk arbetstid efter 1991 kan ses som resultatet av motverkande influenser från nedgången i produktionen och de minskade skattekilama. Professorerna visar att nedgången faktiskt har varit mindre än vad som var att vänta utifrån de historiska mönstren. Kan detta vara tecken på att utvecklingen efter 1991 bär spår i riktning mot positiva effekter på arbetsutbudet från skattere- formen? Deras svar är att det är alldeles för nära inpå reformen för att det ska gå att säga något med säkerhet, allrahelst som det inte finns skäl att vänta sig annat än små kortsiktiga effekter. Ut- vecklingen efter 1991 har varit så störd av mer dramatiska händelser i ekonomin att man inte egentligen förmår särskilja skattereformens effekter från övriga faktorer. Några statistiskt

Säkerställda slutsatser om effekterna på arbetsutbudet baserade på data över utvecklingen efter 1991 som adderar till kunskapsläget före reformen har inte kunnat dras. Av detta får man inte förledas att dra den motsatta slutsatsen att skattereformen saknat effekt på utbudet av arbetade timmar i den svenska ekonomin. Komplette- rande ekonometriska analyser och studier som gjorts inom ramen för utvärderingen underbygger den bild som fanns i samband med att reformen beslutades nämligen att reformen har positiva effekter på arbetsutbudet.

Agell-Englund-Södersten gör bedömningen att de förväntade positiva effekterna på arbetsutbudet sammantaget ligger i storleks- ordningen ett par procent. Bedömningen grundar sig på nya svenska studier som genomförts i anslutning till professorernas utvärdering. Det är inte den faktiska utvecklingen efter skatterefor- men som studerats. Studierna använder empiriskt material från tidigare år som bearbetas för att visa sambanden mellan marginella lönen efter skatt och arbetsutbudet. Utifrån dessa samband kan man dra slutsatser om vilka effekter som är att förvänta till följd av de förändringar som gjordes i samband med skattereformen. Studierna visar ganska samstämmigt att antal arbetade timmar påverkas positivt av marginallönen efter skatt men att känsligheten är liten. Simuleringar tyder på att reformen på sikt kan förväntas öka antalet arbetade timmar med i storleksordningen 2-5 procent för samboende män, medan effekten för samboende kvinnor sannolikt ligger mycket nära noll. Dessa genomsnittseffekter döljer stora skillnader mellan olika hushåll. För makar gäller att valet av arbetstider (på marknaden och i hemmet) är ömsesidigt beroende. Samboende kvinnors arbetsutbud är känsligt för och påverkas av om mannen genom sänkt marginalskatt får höjd marginallön efter skatt. Detta är en orsak till att effekterna på samboende kvinnors arbetsutbud är lågt. Effekterna på arbetsutbudet för ogifta kvinnor är större men skattningama är osäkra.

Man talar ofta om arbetsutbud enbart som en fråga om antalet arbetade timmar och tänker sig att skattereformen framför allt skulle öka villigheten att arbeta övertid eller att öka antalet ordinarie arbetstimmar vid deltidstjänst. Effekten på antalet arbetade timmar är emellertid inte den enda dimensionen av arbetsutbudet. Det finns också en kvalitétsaspekt. Skattereformen har medfört att utbildning och karriärval lönar sig bättre. Detta kan bidra till att fler avstår från låg lön tidigt i livet för att istället utbilda sig och få en högre lön längre "fram. Men incitamenten till resultatgivande intensivutbildning eller andra karriärsatsningar ökar även för personer som redan är etablerade i yrkeslivet inklusive i

yrken med relativt hög lön. Den ökade stimulansen att utbilda sig kan visa sig vara en viktig effekt av skattereformen. Underlag saknas emellertid för att kvantifiera dessa effekter.

En annan aspekt där reformens incitamentseffekter är tydliga är effekterna på den tid hushållen använder för icke-marknadsarbete. Denna tid kan delas upp i ren fritid och arbete inom hemmet, ett val som i sin tur är betingat av villkoren för att köpa hushållstjän- ster på marknaden. Höga marginalskatter påverkar ett vardagligt beslut som valet mellan att själv utföra olika sysslor i hemmet och att arbeta extra för att kunna anlita hantverkare. Ju högre skatt desto mindre effektiva arbetsmetoder kommer att användas när en allt större andel av underhållsarbetet på hus och hem utförs av amatörer i stället för yrkesmän. Skattereformen kan väntas ha effekter på beslutet att köpa hemtjänster. Några egentliga slutsatser om ökad användning av köpta tjänster för hemarbete kan dock inte dras på basis av det underlag som finns. Undersökningar av hushållens tidsanvändning pekar visserligen på att hushållen mellan 1984 och 1993 ökat sin fritid samtidigt som tiden för hemarbete och underhåll och reparation i hemmet minskat. Men vi vet inte i vad mån det minskade hemarbetet har ersatts av ökad användning av arbetstjänster köpta på marknaden. Sannolikt handlar det i större utsträckning om mekanisering och effektivisering och ev. sänkta ambitioner för vissa hemsysslor.

3.3 Effekter på de samhällsekonomiska målen 3.3.1 Stabilisering och skatteintäkter

Sverige har under de senaste åren genomgått den djupaste ekonomiska krisen sedan 1930-talet. Åren 1991-1993 minskade reala BNP tre år i rad, med ett sammanlagt produktionsbortfall på över fem procent. Den öppna arbetslösheten, som var 1,6 procent 1990, hade fyra år senare ökat till 8,2 procent samtidigt som antalet individer i arbetsmarknadspolitiska åtgärder ökade mycket kraftigt. Stora och snabbt växande underskott i de offentliga finanserna var en spegelbild av obalansema i ekonomins reala delar. Budgetåret 1989/90 visade den statliga budgeten ett litet överskott, som de fyra följande budgetåren följdes av underskott på 35, 81, 188 och 177 miljarder kronor.

1 utvärderingen av skattereformens effekter på de samhällsekono- miska målen belyser Agell-Englund-Södersten två frågor som ägnats stor uppmärksamhet i den populära debatten. Hur stor del av den mycket kraftiga försvagningen av de offentliga finanserna

kan skrivas på skattereformens konto? I vilken utsträckning har reformen bidragit till att förvärra den ekonomiska depressionen? Frågorna kan inte besvaras oberoende av varandra.

De ursprungliga finanieringskalkylerna gjordes våren 1990 och byggde på en framskrivning av skattebasemas utveckling. Eko- nomin var då överhettad, privat konsumtion var hög och kapital- vinstema stora. Ändringarnai den ekonomiska miljön under början av 1990-talet medförde att den faktiska utvecklingen av skatteba- sema inte blev den som reforrnkalkylerna utgick ifrån. En efterhandskalkyl6 baserad på samma metodik som i de ursprungliga reformberäkningama men med de faktiska istället för de fram- skrivna skattebasema visar att reformen är underfinansierad med i genomsnitt ca 25 miljarder kr per år under perioden 1991-1993. Kalkylen ger svar på frågan om hur mycket högre skatteintäkterna hade blivit om det gamla skattesystemet applicerats på de faktiska skattebasema under början av 1990-talet. Beräkningen är statisk i meningen att den inte beaktar effekterna av skattereformen på konjunkturutvecklingen och skattebasema.

De tre professorerna gör i sin rapport beräkningar som även beaktar hur den del av konjunkturfallet som beräknas bero på reformen har påverkat den offentliga sektorns inkomster och utgifter. Resultat redovisas från två olika metoder att analysera storleken på skattereformens underfinansiering. Den ena utgår från den kalkyl om 25 miljarder kr som nämnts ovan vartill har lagts en beräkning av hur den del av konjunkturfallet som de bedömer beror på skattereformen har påverkat finansieringen. Den andra bygger på ekonometriska modeller som utgår från det historiska sambandet mellan skattebaser och skatteintäkter. Båda ger samstämmigt bilden av en reform som på kort sikt, med vilket här avses åren 1991 och 1992, uppskattningsvis var underfinansierad med i genomsnitt 35 miljarder kr per år. Båda metoderna indikerar att underfinansieringen tenderar att minska i takt med konjunktur- förbättringen efter 1993. Vad gäller aktivitetsnivån hade reformen både expansiva och kontraktiva inslag. Underfinansieringen stimulerade köpkraften genom att öka hushållens disponibla inkomster. Mot denna expansiva effekt skall ställas den kontraktiva effekt som följer av lägre fastighetspriser och ökat sparande. Nettoeffekten var med största sannolikhet kontraktiv. Räkneex- empel med en makrornodell indikerar att reformen kortsiktigt torde ha skapat ett produktionsbortfall som motsvarar knappt en procent av BNP. Enligt detta räkneexempel har reformen fördjupat

6Anders Kristoffersson, Finansdepartementet. "Was the Tax Reform fully financed?" (Ekonomiska Rådets serie Tax Reform Evaluation Reports).

lågkonjunkturen, men är ingen primär faktor i det ekonomiska krisförloppet.

Jämfört med en del av de bedömningar som figurerat i massmedia, och som gett vid handen att skattereformen är den primära faktorn bakom ökningen i det statliga budgetunderskottet kan kalkylerna synas blygsamma. Inte desto mindre handlar det ändå i kronor om stora belopp. Detta väcker ett par frågor.

Den första gäller skattereformens underfinansiering på lång sikt. En kalkyl av underfinansieringen i ett längre perspektiv försvåras av den omständigheten att skattesystemet ändrats på en rad punkter efter 1991. Med tiden har det blivit allt svårare att renodla skattereformens betydelse för utvecklingen av den offentliga sektorns inkomster. Det finns dock, enligt professorerna, in- dikationer på att underfinansieringen faktiskt minskat efter 1992, främst på grund av stigande aktiepriser och ökande räntabilitet inom den exporterande delen av industrin. På lång sikt bör också reformen ge upphov till effektivitetsvinster i ekonomin vilket skapar förutsättningar för en finansieringsbonus i form av större skattebaser. Men det går i dagsläget, menar Agell-Englund- Södersten, bara att spekulera om hur stor återhämtningen kan bli. Kommittén tar i avsnitt 4.3 upp frågorna om underfinansieringens storlek på lite längre sikt och hur man utifrån dagens situation skall se på skattereformens underfinansiering.

Den andra frågan rör de finansieringskalkyler som låg till grund för skattereformen. Hur stor del av underfinansieringen beror på omständigheter som borde ha förutsetts redan 1990? Få ekono- miska bedömare förutsåg den depression som skulle komma under första halvan av 1990-talet. I utredningarna kring skattereformen diskuterades inte heller i någon större utsträckning vilka effekter skattereformen kunde tänkas få vid olika konjunkturprofiler. De stabiliseringspolitiska aspekterna på reformen föreföll, mot bakgrund av de ekonomiska bedömningar som förelåg, inte särskilt centrala.

Inte desto mindre är slutsatsen i Agell-Englund-Söderstens ut- värderingsrapport att den ursprungliga finansieringskalkylen byggde på omotiverat optimistiska antaganden om vissa skatteba— sers utveckling. Även om man bara beaktar den information som fanns tillgänglig vid slutet av 1980-talet borde kalkylen sett annorlunda ut. Hushållens konsumtionsutgifter var större än deras disponibla inkomster och tillgångsprisema var mycket höga. Genom att extrapolera skattebaser från en överhettad och i längden ohållbar konjunktur gavs en orealistisk bild av de skatteintäkter som skulle genereras av basbreddningama vad gäller konsumtion och kapitalinkomster. En del av dessa problem hade kunnat

undvikas om man i större utsträckning beaktat en del av de beteendestudier som ingick i utredningsmaterialet.

KUSK utgår från att man i de kalkyler som gjordes verkligen vinnlade sig om att göra rättvisande kalkyler utifrån de förut- sättningar som förelåg vid tillfället. Hade då felkalkylen kunnat förhindras? Vissa delar av felkalkylen torde inte gått att undvika. Andra borde gått att få större träffsäkerhet i. KUSK menar att det viktiga nu är att man tar lärdom inför framtiden. Vid så stora omläggningar som skattereformen bör ingå en bedömning av om de baser man utgår från är "onormala". Men även om man kalibrerar kalkylerna till att avse någon form av genomsnittligt hållbart läge kommer den kortsiktiga faktiska utvecklingen oftast att avvika från en sådan kalkyl. Avvikelserna kan i det korta loppet vara positiva eller negativa. Det krävs därför längre tid för att avgöra om det är "rätt" räknat. Detta gäller i viss utsträckning även de kalkyler som låg till grund för skattereform en. När det gäller att bygga in effekten av beteendeförändringar i de kalkylmodeller som används för att göra finansieringsbedömningar pågår utvecklings- arbete på olika håll. I detta utvecklingsarbete bör den utvärdering av beteendeeffekter som nu gjorts i anslutning till ekonomipro- fessoremas rapport kunna vara ett viktigt stöd.

3.3.2 Inkomstfördelningen

Målet om en jämn inkomstfördelning har varit centralt i svensk skattepolitik och skattepolitisk debatt under större delen av efterkrigstiden. 1991 års skattereform är i så måtto tecken på den strömkantring i opinionsläget som inträffade under 1980-talet att den är ett uttryck för beaktande av effektivitetsmålet. Inkomstför- delningen står dock kvar som en väsentlig restriktion. När skattereformen presenterades framhävdes således att skattereformen på det hela taget inte skulle ändra fördelningen av inkomster mellan rika och fattiga hushåll.

Reformen avsågs vara fördelningsmässigt neutral som ett resultat av en kombination av faktorer som inkluderade förändringar av både skatte- och bidragssystem. Förändringarna var att se som ett samlat paket och det var helheten som gav den åsyftade för- delningspolitiska profilen. Sänkningen av marginalskattema till som högst 50 procent skulle i sig medföra en större procentuell Skattelättnad ju högre upp i inkomstfördelningen man kom. Men samtidigt skulle skatten för den genomsnittlige höginkomsttagaren öka relativt sett mer till följd av underskottsavdragens minskade

värde eftersom underskottsavdragen är större vid högre inkomster. Basbreddningar för olika förmåner och för kapitalinkomster och reavinster skulle också bidra till en mera balanserad fördelnings- profil. Vidare skulle höjda barnbidrag och bostadsbidrag öka de disponibla inkomsterna för de barnfamiljer som till följd av försörjningsbörda och deltidsarbete har en förhållandevis låg ekonomisk standard. De kalkyler som presenterades av RINK tydde på att dessa effekter i genomsnitt skulle ta ut varandra. Genomsnitten dolde dock, inte minst bland hushåll med höga inkomster, en stor spridning beroende på om man i utgångsläget hade låga eller höga underskott.

Under hela 1980-talet har funnits en relativt svag men tydlig trend mot en ojämnare inkomstfördelning såväl av inkomsten före skatt som av den disponibla inkomsten efter skatt och bidrag. Det samlade skatte- och bidragssystemets omfördelande verkan har dock varit i stort sett konstant över tiden.

Ser man till den faktiska utvecklingen mellan 1989 och 1992 kan, med SCB:s inkomstfördelningsundersökningar ("HINK") som grund, konstateras att både aktiva hushåll och pensionärshushåll haft en positiv utveckling av sin disponibla inkomst med det disponibelinkomstbegrepp som normalt används. Pensionärshus- hållen har därvid haft en betydligt bättre utveckling än hushållen i aktiv ålder (tabell 5). Bästa året för pensionärerna under perioden har varit 1992. Den positiva utvecklingen för pensionärerna sammanhänger bl.a. med att gruppens sammansättning ändras över tiden. Yngre tillkommande pensionärer har högre ATP än de som avlider. Ett särskilt riktat bostadsstöd till låginkomstpensionärer och en låg skuldsättning är andra faktorer som bidragit till det positiva utfallet för pensionärerna.

5. Tabell: Utveckling av disponibel inkomst per konsruntionsenhet förhushåll i aktiv ålder samt pensionärshushåll. Fmta priser.

Förändring (%) av disponibel inkomst per k.e.

Disponibel inkomst inkl. reavinst Dispanibel inkomst exkl. reavinst

Hushålli Pensionärs- Hushåll i Pensionärs-

Tidspen'od aktiv ålder hushåll aktiv ålder hushåll W

1990-1991 +0,7 +2,5 +0,5 +2,8 1991-1992 -0,7 +4,4 +l,2 +4,7 Hela perioden +1,4 +6,2 +2,7 +9,4

Anm. Förandringstalen för de aktiva hushållen visar utvecklingen av disponibel inkomst före betalning av privata pensionspremier.

År 1992 hade 33 procent av de heltidsanställda inkomster över skiktgränsen för statlig skatt vilket innebär en marginalskatt på ca 50 procent (kommunalskatt+20 procent i statlig skatt). Av heltidsanställda män var andelen över skiktgränsen 43 procent och för heltidsanställda kvinnor 16 procent. Ser man till samtliga över 20 år (inklusive pensionärerna) hade 17 procent inkomster över denna skiktgräns.

Spridningen i inkomst före skatt ökade mellan 1989 och 1992 (bilaga I: kapitel 7, figur 7.4). Arbetslösheten har haft betydelse för utvecklingen liksom en från 1980-talet fortgående trend till ökad lönespridning. Spridningen i disponibel inkomst (efter skatt och bidrag) kom också att öka under denna period (bilaga I: kapitel 7, figur 7.4).

Reformen bedömdes således i förväg komma att bli neutral totalt sett. Den faktiska utvecklingen har inneburit att de disponibla inkomsterna kommit att fördelas mer ojämnt efter 1991. Frågan är hur dessa bilder hänger samman. Har andra faktorer än skatterefor- men varit avgörande för den ökade spridningen av disponibelin- komsten under början av 1990-talet eller var utredningskalkylerna missvisande eller ofullständiga?

Att renodla skattereformens effekter för den fördelningspolitiska utvecklingen är inte enkelt men det går med olika metoder att få ett grepp om reformens roll i sammanhanget. Resultaten och de slutsatser som kan dras är beroende av ansats, definitioner, av- gränsningar, mätmetoder m.m. Därför behövs det flera olika kompletterande metoder och känslighetsanalyser för att få en säkrare bild av reformens fördelningseffekter. Det är också så att samma metod och samma skatte- och bidragssystem tillämpade på olika är kan ge olika resultat beroende på att skattebasema och inkomstfördelningen ändras mellan åren. Viss osäkerhet om reformens fördelningseffekter kommer alltid att finnas.

I utvärderingen har gjorts två separata studier som i olika grad be- skriver olika aspekter på reformens fördelningseffekter. Den ena, vars resultat återges i rapporten av Agell-Englund-Södersten, har gjorts av Björklund-Palme-Svensson. I denna studie jämförs det gamla skatte- och transfereringssystemets omfördelningseffekt för året före skattereformen (1989) med effekten av det nya systemets för ett år efter reformen (1992). Metoden innebär att förändringar i den ekonomiska miljön som inte är betingade av skattereformen också påverkar resultaten. Metoden har dock fördelen att den fångar upp även dynamiska effekter av bl.a. de beteendeanpass-

ningar som är en följd av reformen (och även beteendeanpass- ningar orsakade av andra förhållanden). Nackdelen är att det inte är möjligt att renodla inverkan av skattereformen. I den andra studien (Eklind-I—lussénius-Johansson)jämförs direkt effekterna av det regelsystem som ingick i skattereformen med effekterna av det gamla systemet. Beräkningen blir därmed statisk men har fördelen att den på ett mera direkt sätt tar sikte på att skilja ut reformens effekter från andra förändringar.

En annan skillnad mellan studierna är den avgränsning som gjorts av disponibelinkomstbegreppet vilket innebär att de i olika grad explicit beaktar fördelningsprofilen av reformens påverkan på boendekostnader och effekterna av indirekta skatter för olika hushåll. I den första studien blir beaktandet av boendekostnadema partiellt7 medan den andra studien direkt lägger in effekterna av reformens inverkan på boendekostnadema (under antagandet om fullständigt genomslag av kostnadsökningama på hyresnivån).

Den metod Björklund-Palme-Svensson redovisar för att belysa frågan om reformens fördelningseffekter innebär mer precist följande. Med hjälp av s.k. Ginikoefficienter jämförs inkomstför- delningen före skatt med fördelningen efter skatt och bidrag för ett år före skattereformen varefter samma jämförelse görs för ett år efter skattereformen. Ginikoefficienten är ett aggregerat samman- fattande mått på ojämnheten i inkomstfördelningen.

Den population som studeras är hushåll där hushållsföre- ståndaren (dvs. den person i hushållet som har högst förvärvsin- komst) är i åldern 25-64 år. Företagar- och lantbrukarhushåll har exkluderats.

Mätt med Ginikoefficienter har skattesystemets samlade ut- jämningseffekt minskat påtagligt; de olika basbreddningama och begränsningen av underskottsavdragens värde uppväger inte effekterna av de lägre marginalskattema. Detta motverkas dock fullt ut av utjämningseffekten från höjda barn- och bostadsbidrag. Den sammantagna utjämningseffekten av skatter och bidrag, när inkomsten räknas per konsumtionsenhet, var således minst lika god direkt efter reformen 1991 och 1992 som året närmast före, 1989.

7I studien beaktas omfördelningen via hushållens inkomstskatt (inklusive kapitalskattema) och transfereringarna till hushållen. Detta innebär att effekterna av förändringar av fastig- hetsskatten för egnahem och förändringar av underskottsavdragen kommer med i disponibel- inkomstbegreppet. Effekter av förändringar av räntebidrag beaktas till den del de avser egna hem. Däremot beaktas inte hur de minskningar av räntebidragen för flerfamiljshus som gjordes i samband med reformen påverkat hyressättningen för flerfamiljshus. Förändringarna av drihskostnadema för egna hem och inverkan på fördelningsprofilen av indirekta skatter i övrigt beaktas inte explicit. Till den del de faktorer som ej beaktats har en olikformig påverkan på hushållens konsumtionsutrymme fångas detta inte upp i omfördelningsmåtten.

Eftersom det finns olika sätt att definiera och mäta inkomster och göra hushåll av olika storlek jämförbara prövar forskarna hur känslig slutsatsen är för alternativa definitioner bl.a. vad avser kapitalinkomster. Ingen av de alternativa definitionerna ger en radikalt annorlunda bild av reformens utjämnande verkan.

Resultatet ovan gäller för hushållen sammantaget sett. Eftersom bidrag riktade till barnfamiljerna spelar en så stor roll för omfördelningen efter reformen har i professoremas utvärdering även belysts hur graden av omfördelning inom olika hushållskate- gorier har påverkats. Här visar det sig att det finns skillnader mellan olika hushållskategorier. Skatte- och bidragssystemets ut- jämningseffekt har blivit mindre inom kategorierna ensamstående och sammanboende utan barn samt för enbarnsfamiljema. Här har bidragen så liten betydelse att de inte uppväger att skatterna har en svagare omfördelningseffekt efter reformen. Inom de hushållskate- gorier som har flera barn har däremot utjämningseffekten ökat. Alla kategorier sammantaget är skatte- och bidragssystemet minst lika utjämnande som före reformen beroende på en ökad omför- delning mellan de olika grupperna till förmån för familjer med stor försörjningsbörda. Bidragen har således fått en mer central roll för att omfördela inkomster. En baksida av detta är att bostadsbidragen medverkar till att skattekilama fortfarande är mycket höga för vissa grupper av hushåll med låga inkomster.

Att den faktiska fördelningen av disponibla inkomster blivit mer ojämn är ett resultat av att inkomsterna före skatt blivit mer ojämnt fördelade. Detta beror väsentligen på två saker: arbetslösheten och den ökade lönespridningen. Eftersom analysen av den omför- delande effekten tog inkomstfördelningen före skatt för given ställer sig ekonomerna frågan i vilken utsträckning skattereformen kan ha inverkat på denna fördelning. Som framgått tidigare bedömer de att något mindre än en procents nedgång i BNP kan skrivas på reformens konto. Skattereformens inverkan på arbetslös- heten är därför inte den primära orsaken till den ökade arbetslös- heten och med tanke på att flertalet av de arbetslösa ännu uppbär arbetslöshetsunderstöd menar forskarna att detta knappast kan kullkasta deras slutsatser. I utvärderingen har det inte varit möjligt att ge ett mer precist svar på hur skattereformen påverkat den faktiska lönebildningen. Den ökade lönespridningen framstår som fortsättningen på en trend som har pågått sedan mitten av 1980- talet både i Sverige och internationellt. Skattereformen kan enligt forskarna knappast ha haft en avgörande betydelse.

Agell-Englund-Södersten pekar i sin utvärdering på att reformen också påverkat inkomstfördelningen via kapitalförlustema på

småhus. Utvärderingen tyder på ett sannolikt realt prisfall till följd av reformen på ca 15 procent, vilket för den genomsnittlige husägaren motsvarade ca 20 procent av de disponibla inkomsterna. Bilden blir ensidig om man inte samtidigt frågar sig om det finns andra poster som inte ingår i fördelningskalkylen som berör andra delar av bostadsmarknaden. I den fördelningsstudie som redovisats ovan är räntebidragsminskningarna för hyreslägenheter en sådan post. Analysema pekar på att de räntebidragsminskningar för hyreslägenheter som var direkt knutna till skattereform en motsvara- de tre procent av de disponibla inkomsterna årligen. Professoremas bedömning är att fördelningskalkylen utslaget över tiden i stort sett balanserar när man väger småhusägamas kapitalförluster mot effekterna på hyran av de räntebidragsminskningar för hyreshus som gjordes i anslutning till reformen.

I samband med RINK-utredningen gjordes kalkyler över skattere- formens effekter på inkom stfördelningen med en annan metod som innebar att man undersökte hur två olika skattesystem verkar på en och samma fördelning av inkomsterna före skatt. En sådan studie gjordes för RINK och för reformpropositionen av Eklind-Johans- son. Kalkylerna baserades på en fram skrivning av skattebasema för det enskilda hushållet till 1991 års ekonomiska förhållanden. Utgångsåret för framskrivningarna var skattebaser och tillgångs— priser för 1987 som var det mest aktuella material som fanns tillgängligt våren 1990 då beräkningarna gjordes (1987 års HINK).

I en speciell rapport som gjorts på uppdrag av KUSK (bilaga 5) har Eklind-Hussénius-Johansson upprepat kalkylerna som gjordes till reformpropositionen men nu baserat på i princip faktiska inkomster och basbreddningar. Syftet är att med nya data så långt möjligt upprepa de tidigare beräkningar av fördelnings- effekter som redovisades i reformpropositionen (prop. 1989/901110). I beräkningarna försöker man renodla effekterna av just skattereformen så att de inte skall sammanblandas med effekterna av andra förändringar, i skatteregler och i den ekono- miska miljön, som inträffat samtidigt eller därefter. Metoden kräver tillgång till mycket detaljerade uppgifter om skatte- och bidrags- systemet. I de förnyade beräkningarna används i två separata kalkyler uppgifter avseende den faktiska inkomstfördelningen både för 1989 och 1992. Tanken med detta är att belysa skattereformens effekter med hjälp av två separata och i tiden åtskilda material. 1989 var ett år som karakteriserades av hög sysselsättningsgrad och höga aktiekurser medan 1992 var ett lågkonjunkturår med väsentligt lägre sysselsättning samtidigt som aktietillgångama värderades mycket lägre. De båda beräkningarna ger på så vis en

uppfattning om beräkningamas känslighet för den ekonomiska miljö som råder olika år.

1989 års faktiska inkomstfördelning har en jämförelse gjorts av effekterna av regelsystemet för år 1989 respektive de regler som ingick i reformen. För varje hushåll beräknas två olika disponibla inkomster. Den ena avser förhållandet med 1989 års regler, medan den andra avspeglar reformens regelsystem. En motsvarande beräkning har även utförts på 1992 års faktiska inkomstfördelning med dels 1989 års regler dels reglerna som ingick i reformen.

I de nya kalkylerna beaktas explicit, liksom irefornrpropositio- nen, även fördelningseffekterna av de förändrade indirekta skatter och subventioner som var ett led i finansieringen av reformen såväl de som påverkar boendekostnadema som i övrigt.

De nya kalkylerna ger en säkrare bild av reformens för- delningseffekter inte bara för att man kunnat använda faktiskt material istället för framskrivningar. Urvalet i HINK är åren 1989 och 1992 förstärkt just för att få säkrare uppgifter att bygga analyserna på. HINK-87 som låg till grund för framskrivningama i den tidigare beräkningen hade ett mindre urval bl.a. av högin- komsttagare och osäkerheten i grundmaterialet var därmed större.

6. Tabell: Förändring av real disponibel inkomst genom skatterefomren i deciler efter ekonomisk standard, 20—64 år. Procent

Decil Enligt Nya beräkningar Sysselsättningsgrad

proposition 1989 års 1992 års 1989 års 1992 års material material material material

1 0,0 0,1 0,6 50 41 2 1,8 2,8 2,3 70 59 3 2,5 3,0 2,9 78 67 4 2,8 2,8 2,4 85 78 5 2,7 3,0 3,5 89 82 6 2,9 3,5 3,4 91 86 7 3,6 4,2 3,5 94 89 8 4,2 4,9 4,2 94 91 9 3,8 4,3 3,9 94 93 10 0,2 2,7 3,4 96 95

Samtliga 2,5 3,4 3,3 84 78

De nya beräkningarna visar att ökningen av disponibel inkomst per konsumtionsenhet är ganska likartad den som redovisades i skattereformspropositionen (tabell 6). Ökningen av disponibel inkomst på grund av det nya regelsystemet stiger sakta från decilgrupp 2 för att vara störst i decilgrupp 8. Därefter minskar den. För decilgrupp 10 har reformutfallet blivit högre än vad som redovisades i propositionen nämligen 2,7 respektive 3,4 procent

jämfört med 0,2 procent. 1 de nya beräkningarna får sålunda den högsta decilgruppen en ökning som ligger nära genomsnittet.

De nya beräkningarna tyder sålunda på att reformutfallet för decil- grupp 108 underskattades med 2 ä 3 procentenheteri samband med reformpropositionen. Analyser av beräkningarna visar att orsaken bl.a. är nya antaganden om basbreddningar och att basbredd- ningama i kapital de år som ingår i den nya studien är mindre än med de framskrivningar som gjordes till propositionen. Hur reformens basbreddningar kommer att te sig mera långsiktigt är svårt att avgöra. Aktiekurserna har stigit efter 1992 vilket är en faktor av betydelse för bedömningen eftersom reavinster på aktier beskattas hårdare med det nya systemet.

Högre tjänstemän är den grupp som enligt de nya kalkylerna får det högsta reformutfallet (bilaga 5 tabell 4). För övriga arbetar- och tjänstemannahushåll är ökningarna ungefär lika stora och avvikelserna från propositionsberäkningarna små.

Skattereformen innebar en förhållandevis stor förbättring för hushåll med barn Vilket bekräftas av de förnyade beräkningarna (bilaga 5 tabell 5).

En jämförelse mellan beräkningarna av reformutfallet baserat på de olika åren 1989 och 1992 visar på ganska små avvikelser. För hushållen i decil 10 blir reformutfallet lägre med de ekonomiska förhållanden som rådde 1989 än de som rådde 1992. Aktiekurserna var betydligt högre 1989 än 1992 vilket är av betydelse för effekterna av den skärpning av reavinstbeskattningen som genom- fördes i samband med reformen. Detta torde ha betydelse för de skillnader i reforrnutfall för hushållen i decil 10 som kan noteras mellan materialen för de båda åren.

Av betydelse för bedömningen av reformens fördelningseffekter i ett längre perspektiv är hur det förhåller sig med reformens finansiering. Reformen är kortsiktigt underfinansierad. Under- finansieringen minskar av allt att döma på längre sikt. Om det är

&Av bilaga 5 tabell 2 framgår för olika hushållstyper den genomsnittliga disponibelinkomsten för olika decilgrupper. För ensamstående utan barn i decilgrupp 10 motsvarar den disponibla inkomsten 217.300 kr/år, för sammanboende utan barn i decil 10 är motsvarande värde 334.400 kr för makarna gemensamt och för sammanboende med två barn i decil 10 är värdet 536.600 kr sammantaget för hushållet. Decilgrupp 10 domineras socioekonomiskt av tjänstemannahushåll på hög och mellannivå (bilaga 5 figur 3). Ca 20 procent av hushållen i decilen är arbetare och lägre tjänstemän och ca 15 procent "övriga" (främst företagarhus- håll). Medelåldern är hög; inemot 70 procent är över 45 år (figur 5) och andelen barnfamiljer (figur 4) är liten.

fråga om en bestående underfinansiering går inte att svara på idag. Om en varaktig underfinansiering skulle motivera åtgärder, för att uppnå full finansiering, kan sättet att göra detta ha betydelse för bilden av reformens fördelningseffekter.

Den största svagheten i analyserna av fördelningseffektema är det i grunden statiska perspektivet. Reformen har incitamentseffekter på dynamiska beslut som utbildning och sparande. Uppenbarligen kan de anpassningar som detta kommer att ge upphov till också få effekter på inkomstfördelningen. En diskussion om i vilken riktning de går måste dock bli ganska spekulativ.

Skattereformens effekter för pensionärerna diskuterades mycket i samband med reformens genomförande. Mot bakgrund härav har KUSK låtit särskilt sammanställa statistik om pensionäremas inkomstutveckling under åren 1989-1992 (bilaga 4; kapitel 6). Den faktiska utvecklingen visar att pensionärshushållen i genomsnitt haft en betydligt bättre utveckling av de disponibla inkomsterna än hushåll i aktiv ålder. Utan att kunna isolera skattereformens roll menar KUSK ändå att den faktiska utvecklingen tyder på att skattereformen i kombination med pensionäremas inkomstutveck- ling i övrigt inte kan sägas ha missgynnat pensionärerna.

En aspekt på skattereformens fördelningsprofil som inte får glömmas bort är den s.k. horisontella rättvisan varmed avses att personer med lika stora faktiska inkomster betalar samma skatt. Utvärderingen visar att spridningen i faktisk skatt vid samma arbetsinkomst minskat kraftigt för höginkomsttagama i samband med skattereformen (bilaga 2; tabell 23).

En annan aspekt på inkomstfördelningen är att transparensen i de faktiskt disponerade inkomsterna ökat genom ändringarna i förrnånsbeskattningen och breddningama av skattebasema i inkomstslaget kapital. Inkomsterna är inte längre "osynliga". Detta har, menar KUSK, ett självständigt positivt värde.

3.3.3 Blev reglema enklare?

Kravet på enkelhet är i regel underordnat andra samhällseko- nomiska mål dvs. önskemålen om enkla och lättillämpade regler kommer i andra hand. Ett uttalat mål med skattereformen 1990- 1991 var att parallellt med andra målsättningar även åstadkomma enklare regler.

Rent allmänt bedöms inkomstskatten till följd av färre inkomstslag och färre skatteprocentsatser ha bidragit till att de enskilda bättre kan överblicka skattekonsekvenser av olika ändringar i sin ekonomi. Skattereformen bygger på enhetliga och konsekventa principer och detta bedöms ha ökat skattereglernas logiska uppbyggnad och inbördes sammanhang, vilket i sin tur underlättar förståelsen av regelverket.

Om den enskilde upplever något som lätt eller svårt hänger dock samman med flera faktorer som inte låter sig enkelt isoleras t.ex. reglernas utformning, antalet regler, hur ofta reglerna skall tillämpas, de administrativa rutinerna m.m. När man ska bedöma de sammanlagda effekterna av olika ändringar, t.ex. om skattere- formen totalt sett medfört ökad eller minskad belastning för de skattskyldiga, måste också beaktas hur många som över huvud taget är berörda av vissa bestämmelser. Det är uppenbart att det inte är möjligt att bedöma om en skattereform har lett till enklare regler genom att studera enbart regelverkets utformning. Om en skattereform leder till enklare regler bör om möjligt bedömas utifrån om reformen lett till lägre driftskostnader för skattesystemet för samhället totalt sett.

Skattesystemets driftskostnader finns på två håll, dels hos för- valtande myndigheter dels hos de skattskyldiga och tredje man som på annat sätt medverkar i beskattningen med kontrollupp- giftslämnande m.m. Uttrycket administrationskostnader används för att uttrycka kostnader i den offentliga sektorn. Kostnaderna hos de skattskyldiga och tredje man benämns fullgörandekostnader. Det kan också finnas fördelar för de skattskyldiga i samband med fullgörandet av beskattningen, t.ex. räntevinster via de kredittider som finns i skatteuppbörden. Man kan därför tala om såväl brutto- som nettokostnad. I det följande beskrivs i första hand bruttokost- naden.

Driftskostnaderna för skattesystemet har uppskattats till totalt ca 14 miljarder kronor efter skattereformen, varvid fullgörande- kostnadema är dubbelt så stora som administrationskostnadema (bilaga 2). Inkomstskatten drar 62 procent av totalkostnadema och momsen 29 procent.

7. Tabell: Driftskostnaderna lör skattesystemet, miljarderkr.

Fördela! efter vem som urfon arbetet.

Administrativa kostnader hos myndigheterna 4,6 Fullgörandekostnader hos de skattskyldiga 9,3 varav

-"svenska folket" 2,8

- företagen 6,5 Fordelaipaskatteslag ...................................................................................................... Inkomstskatt 8,7 Arbets givarav giher 1,1 Moms 4,0 Punktskatter 0,1

Om kostnaden ställs i relation till skatteintäkten är momsen dyrast av de stora skatterna (se diagram 8). Detta understryker betydelsen av enkla momsregler och få skatteprocentsatser.

8. Diagram: Dlitlskostnader per hundralapp i skatt

3,50 3,00 2,50 2,00 1,50 1,00 0,50 0,00

kronor

. = . , Inkonstskatt Arbets givar— Moms Punktskatter Alla skatter avgitter

I Admh'strationskosmader [ Fullgörandekostnader

Fullgörandekostnaderna är relativt sett högre för de små företagen samtidigt som räntevinsterna på de kredittider som finns i skatte- uppbörden är lägre än i de stora företagen. Fullgörandekostnaderna netto faller därför tyngst på de små företagen.

Varje förändring i ett skattesystem ger upphov till temporära övergångskostnader både för de adminstrativa myndigheterna och för de skattskyldiga.

I samband med skattereformen omprioriterades skatteförvalt- ningens resurser under ett par år i ganska stor grad från kontroll till information och service. Som en följd härav fick deklarations- granskningen bedrivas med lägre ambitioner och revisionsfrekven- se'n minskade temporärt. Detta innebär att skattereformen över- gångsvis medfört vissa dolda kostnader i form av skatteförluster

som inte kan preciseras. Det är svårt att mäta de långsiktiga och bestående effekterna av skattereformen för skatteförvaltningen. Granskningen av löntagardeklarationema har förenklats medan skattereformen inom andra områden har medfört nya och delvis mer komplicerade regler. Skattereformen har dock haft över- vägande positiva effekter för skatteförvaltningen. Några rationalise- ringsvinster är det dock inte fråga om.

För vanliga deklaranter bedöms skattereformen ha inneburit en relativt stor förenkling. Fler personer har kunnat använda den förenklade deklarationsblanketten; en högre andel har deklarerat helt på egen hand och färre har haft experthjälp; fler har räknat ut skatten själv. Tidsåtgången och utgifterna för att deklarera har för vanliga deklaranter minskat. Denna minskning kan värderas till 800 mkr eller 20 procent av fullgörandekostnadema.

Offentliga myndigheter uppger att Skatteredovisningen blivit svårare efter skattereformen. Detta gäller både redovisningen på uppbörds— och kontrolluppgifter och momsredovisningen. Resulta- tet är inte förvånande med tanke på att redovisningen av trakta- menten och olika förmåner liksom momsredovisningen ändrades och utökades radikalt för offentlig sektor.

Privata företag och arbetsgivare bedömer att de bestående effekterna av skattereformen är en marginellt ökad belastning. Då företagen gjorde denna bedömning (i december 1992) hade momsskattesatsen redan differentierats vilket försvårar moms- redovisningen. Reglerna om skatteutjämningsreserv och uppskovs- belopp, som bedömdes som svåra av företagen, har sedermera tagits bort och ersatts med andra och enklare regler. De regelför- ändringar som gjorts för egenföretagama efter 1992 fanns med i planeringen redan i samband med skattereformsbeslutet. Man hann dock inte med att utforma reglerna i sådan tid att de kunde träda ikraft i samband med reformen i övrigt. Dessa regler har utökat komplexiteten vilket medför att regressiviteten i företagens fullgörandekostnader ökat ytterligare. Enkelheten har för egenföre- tagamas del fått stå tillbaka för ambitionen att få ett likformigt system för olika företagsformer.

3.3.4 Samhällsekonomisk effektivitet

Ett viktigt motiv för skattereformen var den vitt spridda föreställ- ningen att det gamla skattesystemet i onödan hämmade produktiv verksamhet. Höga skattekilar på extra arbetsinsatser och en olikformig kapitalbeskattning bidrog till en misshushållning med ekonomins resurser. Agell-Englund-Södersten ställer i sin ut-

värdering frågan om förhoppningarna om en bättre fungerande ekonomi var befogade.

I vilken utsträckning har reformen skapat förutsättningar för en bättre hushållning med ekonomins resurser? Ett väsentligt problem i sammanhanget är att många av de önskade effekterna är av långsiktig karaktär. Arbetsmarknadslagstiftningen och anställnings- kontraktens utformning gör exempelvis att merparten av hushållen inte över en natt kan anpassa arbetsutbudet till de nya skatteregler- na. Det kan ta flera år innan stärkta incitament för högre utbildning låter sig omsättas i samhällsekonomiska produktivitetsvinster. Därtill kommer, vilket är alldeles avgörande, den djupa lågkon- junkturen under början av 1990-talet. Allt detta innebär att det inte är att vänta sig snabba och dramatiska dynamiska effekter. Professoremas utvärdering har därför på denna punkt i stora stycken karaktären av en granskning av de analyser som låg till grund för reformen. Har det tillkommit information som gör att synen på det gamla skattesystemet bör omprövas? Ett illustrativt exempel gäller storleken på effektivitetsförlustema förknippade med höga skattekilar på en extra arbetsinsats. Tidigare analyser av effektivitetsförlustema förknippade med höga marginalskatter på arbetsinkomster byggde ofta på utländska bedömningar, som gav vid handen att skatterna spelade en viktig roll för hushållens arbetsutbud. Av de tre professoremas rapport framgår att det nu finns ganska många svenska ekonometriska studier som indikerar att skatterna spelar en jämförelsevis liten roll för arbetsutbudet, något som antyder att åtminstone ett av problemen med det gamla skattesystemet kan ha överskattats. Inte desto mindre är slutsatsen att analysen av det gamla skattesystemet i allt väsentligt ändå var korrekt. Före skattereformen var skattekilama i Sverige så höga, att också en liten beteendeanpassning kunde översättas i en stor samhällsekonomisk effektivitetsförlust.

Andra effektivitetsvinster följer av den likformiga kapitalbe- skattningen, vilken tillsammans med de samtidiga ändringarna i räntesubventionerna har reducerat gynnandet av investeringar i bostadssektorn. Med det gamla skattesystemet ledde ökad inflation till en kraftig spridning i den effektiva beskattningen av olika sparforrner det blev inflationen och inte samhällsekonomiska överväganden som styrde investeringarnas inriktning. Det nya systemet är i detta avseende betydligt mera robust. På lång sikt har reformen skapat incitament för en mer ändamålsenlig fördelning av sparandet och förutsättningar för en effektivare kapitalallokering. Det handlar dock här om vinster som materialiseras först på lång sikt. På kort sikt har den likformiga kapitalbeskattningen förstärkt vissa problem. De långsiktiga allokeringsvinstema har köpts till

priset av att reformen förstärkte omställningsproblemen på fastig- hetsmarknaden. l nuvärdesterrner åsamkades många villaägare och hyresgäster, som anpassat sitt boende till de gamla skatte- och sub- ventionsreglerna, mycket stora förluster. Även om det långt ifrån var en primär orsak så bidrog övergången till en mer likformig kapitalbeskattning till att reformen kom att fördjupa den ekono- miska depressionen under början av 1990-talet. Dessa iakttagelser understryker att skatteomläggningar, och speciellt sådana som rör mycket långsiktiga investeringsbeslut, väcker sina egna problem. De långsiktiga vinsterna måste vägas mot risken för att själva bytet av skattesystem skapar orättvisor och makroekonomiska obalanser.

] utvärderingen pekas också på de möjliga effektivitetsvinster som följer av ett skattesystem som är enkelt och som inte stimule- rar till olika former av skatteplanering.

Agell-Englund-Södersten menar att det nya skattesystemet på några punkter ter sig som betydligt rimligare än det gamla. Skatterefor- men kan nå sitt syfte att ge ett väsentligt bidrag till en långsiktigt bättre fungerande samhällsekonomi.

3.4 Allmänhetens inställning till skattereformen

Kunskapen om det nya skattesystemet vid tidpunkten då det genomfördes grundades i stor utsträckning på beräkningar om dess effekter, vilka i sin tur baserades på en rad antaganden av olika slag. Den breda allmänheten fick sin bild via massmedia och den offentliga debatten. Efterhand ökar dock medborgarnas möjligheter att utifrån egna erfarenheter bilda sig en uppfattning om systemet och dess effekter. I syfte att belysa bl.a. denna fråga har forskare vid sociologiska institutionen vid Umeå universitet under ledning av professor Rune Åberg undersökt allmänhetens attityder till skattereformen (se bilaga 3). Opinionsundersökningar har genom- förts vid fyra tillfällen mellan mars 1991 och september 1992.

Opinionen i skattefrågor bestäms utifrån en rad bevekelsegrunder. Umeåsociologema tar upp ett par olika bestämningsfaktorer nämligen egenintresse, allmänintresse, moral och tillit.

Egenintresset utgår från en individuell nyttokalkyl. Av betydelse är därvid hur man själv uppfattar sin ekonomiska situation snarare än hur den faktiskt är Undersökningarna visar ett stödet för skattereformen var betydligt större bland de som uppfattar sig som vinnare på reformen än bland de som ser sig som förlorare vilket ger visst stöd för hypotesen att egenintresset har betydelse för medborgarnas inställning.

Med stöd i empirisk forskning har dock visats att allmänintres- set oftare är starkare än det kortsiktiga egenintresset då det gäller att ta ställning i viktiga politiska frågor. Argumentet att skattere- formen skulle åstadkomma dynamiska effekter och vara bra för samhällsekonomin är argument som kan sägas vädja till allmänin- tresset eller det gemensamma bästa. Undersökningarna ger stöd även för att allmänintresset har betydelse för hur åsikterna kring skattereformen tillskapas. De som tror på argumentet att skattere- formen är bra för samhällsekonomin stöder oftare reformen.

Opinionen styrs också utifrån moraliska värderingar. Ett legitimt skattesystem är ett system som svarar mot rådande moraluppfattningar. Dessa uppfattningar kan variera mellan människor och samhällsklasser. I vissa grupper är t.ex. jämlikhet och social rättvisa högt värderade värden. En skattereform som inte svarar upp mot dessa värden bland dem som omfattar dem, uppfattas inte där som legitim. Även denna moralfaktor kring hur åsikterna tillskapas ges stöd av undersökningarna.

Legitimiteten kan också ha att göra med förtroende och tillit till den som företräder ett förslag. Man gör inte någon egen bedömning utifrån någon form av nyttokalkyl utan man gör som man alltid gjort och förlitar sig på dem man tidigare förlitat sig på.

Det finns således flera bevekelsegrunder utifrån vilka männi- skor formulerar sina åsikter om skattereformen, och alla tycks de få visst stöd i undersökningarna. Detta är knappast förvånande eftersom de tenderar att hänga samman med varandra.

Den kritik av det gamla skattesystemet som politiker, fackför- eningsfolk och andra skattedebattörer framförde återspeglade sig också i medborgarnas inställning och man kunde i opinionsmät- ningar notera ett växande missnöje med det existerande skattesys- temet. Hur inställningen till skattesystemet som helhet har förändrats belyses i tabellen nedan som visar hur medborgarna svarat på identiska frågor som upprepats i några undersökningar utförda vid olika tidpunkter. De förändringar som kan utläsas av tabellen visar att inställningen till skattesystemet blivit något mer positiv efter skattereformen.

9. Tabell: Andel instämmande svar på några påståenden om skattesystemet i olika lurdersökningar ställda vid olika tidpunkter. Irronr parentes anges balansmått (andelen positiva till skattesystemet minus andelen negativa).

1969' 19811 19863" 19894 1992”

Med hänsyn till de förmåner som staten ger medborgarna är skatterna inte för höga 43(—l ]) 56(+l7) 53(+13) 58(+21) M arginalskattema är alldeles för

höga 70(-5l) 82(-70) 59(-30) V ån skattesystem ger en rättvrs för-

delning av skattebördan 34(-29) l6(-63) 26(-39)

Vad tycker du i stort om skattesyste- met. dvs skattemas storlek och reg— lernas utformning? (andel bra eller m ycker bra) 23039) 10055) 25(-1 ] )

Källor" ! Vogel 1970; 2 Laurin 1986; 3 Svallfors 1989; 4 Riksskatteverket ; 5 Svallfors 1992

Umeåsociologemas undersökningar visar att människors egna erfarenheter av det nya skattesystemet inte inneburit att opinionen kring skattereformen över lag förändrats. Vid första mätningen i mars 1991 stödde 45 procent av medborgarna reformen och vid sista mätningen i september 1992 var siffran 46 procent. Motstån- det hade sjunkit från 20 procent till 15 procent och osäkerheten ökat från 35 procent till 38 procent. Opinionsförskjutningama i befolkningen som helhet var således ytterst små under de arton första månaderna efter det att reformen trätt i kraft. Enskilda individer kan naturligtvis ha ändrat uppfattning men sådana förändringar har i så fall lika ofta gått i negativ riktning som i positiv.

10. Tabell: Svar på frågan om det var ett riktigt beslut att införa ett nytt skattesystem Pmcentandelar.

1991 1991 1992 1991 1991 1992 1991 1991 1992

m ars sept. sept. m ars sept. sept. m ars sept. sept. Ja 45 45 46 Nej 20 20 15 Vet ej 3 5 34 38 Sunmra 100 100 100

Opinionsbilden var mycket stabil under reformens arton första må- nader. Däremot har stödet förändrats inom olika politiska partier allteftersom människor rört sig ut ur och in i olika partier.

Det är viktigt att ha i minnet att de som inte stöder reformen endast till liten del utgörs av dem som är motståndare till den; de flesta av dem är osäkra och för många börjar troligen det gamla skattesystemet att alltmer falla i glömska.

Undersökningarna visar att medborgarnas uppfattning om skattere- formens fördelningseffekter är relativt entydig. Höginkomsttagarna uppfattar sig som vinnare och låginkomsttagama som förlorare eller också är de osäkra om fördelningseffektemag. Åberg ställer i sin utvärderingrapport, som skrevs 1993 då inga resultat om de faktiska effekterna fanns att tillgå, frågan om man rätt uppfattat reformens effekter? Agell-Englund-Söderstens utvärdering visar att skattesystemets omfördelande verkan minskat men att detta uppvägs av att den omfördelande verkan av bidragssystemet ökat. Omfördelningseffekten av det samlade skatte- och bidragssystemet är lika stor de första åren efter reformen som före. Av betydelse för hur man skall bedöma svaret på frågan är om de intervjuade uppfattat den ställda frågan såsom inkluderande enbart effekterna av förändringarna i skattesystemet eller om man uppfattat frågan som relaterande till den samlade reformen som även inbegrep vissa bidragsförändringar. Den replikering av tidigare beräkningar för RINK som på uppdrag av KUSK gjorts av Eklind-Husse'nius- Johansson visar att fördelningsprofilen av skattereformen åt- minstone i det korta perspektivet varit mera förmånlig för hushåll med höga inkomster än vad RINK-kalkylerna pekade på.

Umeåsociologemas undersökningar visar att stödet för reformen är betydligt starkare bland höginkomsttagare än bland låginkomsttagare; det är starkare bland högre tjänstemän än bland arbetare, och det är starkare bland män än bland kvinnor (tabell ll). Mönstret har varit detsamma i alla undersökningarna, möjligen har det skett en viss polarisering så till vida att de högre tjänste- männen blivit något mer övertygade om reformens fördelar och arbetarna något mindre övertygade.

Mäns och kvinnors värderingar om beslutet att införa det nya skattesystemet skiljer sig åt. Reformen erhåller konsekvent ett svagare stöd av kvinnor än män vid samma yrkesgruppstillhörighet och inkomst. För kvinnornas del är det faktiskt bara bland de kvinnliga tjänstemännen i de högre inkomstintervallen som stödet till reformen överstiger 50 procent. Ifråga om den manliga delen av befolkningen är det i stort sett bara bland låginkomsttagare i arbetargruppema som stödet till reformen understiger 50 procent. Åsiktsskillnadema mellan män och kvinnor synes vara stabila över tiden. Det bör dock betonas att kvinnorna inte är mer benägna att ta avstånd från reformen än männen. Däremot är kvinnorna mera osäkra.

9 Frågan som ställdes hade följande formulering: "I samband med skatteomläggningen pratade man mycket om att vissa grupper skulle tjäna och andra förlora på den. Anser du att du, i jämförelse med andra, tillhör det nya skattesystemets vinnare eller förlorare?"

11. Tabell: Andel positiva till det nya skattesystemet efter kön, yrke och inkomst vid tre tidpunkter. Pmcentandelar.

Inkomst 199] 1991 1992

Kön Yrkesgrupp kr. Mars September September Man Ej facklärd arbetare 8-12 000 48 41 43 Facklärd arbetare 8—12 000 48 45 37

12-16 000 52 52 48

Lägre tjänsteman 12-16 000 57 62 65

Mellan tjänsteman 12-16 000 64 72 71

"16-20 000 71 80 76

Högre tjänsteman >20 000 79 87 91

Kvinna Ej facklärd arbetare 8-12 000 30 25 26 Facklärd arbetare 8-12 000 30 29 29

12-16 000 34 35 40

Lägre tjänsteman 12-16 000 39 45 46

Mellan tjänsteman 12-16 000 46 45 52

16-20 000 54 56 59

Högre tjänsteman >20 000 64 84 74

4. Kommitténs avslutande synpunkter

4.1. Val av tidpunkt för reformen — Hade man kunnat göra annorlunda?

I efterhand kan konstateras att tidpunkterna för avreglering av kreditmarknaden och skattereformen varit dåligt anpassade till varandra och till konjunkturförloppet. Frågan är dock om det egentligen fanns något alternativ?

Genomförandet av skattereformen kom att sammanfalla med en mycket kraftig nedgång i ekonomin, faktiskt den kraftigaste sedan 1930—talet. Denna lågkonjunktur var på väg oberoende av skattere- formen. Reformen som sådan hade både expansiva och kontraktiva inslag. Underfinansieringen verkade stimulerande på ekonomin me- dan reformens inverkan på finansiella sparandet gav en negativ effekt. Sammantaget indikerar utvärderingen att skattereformen kortsiktigt kan ha skapat ett produktionsbortfall som motsvarar knappt en procent av BNP. Reformen har således fördjupat lågkon- junkturen. Men reformen är inte en primär faktor i krisförloppet. Mot bakgrund av den debatt som funnits vill KUSK dock ta upp frågan om man, om det hade gått att förutse konjunkturutveckling- en, borde ha valt att tidsmässigt lägga upp reformen annorlunda.

Hade det varit bättre att helt avstå från skattereformen och likt tidigare år fortsätta med årsvisa anpassningar med hänsyn till inflation m.m.? Kommittén menar att reformen var nödvändig. Det är bra att reformen är genomförd och att vi har övergångspro- blemen bakom oss. Det hade inte varit bättre att avvakta.

Man glömmer lätt hur situationen var. Kritiken mot skattesys- temet var utbredd. Systemets utjämnande effekt var i praktiken helt annan än vad skatteskaloma gav uttryck för. De som hade möjligheter tog hellre ut ersättning i form av Obeskattade eller lågt beskattade förmåner än som lön. Systemet var krångligt och lätt att utnyttja för skatteplanering av de som hade den rätta kunskapen.

På olika sätt gick det att omvandla högt beskattade löpande inkomster till värdestegringar, som då de realiserades beskattades lågt. Särskilt lönsamt var detta för personer med höga inkomster. Det behövdes större strukturella förändringar i systemet för att komma tillrätta med problemen. Successiva smärre anpassningar förslog inte längre. Svagheterna med det gamla skattesystemet torde också ha förstärkts och blivit än mer uppenbara åren framöver om reformen inte gjorts. I kombination med ökad internationell rörlighet och friare kredit- och valutamarknader skulle det gamla skattesystemets svaga punkter ha blivit än mer uppenbara. Det nya skattesystemet bör kanske därför inte jämföras med det gamla såsom det verkade i slutet av 1980-talet utan hur det skulle ha fungerat långsiktigt om det hade varit kvar.

Den valda paketlösningen där sänkta marginalskatter och mera likformig beskattning av arbete och kapital kombinerades med breddade skattebaser förefaller därför även i ljuset av de fem åren som gått som en riktig väg. Det har diskuterats om en mer successiv övergång till den 30-procentiga skattesats som infördes i kapitalbeskattningen skulle ha mildrat de effekter som uppstod via prisfallet på fastighetsmarknaden och det ökade finansiella sparandet. Svaret är inte givet. Om slutmålet om en 30-procentig kapitalskattesats varit känt är det möjligt att hushållen ändå agerat efter detta. Om slutmålet om en 30-procentig skattesats å andra sidan inte slagits fast hade man fått andra negativa effekter av att dras med ett olikformigt system för beskattning av arbete respekti- ve kapital under längre tid. Det är också osäkert om målsättningen om en likformig beskattning och en full beskattning av reavinster gått att uppnå i slutänden i detta fall. Även om man haft kunskap om att den samhällsekonomiska utvecklingen skulle ändras påtagligt är det oklart om det skulle ha haft några positiva effekter att sträcka ut genomförandet över en längre period än som gjordes.

Naturligtvis hade det, som framförts från en del håll, varit bäst om reformen kommit tidigare och genomförts i det överhettade ekonomiska läge som rådde under andra hälften av 1980-talet. Detta hade haft effekten att dels dämpa den lånerusch som uppstod i spåren av den avreglerade kreditmarknaden och därige- nom kyla av överhettningen. Dels hade lågkonjunkturen under inledningen av 1990-talet sannolikt blivit mindre djup. Med facit i hand är detta något alla kan hålla med om. "Då vi befann oss mitt i skeendet var utvecklingen dock svår att förutse. En så långt- gående reform kan på grund av sin komplexitet inte heller genom- föras utan viss tid för utredning och beslut i demokratisk ordning. En stor och på den tiden betraktad som mycket genomgripande skattereform hade ju faktiskt genomförts 1982 ett beslut som

tillkom genom en politisk uppgörelse ("den underbara natten") som då orsakade stor turbulens. Den skattereformen hade drag gemen- samma med 1990-1991 års reform, nämligen sänkta marginalskat- ter och reducerade skattelättnader för underskottsavdrag. Efter denna, i den tidens tycke, genomgripande förändring av skattesys- temet med de ändrade incitament som denna medförde är det inte förvånande att man från politiskt håll avvaktade med att dra igång ett stort utredningsarbete om ytterligare förändringar, vilket skulle ha krävts för att skattereformen skulle kunna ha genomförts under andra hälften av 1980-talet. Utredningsarbete kring ett par av de stora systemfrågoma i skattepolitiken pågick dock under perioden med inriktning på att pröva om helt nya modeller för beskattning skulle kunna vara möjliga alternativ för Sverige. De alternativa skattemodellerna gällde real beskattning och utgiftsskatt. När kritiken mot skattesystemet fortsatte gjordes 1987-1989 en kraftsamling av utredningsresurser där man med tanke på komplex- iteten i utredningsuppdraget på rekordtid fick fram ett heltäckande förslag innefattande såväl individ-, företags- som indirekt beskatt- ning.

Övergångskostnadema kunde dock ha mildrats betydligt om skattelättnaderna för underskottsavdrag hade reducerats från 50 till 40 procent redan fr.o.m. 1988 inom ramen för det dåvarande systemet med grund- och tilläggsbelopp. Överhettningen i slutet av 1980-talet kunde då ha dämpats och övergången till det nya regelsystemet skulle ha mildrat effekterna på bl.a. fastighetsmark- naden. Men en begränsning av ränteavdragen som ensidigt inneburit en begränsning i avdragsrätten hade varit ett svårt politiskt beslut att ta.

Att en skattereform skulle göras var känt genom de utrednings- direktiv som gavs 1987. Konturema av en del av dess möjliga innehåll preciserades hösten 1988. Men det var först sent hösten 1989 som det stod det klart att det också gick att få en politisk majoritet för att genomföra en så långtgående reform åren 1990- 1991. Man kan reflektera över varför hushållen och andra aktörer såsom fastighetsköpare, banker m.fl. synbarligen inte omedelbart reagerade på de signaler som gavs i och med att det blev klart att reformen skulle komma att genomföras. I så fall borde hushållen och andra ekonomiska aktörer genast ha påbörjat en anpassning av t.ex. spar- och lånebeteendet. Uppenbarligen var den ekonomiska verklighetens signaler starkare, såsom den fortsatt höga nominella löneutvecklingen, den höga inflationen och stora möjligheter att låna. Dessa signaler tog över. Först när man på ett påtagligt sätt via höjda räntor och nedväxling till låg inflation praktiskt fick

högre realränta och fallande fastighetspriser kom beteendeförän- dringama. Dessa blev då desto kraftigare.

Den formella avregleringen av kreditmarknaden torde också ha haft en större effekt än förväntat på upplåningen under andra hälften av 1980-talet. Den dominerande uppfattningen var att mycket av anpassningen till en friare kreditmarknad i praktiken hade skett redan tidigare. Men uppenbarligen fanns det fortfarande en uppdämd låneefterfrågan som inte hade tillgodosetts.

Sammanfattningsvis kan sägas att begränsade möjligheter att förutse den ekonomiska utvecklingen i kombination med de restriktioner som finns i det demokratiska beslutsfattandet har varit styrande för när och hur reformerna lagts upp. "Manöverutrymmet" har varit litet. Tidsordningen var inte den bästa. Bristerna i ordningen är på kort sikt ett pris vi fått betala men på lång sikt är det av mindre betydelse.

Att skattereformen överhuvudtaget var möjlig att genomföra hänger samman med att politikerna höll fast vid och värnade om principerna. Reformen var ett samlat paket som berörde alla delar av skattesystemet och även vissa bidrag. Det var helheten som gällde och särintressen kunde hållas tillbaka.

4.2 Skattereformen - en långsiktig investering

Kommittén vill understryka skattereformens karaktär av investe- ringsprojekt. Investeringen består i att ändra skattesystemets incitamentsstruktur. Avkastningen på investeringen uppkommer via påverkan på beteendet hos individer och företag på ett sådant sätt att detta bidrar till att öka den samhällsekonomiska effektiviteten. Problemet är att det dröjer innan investeringen ger full avkastning. Man kan identifiera olika faser i detta förlopp. För det första måste individer och företag "upptäcka" att incitamenten förändrats. Därefter skall denna upptäckt generera en vilja att ändra beteendet. För att denna vilja att ändra beteendet också skall kunna realiseras krävs också att möjligheterna finns rent praktiskt. Det samhällseko- nomiska läge som funnits åren närmast efter skattereformen har på vissa viktiga punkter lagt en hämsko på förändringar i beteendet även om viljan kan ha funnits. Men även när konjunkturen börjar förbättras dröjer det innan effekterna av skattereformen får fullt genomslag.

Vissa av de förväntade effekterna är av synnerligen långsiktig karaktär där avkastningen dröjer. Detta gäller t.ex. effekter på investeringar i utbildning och kärriärmöjligheter.

På vissa områden har beteendeförändringar i den åsyftade riktningen redan inträffat. Hushållen har ökat sitt finansiella sparande. På lång sikt skapar detta förutsättningar för en från samhällsekonomisk synpunkt bättre allokering av hushållens sparande. Kortsiktigt har dock uppstått en övergångskostnad genom att det ändrade beteendet bidragit till att fördjupa konjunktumed- gången. I ett mera normalt konjunkturläge skulle sådana över- gångseffekter vara oproblematiska.

Företagssektom är känslig för ändrade incitament. De ändrade incitamenten är där väl kända. Skatteplanering upptar inte längre samma centrala roll i företagens agerande. Exportföretag och företag med exportrelaterad verksamhet har från 1993 haft ett par goda år och uppvisar stora vinster och ökande skatteinbetalningar. Utöver den rent konjunkturella effekten är detta sannolikt också ett tecken på att man i högre grad skattar av vinsterna direkt med det nya systemets låga skattesats. På lång sikt kommer den mer likformiga beskattningen av kapital och en mer enhetlig prövning av olika investeringsprojekt att innebära att ekonomins sparande kanaliseras i mer produktiva former vilket ger ytterligare effektivi- tetsvinster.

Större omläggningar i skatternas regelsystem för alltid med sig vissa övergångskostnader. För skattereformens del har vi nu dessa bakom oss. I vilken takt de positiva effekterna kommer fram fullt ut beror bl.a. på hur ekonomin i övrigt utvecklas. En förutsättning för att skattereformen skall ge de åsyftade effektivitetsvinstema är dock att reglerna hålls någorlunda stabila och att principerna som låg till grund för reformen inte urholkas. Annars riskerar vi att hamna i ett läge där vi haft kostnader för en investering men inte får den tänkta avkastningen.

4.3 Skattereformens finansiering

Skattereformen beslutades i ett läge då statsbudgeten var balanse- rad eller till och med visade ett visst överskott. Men åren 1991- 1993 kom det statsfinansiella läget att snabbt försämras och underskottet i statsbudgeten blev nästan 190 miljarder kronor budgetåret 1992/93. Avsikten var att skattereformen skulle vara totalfinansierad. Utvärderingen visar vid en statisk beräkning utifrån skattebasemas faktiska utveckling på en kortsiktig under- finansiering på i genomsnitt ca 25 miljarder kr per år för åren 1991-1993. Kalkylen visar hur mycket högre skatteintäkterna hade blivit om det gamla skattesystemet applicerats på de faktiska skattebasema under början av 1990-talet. Därtill skall läggas en

effekt som är mera osäker och som sammanhänger med den indirekta effekt skattereformen haft på efterfrågan i ekonomin. Ekonomiprofessorema gör i sin utvärdering bedömningen att skattereformen för åren 1991 och 1992 var underfinansierad med ca 35 miljarder kr per år. Därvid har i underfinansieringen även beaktats hur den del av konjunkturfallet som bedöms bero på reformen har påverkat den offentliga sektorns inkomster och

utgifter.

Sammansättningen av den statiskt beräknade underfinansieringen för åren 1991—1993 avseende det andra steget av skattereformen framgår av tabell 12. Beräkningarna bygger samtliga är på det regelsystem som beslutades i anslutning till skattereformen. Kalkylema visar för skattereformens andra etapp på en genomsnitt- lig underfinansiering för åren 1991-1993 på drygt 21 miljarder kr. Därtill kommer underfinansiering av reformens första steg. Första etappen har bedömts vara underfinanierad med i storleksordningen 4 miljarder kr avseende i första hand sänkta skattesatser i individ- beskattningen och ändrad bolagsskatt. Det sammanlagda bidraget till underskottet uppgår sålunda enligt denna efterhandskalkyl i runda tal till i genomsnitt 25 miljarder kr per år för åren 1991- 1993. Därvid har i den reviderade beräkningen förutsatts att de 5 miljarder kr avseende dynamiska effekter som ingick i den ursprungliga reformkalkylen uteblivit i rådande konjunkturläge.

12. Tabell: Skatterefomrens budgetefl'ekterf'ör åren 1991-1993 ex post revidering av re- fomiberäkningar. Refonnens andra etapp. Effekter för konsoliderad offentlig sektor. 1991 års penningvärde.

Ex post revideringar Budgeteffekt, miljarder kr 1991 1992 1993 Snitt 1991-1993 Ursprunglig refomrkalkyl -0,3 —0,8 —0,8 -0,6 Ex post revideringar-. ]. Pga ändrade skattebaser m.m. Effekter av sänkta skattesatser -6,0 -6,0 -6,0 -6,0 (individer) Kapitalskatter -6,8 -5,7 -3,6 -5,4 Särskild löneskatt -2,5 -2,5 -0,3 -l,8 Företagsskatt -3,1 -3,1 -l,8 -2,7 Mervärdesskatt -2,5 -3,2 -3,8 -3,2 Punktskatter - 1,2 - l ,3 - 1,3 -1,3 Delsumma -22,1 -21,8 -16,8 —20.2 11. Dynamiska effekter -2,5 -5,0 —7,5 -5,0 Sununa revideringar ex post -24,6 -26,7 -24,3 -25,2 Reviderad refomibedömning -24,9 -27,5 -25,1 -25,8 Omperiodiseringar iförhållande till 1,9 6,0 5,5 4,5 reformkalkyl (avskattning av företagens reserver) Skattereformens bidrag till tmderskott -23,0 -21,5 -19,6 -21,4

Kalla: Anders Kristoffersson, Finansdepartementet: Was me tax reform Elly Enanced? (Ekonomiska Rådets serie Tax Reform Evaluation Reports).

En kort beskrivning av de komponenter som ligger bakom den reviderade kalkylen ges nedan.

Reforrnberäkningen baserades på framskrivning av individer- nas inkomster för 1988 som var det senaste utfall som fanns tillgängligt då reformen beslutades. Den faktiska utvecklingen av individernas inkomster blev snabbare än vad som förutsågs och in- dividerna hade vid tidpunkten för reformen förts upp i högre marginalskatteskikt. Sänkningen av skattesatserna beräknas som en följd härav vara underfinansierad med 6 miljarder kr i jämförelse med reformkalkylen.

Nedrevideringen av intäkterna från kapitalskatterna beror på att tillgångsprisema i praktiken utvecklades långsammare än med de framskrivningar som gjordes i reforrnberäkningen. Därmed korn bl.a. basbreddningama inom kapitalbeskattningen att lämna ett

mindre bidrag till finansieringen. Av underfinansieringen inom kapitalskatteområdet 1991 på inemot 7 miljarder kr är 1,5 miljarder kr hänförlig till reavinstbeskattningen av aktier och 3,6 miljarder kr till avkastningsskatten på pensionsfonder. Ett positivt tecken är att underfinansieringen av avkastningsskatten minskar med 3 miljarder kr mellan 1991 och 1993.

Den särskilda löneskatt som infördes på förvärvsinkomster och på arbetsgivarnas pensionskostnader var 1991 och 1992 under- finansierad med 2,5 miljarder kr. Utfallet för inkomståret 1993 visar på en återhämtning och underfinansieringen av löneskatten blir mindre än en halv miljard kronor.

Nedgången i ekonomin medförde att de förändringar som gjordes i regelsystemen för företagsskatten blev underfinansierade med ca 3 miljarder kr åren 1991 och 1992. Även för företagsskat- ten kan noteras en viss återhämtning av underfinansieringen under 1993.

Mervärdesskatten har i ex postberäkningen nedreviderats med drygt 3 miljarder kr i snitt per år. Den beräknade underfinans- ieringen sammanhänger i detta fall bl.a. med att korrigeringar gjorts för vissa felaktigheter i tidigare reformkalkyl och att den privata konsumtionen minskat.

Det bör noteras att det under perioden sker en påtaglig minskning av den del av underfinansieringen som är direkt kopplad till regelsystemförändringarna.Underfinansieringenavkapitalskattema, löneskatten och företagsskatten, som för 1991 beräknats till drygt 12 miljarder kr, minskar med 7 miljarder kr mellan 1991 och 1993 med tyngdpunkt på det senaste året (tabell 12). Någon åter- hämtning för mervärdesskatten har däremot inte inträffat beroende på fortsatt svag utveckling av den privata konsumtionen.

Det finns således indikationer på att underfinansieringen minskar efter 1992. Finansieringen genom den ändrade kapitalbe- skattningen blir allt större på grund av en mera positiv utveckling av aktiekurserna. En annan orsak är ökade skattepliktiga vinster i exportföretagen och exportrelaterad verksamhet. Det finns en rad faktorer som bidrar till att minska underfinansieringen på lite längre sikt. Den av skattereformen orsakade ökningen av det finansiella sparandet och den minskade skuldsättningen förbättrar kalkylen på sikt. De anpassningar som hushållen nu gör av sin bostadsefterfrågan bidrar på lite längre sikt till att ändra konsum- tionens sammansättning på ett för finansieringskalkylen fördelaktigt sätt eftersom bostadkonsumtionen även efter reformen är sub- ventionerad jämfört med annan konsumtion. Den genom skattere- formen minskade skatteplaneringen i företag och hos enskilda är också av betydelse. Vid övergången till det nya skattesystemet

gjordes en infasning av fastighetsskatt och reavinstskatt för att mildra övergångseffekterna. I takt med att dessa infasnings- processer får fullt genomslag uppkommer tillkommande finans- iering. Att underfinansieringen blir mindre i takt med en kon- junkturförbättring torde stå klart. En faktisk ökning av arbetsut- budet med 2 procent, vilket är den storleksordning man kan förvänta enligt utvärderingen, skulle ge en finansieringseffekt på tillkommande ca 10 miljarder kr. Om finansieringen därmed helt kommer att gå ihop mer långsiktigt är idag svårt att svara på. Hur som helst rör sig den mer långsiktiga underfinansieringen om den finns om väsentligt mindre belopp än vad som gäller de första åren efter reformen.

För att få ett säkrare underlag för en bedömning av under- finansieringen hade det, menar KUSK, varit önskvärt med en uppdatering av reformkalkylen för åren efter 1992. Kommittén har dock av tidsskäl inte kunnat göra en sådan utvärdering inom ramen för sitt arbete. En bidragande faktor till detta är att en tillfredsstäl- lande uppdatering till senare år bl.a. kräver tillgång till utfallsdata på mikronivå. I detta avseende finns en eftersläpning som bl.a. innebär att mikromaterial för inkomståret 1993 förelegat först sent hösten 1995. I frånvaro av utfallsdata måste bedömningarna baseras på förhållandevis osäkra framskrivningar över flera år av bl.a. inkomstfördelningen.

Hur skall man se på skattereformens kortsiktiga underfinansiering utifrån dagens situation? Bör åtgärder vidtas för att kompensera underfinansieringen? KUSK:s uppfattning är att denna fråga måste frikopplas från den mer kamerala betraktelsen av om reformen var underfinansierad och bedömas utifrån dagens situation. Utgångs- punkten bör vara där vi står idag och de beslut som fattats om förändringar av skatte- och utgiftsregler efter skattereformen. Dessa har fattats utifrån en bedömning av finansiella läget för offentlig sektor och vad som i dagsläget bedömts som lämpligt. Till den del skattereformen har en roll i de försämrade statsfinanserna kan därför sägas att statsmakterna genom tagna beslut har gjort en avvägning av detta förhållande mot främst de krav den stabilise- ringspolitiska situationen i övrigt ställer.

KUSK vill dock här ändå ge en beskrivning av de förändringar i systemet som beslutats efter det att reformen trädde i kraft. Den finansiella effekten av dessa tillkommande skatteändringar är totalt sett relativt begränsade t.o.m. 1994. Däremot skedde en ganska omfattande omfördelning av skatteuttaget. Framför allt ökade skatterna på förvärvsinkomster. Detta skedde bl.a. genom att det generella schablonavdraget slopades och att resekostnader till och

från arbetet istället endast fick dras av om kostnaderna översteg visst belopp. Egenavgifter infördes i sjuk- och arbetslöshetsförsäk- ringen. Skattesänkningama berörde, vid sidan av sänkta arbets— givaravgifter, fastighetsskatten på lokaler och beskattningen av kapitalinkomster och förmögenhet. ' Mervärdesskatten som i samband med skattereformen fick en enhetlig skattesats differentie- rades ånyo. Punktskattema har ökat i första hand på alkohol, tobak och bensin. År 1995 och åren därefter ökar skatterna avsevärt. Skatten på förvärvsinkomster höjs genom den s.k. vämskatten och minskad indexering av grundavdrag/skiktgräns och försatt höjning av egenavgifterna. Skatten på kapital höjs i första hand genom återställande av reglerna till de som gällde då skattereformen trädde ikraft men också genom höjd avkastningsskatt på pensions- försäkringar. Arbetsgivaravgiftema höjs som en del i finansieringen av EU-avgiften. Mervärdesskatten på livsmedel sänks.

De förändringar av skatterna som beslutats av riksdagen efter skattereformen motsvarar sammantaget för 1998 en budgetförstärk- ning för offentlig sektor med i storleksordningen 55 miljarder kronor eller ca 4 procent av BNP vilket är betydligt mer än storleken på skatterefomiens underfinansiering. Dessa skattehöj- ningar har beslutats utifrån en totalbedömning av det stabiliserings- politiska läget och det stora budgetunderskottet.

En fråga av principiell betydelse för den fördelningspolitiska värderingen av skattereformen är om de budgetförstärkningar som kan föranledas av skattereformens underfinansiering har en väsentligt annorlunda fördelningsprofil än den faktiskt genomförda skattereformen. Frågan kan inte besvaras med någon exakthet. Att det kortsiktigt är fråga om en underfinansiering står klart. Men om det är fråga om en underfinansiering även på lång sikt går ej att svara på. Det är således svårt att ringa in någon storlek på de budgetförstärkningsåtgärder som kan föranledas av skattereformens eventuella underfinansiering. Än mindre går det att skilja ut och identifiera specifika åtgärder som skulle ha "vidtagits av just detta skäl och utvärdera den fördelningspolitiska profilen av dessa. Besluten har tagits utifrån en bedömning av det stabiliseringspoli- tiska läget i stort. Därvid har beslutsfattarna bemödat sig om att avväga åtgärderna så att den fördelningspolitiska profilen skall vara acceptabel.

4.4 Reformens fördelningseffekter

Skattereformen var en stor och genomgripande reform. Tekniskt berördes alla delar av beskattningen och även bostadssubventioner och bidragen till hushållen. Ett av reformens huvudsyften var att driva ned skattekilama till mer rimliga nivåer och få ett system som ökar den samhällsekonomiska effektiviteten. Reformens för- delningseffekter bör ses och bedömas utifrån denna övergripande målsättning.

De beräkningar av fördelningseffektema som gjordes i samband med reformpropositionen baserades på uppgifter om inkomstförhål- landena 1987 som var det mest aktuella material som då fanns att tillgå. För att återspegla aktuella förhållanden då reformen skulle genomföras skrevs materialet fram fyra år. Sådana framskrivningar ger alltid viss osäkerhet. Felkällorna kan finnas både i valet av nivå för framskrivningama och i de metoder som används. Därtill kommer viss osäkerhet i det statistiska grundmaterialet eftersom det baseras på en urvalsundersökning. I den utvärdering som nu gjorts har kunnat användas faktiskt material för reformåren vartill kommer att grundmaterialet är säkrare på grund av att det statistis- ka grundmaterialet förstärkts just för att kunna bättre studera effekterna av reformen. De resultat som kommit fram i utvär- deringen ger därför en säkrare bild av reformutfallet än beräk- ningarna i propositionen. Men det finns fortfarande osäkerheter kvar. Valet av metod är inte givet. Olika metoder och avgräns- ningar ger delvis olika resultat. Klassificeringar är i en del fall osäkra och indelningsgrundema kan diskuteras. Som framgått av den tidigare redovisningen ger en och samma metod olika resultat tillämpad på olika är beroende på att inkomstfördelningen och skattebasema varierar.

Utvärderingen visar att den bild av reformens fördelningseffekter som gavs inför genomförandet av reformen håller för de allra flesta grupper. Resultatet av de nya beräkningar som genomförts ligger mycket nära de kalkyler som gjordes i samband med refonnpropo- sitionen. Men på en viktig punkt underskattade de gamla be- räkningarna refonnutfallet. Hushållen med de högsta inkomsterna och högre tjänstemän har fått ett högre utfall än vad de tidigare kalkylerna visade på. Utfallet för de 10 procent av hushållen med högst disponibel inkomst ligger i den nya kalkylerna nära genom- snittet för samtliga hushåll vilket innebär en ökning av den disponibla inkomsten med omkring 3 procent som en följd av reformens regeländringar mot 0,2 procent enligt kalkylerna i pro- positionen. Det högre utfallet för hushållen med de högsta in-

komsterna förklaras bl.a. med att det nu finns säkrare uppgifter om basbreddningamas faktiska storlek och fördelning. Basbredd- ningama blev i själva verket mindre än vad som antogs i den ursprungliga reformkalkylen i hög grad beroende på den djupa lågkonjunkturen. Dessa nedrevideringar är en av orsakerna till att reformens effekter på den disponibla inkomsten i de nya beräk- ningarna blir högre för välbeställda hushåll. Vissa av basbredd- ningama felbedömdes helt klart. I flera fall råder dock osäkerhet om vilken nivå de hamnar på mera långsiktigt. Ny information om basbreddningamas storlek och profil kan dock inte förklara hela förändringen. Även andra faktorer har av allt att döma spelat in. En faktor man kan spekulera i är om marginalskattema, beroende på den faktiska löneutvecklingen, kom att ligga högre än med de framskrivningar som gjordes i propositionen. I så fall bör i be- dömningen också finnas med att skattekilama och effektivi- tetspriset i praktiken var en aning högre. En annan möjlig för- klaring är att det helt enkelt finns slumpfel i det statistiska grundmaterialet (urvalsundersökningarna) som kalkylerna utgår ifrån. Sådana slumpfel varierar och kan vara olika stora för olika grupper i grundmaterialen från olika är.

KUSK skulle enligt direktiven belysa reformens effekter för lönebildningen — en fråga som också är av intresse för inkomst- fördelningen. Det har dock i utvärderingen inte gått att klarlägga reformens effekter på lönebildningen. Ser man till den faktiska ut- vecklingen kan inte skönjas några spår av en minskad lönesprid- ning vilket det kan ha funnits förväntningar på. Den trend till ökad lönespridning som funnits sedan mer än ett decennium i Sverige och internationellt har inte brutits i samband med skattereformen. Men det finns inte heller någon grund för att dra den motsatta slutsatsen att reformen har bidragit till en ökad lönespridning. Den nominella löneökningstakten har reducerats påtagligt fr.o.m. 1991 men skattereformens bidrag till detta är oklart.

I utvärderingen har studerats reformens fördelningseffekter givet den underfinansiering av reformen som finns på kort sikt. Många justeringar har gjorts av skattesystemet efter reformen. Det stabiliseringspolitiska läget inklusive effekterna av underfinans- ieringen av skattereformen har tvingat fram en rad ändringar bl.a. i transfereringssystemen. Det blir allt svårare att avgränsa och skilja ut reformens roll i sammanhanget och det blir också med tiden mindre intressant. Värderingen av inkomstfördelningen för hushållen får göras utifrån där vi står idag.

Det finns en rad aspekter av fördelningskaraktär på reformen som inte låter sig enkelt kvantifieras men som ändå bör finnas med i värderingen av reformens utfall. Sverige har fått ett mera tåligt och robust system som inte på samma sätt kan utnyttjas för skattepla- nering. Spridningen i faktisk skatt mellan personer med lika inkomster har minskat. Beskattningsresultatet är mera förutsägbart och den fördelningspolitiska träffsäkerheten större. Breddningen av skattebasema har gjort inkomsterna synliga. Skattesystemet är enklare och lättare att förstå för den enskilde. Detta är faktorer som också kan vara väsentliga för lojaliteten med systemet och benägenheten att fuska vilket också har betydelse för bilden av för- delningseffektema.

4.5 Likformighet, stabila skattebaser och kontrollproblem

Huvudsyftet med skattereformen var att med beaktande av de be- gränsningar som ges av de fördelningspolitiska ambitionerna åstadkomma en från samhällsekonomisk synpunkt mera effektiv beskattning. Vid utformningen togs också hänsyn till miljöaspekter. Stabila regler var ett annat uttalat mål.

En central utgångspunkt för skattereformen var strävan efter större likformighet mellan olika skatter. Samma typer av inkomster och verksamheter skulle beskattas på ett likartat sätt. Ett mera lik- formigt system ger mindre samhällsekonomiska förluster genom att företagens och individernas beteende inte snedvrids lika mycket av skattesystemet.

Likforrnighetsprincipen är också viktig om man vill minska möjligheterna till vinster genom olika slags skatteplanering. Ett likformigt system hjälper till att uppnå målsättningen om horison— tell rättvisa, dvs. att personer med lika stora faktiska inkomster betalar samma skatt. Fördelen är också en viss stabilitet i regelsys- temen genom att det är svårt för olika intressegrupper att få igenom selektiva skattelättnader i ett system där principen om likformighet upprätthålls. Även från administrativa synpunkter har ett likformigt system fördelar.

Stabiliteten i skattebasema varierar. Därtill kommer att beständig- heten i vissa av skattebasema också beror på problemen med att i ett internationellt perspektiv finna enkla och effektiva kontrollme- toder. Särskilt svåra att kontrollera är kapitalinkomstema. Även om regelsystemet är sådant att svenskars kapitalinkomster utomlands skall beskattas på samma sätt som inhemska kapitalinkomster är

det i praktiken svårt att kontrollera kapitalinkomster utomlands. Detta begränsar handlingsutrymmet vad gäller skattesatsnivå m.m. inom kapitalbeskattningen. Om skattenivån är betydligt högre i Sverige än motsvarande källskatt i andra länder söker sig kapitalet utomlands och skattebasen eroderas.

En gemensam internationell syn på kapitalinkomstbeskatt- ningen skulle underlätta men det har visat sig svårt att i det internationella samarbetet uppnå enighet om t.ex. informationsut- byte eller källskatt på räntor och utdelningar. Ett par exempel från andra länder illustrerar problemen. 1987 infördes en källskatt på ränta på obligationer i Tyskland. Den avskaffades emellertid efter två år med hänvisning till att kapitalet sökte sig utomlands och räntorna ökade. I Belgien sänkte man 1990 källskatten på räntein- komster från 25 till 10 procent för inhemskt sparande. Med den lägre skattesatsen blev det inte lika intressant att göra komplicera- de internationella arrangemang (involverande främst Luxemburg) för att undvika skatten.

Kontrollproblemen i ett internationellt perspektiv sätter således gränser för hur hög kapitalbeskattningen kan göras i Sverige. Även om man inom EU på sikt skulle lyckas komma överens om informationsutbyte eller om ett gemensamt system för preliminär skatt på räntor/utdelningar så kan kapitalet komma att söka sig utanför EU. Transaktionskostnader och osäkerhet av olika slag i samband med privatpersoners placering av kapital utomlands har dock en viss återhållande effekt på att föra kapitalet utomlands i syfte att kringgå de svenska skattereglerna.

Även företagsbeskattningen är utsatt för stort internationellt beroende, vilket gör de inhemska skattebasema känsliga för skattenivån. Den utformning den svenska företagsbeskattningen har efter skattereformen är från den synpunkten konkurrenskraftig. Vilka krav som kommer att ställas på'företagsbeskattningen i framtiden beror i hög grad på hur denna utvecklas i andra länder.

När det gäller geografiska områden med närhet till andra länder (t.ex. Skåne) kan antas att skattebasema för moms och punktskatter är känsliga för stora skillnader i beskattningsnivå mellan länderna.

Arbetskraft brukar anses vara en internationellt sett relativt trögrörlig skattebas och är därmed inte lika beroende av skattehar- monisering med utlandet. Vissa antalsmässigt mindre, men strategiskt viktiga, grupper kan dock antas mer känsliga än andra t.ex. välutbildade med en internationellt användbar kompetens. Skattereglema skulle också kunna ha betydelse för företagens val att lokalisera sin forskning och utveckling. En viktig fråga är därvid också hur den svenska lönestrukturen förhåller sig till andra länders. Även om arbetskraften således kan betraktas som en

jämförelsevis stabil skattebas torde det internationella beroendet sätta vissa gränser för t.ex. vilken skattenivå man kan ha inom inkom stskattesystemet. Därmed är frågan om inkomstskattens nivå i Sverige till del beroende av de nivåer som finns i andra länder främst inom EU.

Genom skattereformen gavs skattesystemet en förstärkt miljöprofil bl.a. genom en differentierad bensinskatt, koldioxidskatt, differenti- erad energiskatt på oljeprodukter, svavelskatt och utsläppsavgift på kväveoxider från stora förbränningsanläggningar. Under våren 1995 tillsattes en parlamentarisk utredning som skall se på förutsättningama för ökad milj örelatering av skattesystemet. Frågan om förutsättningama för växling mellan skatter på arbete och miljörelaterade skatter kommer att prövas av utredningen. Med skatteväxling avses därvid en övergång till ökad skatt på miljöfar- lig verksamhet och förbrukning av ändliga resurser till förmån för sänkt skatt på arbete. Även skattereformen innebar en sådan växling. Skatteväxlingen syftar till effektivitetsvinster dels genom att samhällets kostnader för negativ miljöpåverkan beaktas på samma sätt som övriga produktionskostnader, dels genom minska- de skattekilar på arbete. En diskussion om miljörelaterad skatte- växling pågår också inom EU och den framtida utvecklingen inom EU blir av stor betydelse för Sverige.

4.6 Reformens beständighet

Från olika håll har framförts åsikten att skattereformen inte resulterade i det stabila och varaktiga skattesystem som man trodde då beslutet togs. Det har hänvisats till det stora antalet förändringar som gjorts i systemet åren efter skattreformens genomförande.

Kommitténs bedömning är att även om det varit fråga om många förändringar så består reformens huvudprinciper alltjämt. Det gäller t.ex. - den kraftiga sänkningen av marginalskattema i individbeskatt- ningen kombinerad med en breddning av skattebasema, - den separata och proportionella beskattningen av inkomst av kapital samt - sänkningen av den formella skattesatsen i bolagsbeskattningen kombinerad med en motsvarande basbreddning.

Men det finns också exempel på brott mot de principer som var vägledande för reformen. Differentieringen av momsskattesatsen

är ett exempel på ett sådant avsteg. Sänkningen av kapitalbeskatt— ningen åren 1992-1994 är ett annat exempel.

"Värnskatten" innebär en höjning av marginalskatten. Höjningen uppgår till 5 procentenheter och är tidsbegränsad till åren 1995- 1998. Den skall ses i perspektiv av de försämrade statsfinanserna och strävan att fördela bördoma av de ekonomiska saneringsåt- gärdema på alla grupper. Tidsbegränsningen innebär att det finns en vilja att stå fast vid skattereformens principer.

En annan fråga är hur man från marginalskattesynpunkt skall se på de allmänna egenavgifter som införts efter skattereformen. Dessa tas f.n. ut med 3,95 procent varav ] procentenhet för finansiering av pensionssystemet och 2,95 procentenheter för sjukförsäkringen. Sjukförsäkringsavgiften planeras höjas med 1 procentenhet per år under åren 1996-1998. Detta innebär att det samlade avgiftsuttaget 1998 kommer att uppgå till 6,95 procent. Egenavgifterna är avdragsgilla vilket medför att genomslaget på marginaleffekten blir lägre än avgiftssatsen. En medelinkomsttaga- re (inkomster under skiktgränsen) med genomsnittlig kommu- nalskatt hade 1991 en marginalskatt på ca 31 procent. Egenavgifter och en viss höjning av kommunalskatten innebär att medelin- komsttagaren 1998 kommer att ha en marginaleffekt på ca 36 procent. En sådan drift uppåt är begriplig med hänsyn till budget- konsolideringsbehovet. Ett tak för uttag av egenavgifter går vid 7,5 basbelopp (vilket 1995 innebär en inkomst på 270.000 kr). På inkomster över 7,5 basbelopp tas inte ut egenavgifter och de berättigar inte heller till förmåner.

För närvarande övervägs hur det fram tida pensionssystem et skall utformas och finansieras. Det skulle kunna betyda stora förändring- ar som tillsammans med förändringar av barn- och bostadsbidrag ändrar skatte- och bidragssystemets incitamentseffekter och för- delningsprofil i förhållande till när skattreformen genomfördes. Det ligger dock utanför KUSKzs uppdrag att belysa dessa frågor.

Basbreddningama, som går ut på att alla ersättningar skall beskattas lika oavsett vilken form de tar, får anses allmänt accepterade. Ingen vill gå tillbaka till ett system där många som hade möjlighet hellre tog ut ersättning i form av lågt beskattade eller Obeskattade förmåner än i form av lön. I den mån det riktas kritik mot ändringarna i förmånsbeskattningen så är det inte med argumentet att det skulle vara orättvist eller principiellt felaktigt. Däremot har olika branschintressenter- pekat på effekter för sysselsättningen inom aktuell bransch. Beskattningen av tjänstebilar kommenterades sålunda utifrån aspekten att nybilsförsäljningen minskade med effekter på sysselsättningen men inte att det skulle vara orättvist från inkomstfördelningssynpunkt eller att be-

skattningen som sådan var orättvis i förhållande till andra bran- scher. Även när det gäller beskattningen av subventionerade måltider diskuterades effekterna för branschen. Ett argument som framfördes var att svenska folkets hälsa skulle försämras till följd av den slopade subventioneringen av lunchkuponger. Men det har aldrig hävdats att beskattningen som sådan skulle vara orättvis.

Den separata beskattningen av inkomst av kapital har inte ifrågasatts. Åren efter skattereformen ändrades kapitalinkomstskat- ten främst genom ändrad skattesats för vissa typer av avkastning. I och med de beslut som togs hösten 1994 har dock systemet återställts till de regler som infördes i samband med reformens genomförande. Det kan i sammanhanget nämnas att en fristående separat kapitalbeskattning efter mönster från Sverige även införts i Danmark, Norge och Finland. Internationellt går den numera under beteckningen den "Nordiska modellen" och har även tagits efter i länder utanför Norden.

Även den grundläggande principen för företagsbeskattningen om kraftigt sänkt skattesats och breddningar av skattebasen ligger kvar. Däremot har reglerna inte blivit så stabila som avsetts. Ändringar- na har dock bl.a. haft till syfte att öka neutraliteten, vilket ligger i linje med skattereformens principer. Avskaffandet av den s.k. skatteutjämningsreserven ("SURV") och den därtill knutna sänkningen av bolagsskattesatsen får ses som en förenkling av det regelsystem som visade sig ha blivit alltför kompliöerat i den utformning det gavs i samband med skattereformens genomföran- de.

Liksom- förväntat har reformen haft återhållande effekter på skatteplaneringen. Kommittén vill i detta sammanhang framhålla vikten av att regelsystemen är stabila. Förändringar i sig tenderar nämligen ge incitament till skatteplanering. En varningsflagga bör hissas för effekterna av kontrollproblemen i anslutning till kapitalets ökade rörlighet och vad detta kan komma att innebära för tendenser till internationell skatteplanering och skattefusk. Dock får sägas att skattereformen som sådan verkat dämpande på denna utveckling. Med det gamla skattesystemet skulle problemen med internationell skatteplanering och skattefusk varit större.

Avsikten var att reformen skulle leda till ett enklare skattesystem. Bedömningen är att så också blivit fallet för löntagarna bl.a. genom att viss uppgiftsskyldighet m.m. flyttats över till arbetsgiva- re och tredje man. Förenklingseffekten av reformen har däremot varit begränsad för företagen. Regelförändringar som gjorts efter reformen har också inneburit tillkommande komplikationer. Som exempel på detta kan nämnas differentieringen av skattesatsen för

mervärdesskatten och de nya regler som införts för enskild näringsverksamhet i det vällovliga syftet att uppnå likformighet med beskattningen av aktiebolag. Väl medvetna om konflikten i att kombinera rättvisa med enkelhet menar kommittén att en strävan måste vara att förenkla reglerna för företagsbeskattningen. De kartläggningar KUSK låtit göra visar att fullgörandekostnadema är en större börda för de små företagen. Som det nu är ägnas alltför mycket kraft åt att informera om reglerna från myndigheternas sida och åt att förstå reglerna på företagssidan. Tolkningsproblemen är stora och det kan lätt bli fel.

Tidigare har pekats på svårigheterna att värdera effekterna av skattereformen i rådande konjunkturläge. Man kan därvid rent allmänt reflektera över vilken inverkan de senaste årens ekono- miska utveckling har för stabiliteten i regelsystemet. Samspelet torde vara komplext. Det statsfinansiella läget medför ett behov att höja skatten. De förändringar i skatteuttaget som är beslutade med hänsyn till det statsfinansiella läget innebär, enligt kommitténs be- dömning, samlat sett inte några grundläggande avsteg från reformens principer. De svaga statsfinanserna torde på ett sätt verka stabiliserande genom att utrymmet för att introducera särregler och undantag (s.k. tax expenditures) är litet. Breddningen av skattebasema bör av bl.a. detta skäl vara ett inslag i reformen som är beständigt i rådande läge. Den ökade arbetslösheten har däremot inneburit att vissa tidsmässigt begränsade avsteg gjorts från de generellt verkande regelsystemen. Det generella anställ- ningsstödet "GAS" som fanns 1994 och det riktade anställnings- stödet "RAS" som fanns i början av 1995 är exempel på sådana temporära "krympningar" av skattebasema.

Med beaktande av den statsfinansiella krisen får sägas att skattereformens principer klarat sig någorlunda bra. Även om grundstrukturen i stort hållits måste kommittén dock konstatera att reglerna inte blivit så stabila som vore önskvärt och som var ett av målen med reformen. Hushåll och företag behöver stabila regler för att kunna se framåt och planera mer långsiktigt.

4.7 Slutbedömning

Reformens omfattning var unik. Den förändrade de ekonomiska villkoren för hushåll och företag på ett i flera avseenden genom- gripande sätt.

Flertalet av reformens målsättningar har blivit väl uppfyllda. Hushåll och företag möter nu ett skattesystem som är mera robust

och mindre manipulerbart genom skatteplanering. Skattesystemet styr hushållens och företagens handlande på ett mindre godtyckligt och mera samhällsekonomiskt riktigt sätt. Det gamla skattesyste- mets svaga punkter hade förstärkts i takt med den ökande in- temationaliseringen. Det reformerade systemet fungerar bättre med de nya internationella förutsättningama. Skattehanteringen för hushållen och skatteförvaltningen har förenklats i flera avseenden och totalt sett förbilligats. På dessa punkter är utvärderingama

entydiga. De villkor som uppställdes för reformen att den skulle vara statsfinansiellt och fördelningspolitiskt neutral har inte

uppfyllts fullt ut. Skattereformen var under de första åren under- finansierad med storleksordningen 25 miljarder kr per år vartill kommer en mer osäker effekt på uppskattningsvis 10 miljarder kr på grund av att reformen torde ha bidragit till att fördjupa lågkonjunkturen. Reformens utfall gav inte heller exakt den fördelningspolitiska profil som man räknade med men dess bidrag till ökad spridning i ekonomisk standard är begränsad. Båda dessa effekter beläggs på kort sikt i utvärderingarna. På längre sikt med mera normalt konjunkturläge minskar underfinansieringen.

Trots att reformen genom underfinansieringen bidrog till att stimulera efterfrågan blev dess sammantagna effekt i konjunktur- förloppet sannolikt kontraktiv genom att den bidrog till att förändra hushållssparandets inriktning. Denna kontraktiva effekt beror på att det starkt ökade hushållssparandet (som väsentligen var en följd av andra faktorer än skattereformen) kom till stånd under helt nya villkor. Sparande i s.k. reala tillgångar som bostäder, fritidshus, möbler, bilar blev genom reformen mindre lönsamt eller dyrare vid lånefinansiering medan finansiellt sparande blev väsentligt mera lönsamt än tidigare. Hushållssparandets ändrade sammansättning bidrog till fallet i hushållens efterfrågan men skattereformens effekter i detta avseende torde inte vara den primära faktorn i konjunktumedgången.

Särskilt genomgripande blev reformens effekter på bostads- marknaden med stigande boendekostnader och fallande priser på villor, fritidshus och bostadsrätter med konsekvenser för byggan- det.

De teoretiska beräkningar av reformens effekter på arbetsut- budet som gjorts i samband med utvärderingen indikerar en för- väntad positiv effekt på storleksordningen två procent, vilket är väl i linje med de effekter som antogs i propositionen. På grund av den häftiga konjunktumedgången har det inte varit möjligt att stämma av dessa beräkningar mot den faktiska utvecklingen.

Det har heller inte varit möjligt att belägga några effekter av skattereformen på lönebildningen. Spridningen i löner och arbetsin-

komster har fortsatt att öka något sedan mer än ett decennium medan den nominella löneökningstakten reducerades markant från och med år 1991.

Utredningen har inte kunnat belägga att skattefusket ökade under 1980vtalet. De (osäkra) beräkningar av den svarta ekonomins storlek som utredningen låtit göra tyder snarast på en oförändrad eller svagt minskande svart sektor under 1980-talet, sannolikt till följd av en effektivare kontrollverksamhet.

Skattereformen har inte medfört den stabilitet i regelsystemet som man trodde då den beslutades. Skattesystemet har varit'utsatt för en mängd förändringar efter reformen varav en del inneburit tillkommande komplikationer. Trots alla förändringar är dock KUSK:s syn att huvudprincipema ännu står kvar.

Det viktiga är nu, menar KUSK, att skattereformens effekter får möjligheter och tid på sig att verka ut. Dessa effekter kommer successivt men kommer att vara svåra att direkta urskilja som hänförbara till skattereformen.

Särskilt yttrande av sakkunnige Sten Johansson

På mindre än ett decennium har det svenska samhället förändrats genomgripande i ett flertal avseenden. När verkningarna av en serie politiska beslut nu till stora delar mognat ser vi ett nytt samhällsmönster växa fram och stabiliseras med bestående mass- arbetslöshet som främsta kännetecken. Den radikala skattereform som trädde i kraft 1990-91 är ett i serien av politiska beslut som kan ha bidragit till den nya situationen.

Till skillnad från övriga i serien ekonomisk-politiska beslut vilka sammantaget resulterat i den nuvarande situationen har skattereformen utvärderats genom en ganska stor forsknings- satsning. I den sammanfattande forskningsrapporten har forskarna penetrerat (nästan) alla de väsentliga frågorna med ett ansenligt mått av kreativ djärvhet och givit underlag för konkreta slutsatser av betydande räckvidd. Den sammanfattning av forskningsresulta- ten som kommittén gör i sin Slutbedömning (avsnitt 4.7) kan jag i allt väsentligt instämma i. .

Dock bör forskarnas resultat på ett par viktiga punkter behandlas som preliminära, ja, som ett första försök att få grepp om de mycket komplexa frågor som aktualiserats i samband med utvärderingen. Eftersom reformen antogs vara statsfinansiellt neutral var det naturligt för reformens tillskyndare att inte ägna frågan om reformens verkningar i olika konjunkturförlopp någon särskild uppmärksamhet särskilt som man också antog att effekter- na på hushållssparandet skulle bli marginella.

Utvärderingama visar entydigt att reformen var underfi- nansierad med ungefär 35 miljarder per år 1991-1993 och att den sannolikt ganska markant påverkade hushållssparandets inriktning från realt till finansiellt sparande. Den sammanlagda effekten på konjunkturförloppet av dessa två faktorer blev enligt forskarnas beräkningar kontraktiv.

Det är möjligt att forskarna med sina räkneexempel baserade på en förenklad makromodell någorlunda korrekt ringat in storleksordningen ett produktionsbortfall på en procent av BNP med ca 10 miljarder i effekt på budgetsaldot. Räkneexemplets bevisvärde är dock begränsat på grund av de många förenklade

antaganden som görs och att skattereformen ses isolerad från övriga faktorer som påverkade konjunkturförloppet. Bevisvärdet skulle öka med en makromodell som mera detaljerat studerar komponenterna i inhemsk efterfrågan och mera specifikt i hus- hållens efterfrågan och som fördelade ut det unikt djupa fallet i inhemsk efterfrågan på flera orsaker. Förloppet behöver också följas över en längre tidsperiod. Det är således möjligt att det snarare än skattereformen var t.ex. knytningen av kronan till ECU och det dramatiska försvaret av en övervärderad krona fram till oktober 1992 som hade huvudrollen när det gällde att initiera det dramatiska konjunkturfallet som tvingade hushållen in i ett helt nytt ekonomiskt handlingsmönster.

En annan ansats vore att söka följa förloppet på mikronivå i hushållens budgetar för att den vägen söka förstå fallet i hus- hållens efterfrågan när de började agera utifrån de nya förut- sättningar som statsmakternas beslut gav för hushållens ekonomi. Det intressanta begreppet i sammanhanget är då hushållens återstående konsumtionsutrymme när det höga ränteläget fram- tvingade snabbamortering av lån, de snabbt ökande boendekost- nadema tog en allt större andel av de disponibla inkomsterna, försörjningsbördan för arbetslösa ungdomar ökade samtidigt som den nominella löneökningstakten snabbt avtog etc. Man behöver också söka förstå hur stor del av den betydande sänkningen av den statliga inkomstskatten som hamnade hos hushåll med låg eller ingen benägenhet att öka sin konsumtion. De databaser som nu finns på Statistiska centralbyrån (SCB) torde vara väl lämpade för sådana analyser.

Hur skall fallet in i massarbetslöshetens samhälle förstås om skattereformens bidrag var relativt marginellt? Med räkneexemplet anser sig forskarna ha ringat in den övre gränsen för skatterefor- mens bidrag till konjunktumedgången. En allmän hänvisning till ”konjunkturen” som orsaksfaktor i övrigt tenderar att mystifiera förloppet. Det måste ju antas att förloppet i själva verket styrdes av en serie av politiska beslut (och icke-beslut) under den senaste tioårsperioden. Även om många av dessa beslut framstår som irreversibla är det av stor vikt att fortsatt forskning med ett bredare perspektiv än skattereformens kommer till stånd.

En besvikelse är att forskarna i så begränsad utsträckning lämnat underlag för den fortsatta diskussionen om dynamiska effekter på arbetsutbudet. Det forskarna gjort på detta området inom ramen för utvärderingen är något mera sofistikerade teoretis— ka beräkningar av effekterna på arbetsutbudet baserade på tvärsnittsdata. SCBs databas innehåller numera uppgifter om löner och sysselsättningsvolym från abetsgivarnas register före och efter

reformen som möjliggör studier av faktiska utfall för individer som följs över tid.

Fortsatt forskning är också önskvärd för att man skall kunna bedöma de mera långsiktiga fördelningspolitiska effekterna. Utvärderingama visar att de fördelningspolitiska villkoren för reformen inte uppfylldes på kort sikt. När man i utfallet för 1992 beaktar att de utlovade höjningarna av barnbidragen inte förverkli- gades fullt ut (se kolumn G i tabell 10, bilaga 5) framstår utfallet som ganska stötande från fördelningspolitiska utgångspunkter. Detta gäller redan på kort sikt. Utfallet på kort sikt föranleder önskemålet om fortsatt forskning om den fördelningspolitiska utvecklingen eftersom det finns skäl att förmoda att utfallet på längre sikt kan bli sämre. När det gäller förrnögenhetsfördelningen är SCBs databas och senast publicerade uppgifter om förändringar- na i förmögenhetsfördelningen en besvikelse eftersom verket inte fullföljt det program för förmögenhetsstudier som funnits sedan flera år.

Att önska mer och fortsatt forskning är vanligt. I detta fall gäller det att bidra till förståelsen av ett förlopp som i grunden förändrat och försämrat villkoren för stora befolkningsgrupper i vårt land. Forskarnas insatser hittills inger förhoppningar om att ökad klarhet skall kunna åstadkommas.

- '. -i' grä-ttd'rtnräm . li 'Iifilii" ":"i 'i' Bri 'l'lhlfllftlol

*» ,...». ' . —'

' | i" 5,51 t-Jpz till! rill—uj mfl . " iii; _ J "'i' . å ' amulett :ilidIl

' .:.r. "iii

till..

t | '1;|'|| _

Bilaga 1: Bilagan föreligger i separat tryckt volym

Jonas Agell Peter Englund Jan Södersten

Svensk skattepolitik i teori och praktik

1991 års skattereform

Ekonomiska Rådets rapport till KUSK

...f._-j'...i_i I'l- [iw .”

.""? '.j'lu, '.,_,1.., i.!l,"':,'i'ell. ...å. .. .,. .. lil-ii" ,|H,I'”" "ft',—'i[,*,'.-—' *,.

iår., regel? .H.». utlagt. . er...-1 lll, ,ll'iei '.n" ::, .|- .

' l-

_, _ , —- rf ...en-..»... kalfjället; diao hour."

.'l'pt ......if'... . jr'a'r '. , ,: grn ignattniamå WL

' 'lii . i . . lur,. ,,' ,, ..f'if-"i " ”RW. '

... ,..-... .- . ",'. ,.'.=* .

Bilaga 2

Skattereformen 1990-1991: Effekter på skattesystemets driftskostnader, skatteplanering och skattefusk

Rapport till KUSK

av Håkan Malmer och Annika Persson

Håkan Malmer är anställd vid Skattemyndigheten i Malmöhus län. Han har tidigare medverkat i olika utredningar, bl.a. i Eko-kommissionen.

Annika Persson är anställd vid Riksskatteverket. Hon har tidigare arbetat i Finansdepartementet och medverkat i olika utredningar med koppling till skattefrågor.

InnehåH ] Inledning ....................................... 101 1.1 Bakgrund och sammanfattning ..................... 101 1.2 Enkla regler .................................. 102 1.3 Analysmodell ................................. 103 1.4 Attityder .................................... 106 2 Driftskostnadema för skattesystemet ................... 107 2.1 Inledning .................................. '. . 107 2.2 Administrativa kostnader ......................... 107 2.3 Skattereformen och svenska folket .................. 109 2.4 Skattereformen och företagen ..................... 113 2.5 Totala driftskostnader för skattesystemet ............. 121 3 Skatteplanering .................................. 124 3.1 Slutsatser beträffande skatteplanering ................ 124 3.2 Inledning .................................... 124 3.3 Lyckades skattereformen öka de formella skattesatsernas genomslag? .................................. 12 5 3.3.1 Vilken marginalskatt mötte höginkomsttagama under 1980-talet? .............................. 125 3.3.2 Simuleringsstudie av det formella skatteuttagets sammansättning ........................... 127 3.4 Skatteplanering _ definitioner och förutsättningar ...... 133 3.5 Skatterådgivama och skatteplaneringen .............. 135 3.5.1 Betydelsen av externa rådgivare ............... 135 3.5.2 Skatterådgivamas syn på skatteplaneringen före och efter skattereformen ........................ 137 4 Skattefusk ...................................... 143 4.1 Inledning och sammanfattning .................... 143 4.2 Kan man mäta skattefusket? ...................... 144 4.2.1 Allmänt om vad som fångas upp med olika måtmetoded44 4.2.2 Svart sektor baserat på hushållssektom .......... 146 4.2.3 Uppskattning utifrån individdata ............... 148 4.2.4 Momsfusket utifrån nationalräkenskapsdata ....... 149 4.2.5 Möjligheten att upptäcka skatteundandragande genom revision ................................ 150 4.3 Skattefusket såsom det avspeglar sig ibrottsstatistiken . . . . 151

4.4 Allmänhetens och rådgivarnas uppfattning om skattefusk och skattekontrollen .................... 156

1 Inledning

De fyra grundbultarna för det nya skattesystemet är lägre skattesatser, bredare skattebaser, mer neutral och likformig beskattning samt enklare regler. En klart uttryckt målsättning med skattereformen var att motverka skatteplanering och skatteflykt.

En av skattereformens me st betydelsefulla ändringar var moderniseringen av inkomstslagsindelningen och indelningen i förvärvskällor. Den allra viktigaste ändringen därvidlag var separatbeskattningen av inkomstslaget kapital. Färre inkomstslag och färre skatteprocentsatser har bidragit till att de enskilda bättre kan överblicka skattekonsekvenser av olika ändringar i sin ekonomi.

Skattereformen bygger på enhetliga och konsekventa principer Vilket har ökat skattereglernas logiska uppbyggnad och inbördes sammanhang vilket i sin tur underlättar förståelsen av regelverket.

Hur skattereformen har påverkat kostnaderna för skattesystemet hos skatteförvaltning och skattskyldiga samt hur reformen påverkat skatteplanering och skattefusk har behandlats i en separat rapportl. Här kommer resultaten att beskrivas översiktligt. Sammanfattningsviskan konstateras att skattereformen i alla fall till viss del levde upp till målen att skapa ett enklare system och att motverka skatteplanering.

Följande slutsatser har dragits:

' Skattereformen medförde lägre driftskostnader för skattesystemet totalt sett och har i den meningen lett till ett enklare skattesystem.

' Det är främst fysiska personer som fick det enklare att deklarera. ' Arbetsgivarna fick ökade kostnader till följd av skattereformen. Men

hade den enhetliga momssatsen som fanns 1991 bibehållits hade reformen sannolikt medfört lägre kostnader även i företagssektorn.

lMalmer H; Persson A; Tengblad Å. Århundradets skattereform. Effekter på skattesystemets driftskostnader, skatteplanering och skattefusk. 1994. Fritzes.

' Skattereformen medförde minskade möjligheter till skatteplanering och omfattningen på skatteplaneringen minskade.

' Skattereformen bedöms ha haft viss effekt på själva skattefusket i sänkande riktning. Nivån på skattefusket är det svårt att uttala sig om.

' Under 1980-talet fram till 1992 har nivån på skattefusket varit i stort sett oförändrad. Det finns möjligen tecken på ett ökat momsfusk under senare år.

Betydande förändringar har gjorts i skattesystemet efter skattereformen. Dessa har inte undersökts. En bedömning är emellertid att dessa ändringar i jämförelse med situationen omedelbart efter skattereformen har lett till ett mera komplicerat system och därmed till ett skattesystem med högre driftskostnader särskilt i företagssektorn. Alla förändringar torde också ha ökat incitamenten till skatteplanering. För vanliga löntagare bör det nya deklarationsförfarandet 1995 med en förtryckt "ifylld" deklarationsblankett innebära en förenkling.

Det finns flera samhällsekonomiska mål för ett skattesystem. Det Viktigaste är att finansiera samhällets utgifter av olika slag. Andra mål är att omfördela inkomst- och konsumtionsmöjligheter, att ge så små indirekta kostnader som möjligt till följd av snedvridningar i människornas och företagens val samt att vara förenligt med gällande rättsprinciper. Ett annat mål, slutligen, är kravet på enkelhet dvs. främst låga hanteringskostnader. Kravet på enkelhet är i regel underordnat andra samhällsekonomiska mål vilket medför att önskemålen av enkla och lättillämpade regler mången gång kommer i andra hand.

Givet de restriktioner som ges av målsättningarna i övrigt med skattesystemet är samhället inte betjänt av att människor och företag ägnar mer tid och resurser än nödvändigt på att skaffa information om skattesystem, planera sin ekonomi med hänsyn till reglerna (skatteplanering) och ställa samman uppgifter och lämna till skatte- myndighetema (skatteredovisning). Myndigheternas kostnader för att informera, administrera, kontrollera och beivra överträdelser av skatte- lagar bör inte heller vara större än nödvändigt.

Sett i det perspektivet kan man inte studera om skatteregler är enkla genom att läsa lagtexten eftersom belastningen på de skattskyldiga hänger samman med flera faktorer som inte låter sig enkelt isoleras.

' De materiella reglernas (beskattningsreglernas) utformning påverkar i vilken utsträckning de skattskyldiga kan förstå och tillämpa reglerna korrekt. ' Antalet regler att tillämpa. ' Hur ofta reglerna skall tillämpas. ' Hur uppgiftslämnandet från den skattskyldige till skatteförvaltningen är utformat dvs. redovisningsreglema i blanketter, möjligheterna att lämna data på ADB etc. ' Befintligt stöd i form av hjälpblanketter, anvisningar, broschyrer och service.

När man har att bedöma de sammanlagda effekterna av olika ändringar i administrativt hänseende dvs. om skattereformen totalt sett medfört ökad eller minskad belastning för de skattskyldiga måste också beaktas hur många skattskyldiga som över huvud taget är berörda av en bestämmelse. Det är uppenbart att det inte är möjligt att bedöma om en skattereform har lett till enklare regler genom att studera enbart regelverkets utformning. Den analysmodell som använts för att studera "enkelhet" framgår av bilden nedan.

1.3. Analysmodell

Skattesystemets driftskostnader finns på två håll, dels hos förvaltande myndigheter dels hos de skattskyldiga och tredje man som på annat sätt medverkar i beskattningen. Uttrycket administrationskostnader används enbart för att uttrycka kostnader i den offentliga sektorn. Kostnaderna hos skattskyldiga och tredje man benämns fullgörandekostnader.

1. Figur. Skattesystemets driftskostnader

Skattesystemets driftskostnader Administrativa kostnader Fullgörandekostnader "' departement * skattskyldiga "' myndigheter * tredje man Bruttokostnad Bruttokostnad Utgifter för: Utgifter för: * löner * löner * lokaler * lokaler * utrustning etc. * utrustning etc. Uppoftring av tid Psykologiska kostnader Nettokostnad Nettokostnad Bruttokostnad med Bruttokostnad med avdrag för: avdrag för: * kreditvinster genom att delta i * fördelari form av bättre uppbördssystemet statistikunderlag för andra ekonomiska beslut * fördelar i förrn av bättre underlag för ekonomiska beslut

Undersökningen har begränsats till att avse bruttokostnadema. En del slutsatser har emellertid kunnat dras om de psykologiska kostnaderna.

De nu nämnda kostnaderna bör för att öka förståelsen placeras in i ett ekonomiskt helhetsperspektiv på skattesystemets kostnader och intäkter. Figuren nedan illustrerar ett sådant ekonomiskt perspektiv på vårt skattesystem.

2. Figur. Ett ekonomiskt perspektiv på skattesystemet (Obs. Schematisk bild. Ytomas storlek ej proportionella mot beloppens storlek)

skatteundandragande, ej produktiv verksamhet (xx mdr kr) Uppbördsförlustar (ca 8 mdr kr)

Beskattnings— förluster Skan'elådus tel

Nettouppbdrd av skatt (ca. 700 mdr kr)

Skattesystemets driftskostnader

Semhållsekonomiska förluster (ineffektiv resursanvändning) xx mdr kr

Skattesys romer: kostnader

Skattesystemets kostnader består dels av administrativa kostnader hos förvaltande myndigheter dels fullgörandekostnader för de skattskyldiga och kan, som kommer att framgå av avsnitt 2, uppskattas till sammanlagt 14 mdr kr. Skatteplanering är en del av fullgörandekostnadema. Skattereformens effekter på skatteplaneringen tas upp i avsnitt 3. Det finns också en tredje kostnadspost som uppstår genom att skattesystemet snedvrider resursanvändningen och leder till ineffektiv resursanvändning. Storleken på denna kostnadspost är det svårt att uttala sig om, men ett av skattereformens främsta syften var att skapa ett utifrån denna synvinkel effektivare skattesystem.

Skatteförlusterna (överst i figuren) kan till vissa delar uppskattas. Uppbördsförlusterna uppkommer då fastställd skatt inte betalas och uppgår till 8 mdr kr. Skatteundandragandet på produktiv "legal" verksamhet ("svartjobb" m.m.) kan med Vissa beräkningstekniska förutsättningar uppskattas till 45 mdr kr. Skatteundandragandet i övrigt (på icke produktiv verksamhet) är det däremot svårt att bilda sig. någon uppfattning om. Skattefusket behandlas i avsnitt 4.

1.4. Attityder

Attityderna till skattesystemet och om det uppfattas som rättvist påverkar sannolikt de skattskyldigas inställning till att deklarera, skatteplanera och skattefuska. Attityderna är därför viktiga. Attityder till skattesystemet tillskapas i ett komplext samspel mellan flera faktorer.

Skattefusk och Skattemas storlek skatteplanering och fördelning

Attityder till skattesystemet

Skattemas/' användning inkl. administrationskostnader Fullgörandekostnader

Hur har då allmänheten uppfattat själva skattereformen?

3. Tabell: Anser Du att det var ett riktigt beslut att införa ett nytt skattesystem? Kalla: Åberg, R. Århundradets skattereform? Politik och opinion kring 1991 års skattereform

1992 september Ja 46% Nej 15% Vet ej 38%

Det är många som svarade "vet ej" när man i september 1992 frågade dem om det var ett riktigt beslut att införa ett nytt skattesystem. Andelen som svarat "ja" är dock tre gånger fler än de som svarat "nej". Andelen osäkra är stor.

RSV har undersökt allmänhetens attityder till' skattesystemet. Skatte- systemet är inte populärt men inställningen har ändrats markant i positiv riktning efter skattereformen (tabell 4). En bidragande förklaring till positivare attityder till skattesystemet torde vara att både allmänhet och Skatterådgivare anser att skatteplanering försvårats genom skattereformen.

4. Tabell: Vad tycker Du i stort om skattesystemet? Betyg: Mycket illa=l; varken bra eller illa=3; mycket bm=5

medelbetyg hösten 1986 2,3 hösten 1989 2,1

hösten 1992 2,8

2 Driftskostnaderna för skattesystemet

2.1. Inledning

Om en skattereform leder till enklare regler bör, om möjligt, bedömas utifrån om reformen har lett till lägre driftskostnader för samhället. Redan på ett tidigt stadium stod det klart att det i Sverige inte existerade några beräkningar av de skattskyldigas hanteringskostnader baserat på urvals- undersökningar för skattskyldiga. Före skattereformen baserades de få kalkyler som fanns på några få case-studies eller rena uppskattningar. För att råda bot på denna kunskapsbrist har utöver att beskriva skatte- reformens effekter gjorts ett försök att uppskatta driftskostnaderna för hela skattesystemet efter skattereformen.

Driftskostnaderna för skattesystemet totalt ca 14 mdr kr och hur skattereformen påverkat dessa redovisas i tre olika avsnitt enligt översikten nedan:

' A dm inistrativa kostnader 3 A dm.kostnad 4,6 mdrkr ' Skattereform en och svenska folket :Fullgörandekostnad 2,8 mdrkr ' Skattereformen och företagen 3 Fullgörandekostnad 6,5 mdrkr

2.2. Administrativa kostnader

Ett antal myndigheter av skilda slag samverkar med eller påverkas på annat sätt av beskattningsmyndigheternas verksamhet. Det gäller i första hand domstolar som har hand om skatteprocesser och andra myndigheter som har hand om brottsbekämpning m.m. De sammanlagda kostnaderna hos de myndigheter som förvaltar skattesystemet m.m. kan uppskattas till 4,7 mdr kr varav 85 procent ligger på skatteförvaltningen.

5. Tabell: Administrationskostnader efter skattereformen.

Belopp 1 mkr

Förvaltning etc Belopp A ndel Skatteförvaltningen 4 009 85% Tullväsendet 100 2% Kronofogdemyndighet 320 7% Förvaltningsdomstolar 175 4% Polisväsendet 45 1% Åklagarväsendet 30 l % Allmänna domstolar 27 1% Kriminalvård 15 0% Simuna 4 721 100%

Summan ovan som andel i procent av:

BNP 0,3% Offentlig konsumtion 1,2% Statlig konsumtion 4,0%

Av administrationskostnaden ligger 70 procent på inkomstskatten. Administrationskostnadema utgör ca 530 kr per invånare och 0,65 kr per hundralapp i skatt.

6. Tabell: Översikt administrationskostnadema för olika skatteslag år 1992

Samtliga myndigheter

per hundralapp mkr i skatt per skattskyldig

Inkomstskatt 3 284 1,03 kr 443 kr Arbetsgivaravgifter 486 0,25 kr 2 658 kr Moms

Punktskatterz)

') Per momsregistrerad ” Som administreras av RSV . Går ej att beräkna då det finns många tillfälliga skattskyldiga. Vad gäller punktskatter vid RSV exkl. tillfälliga skatter uppgår kostnaden per skattskyldig till 1 820 kr ') Avser kostnaden per invånare ” Skillnaden i kostnad mot föregående tabell beror på att administrationekostnadema för vissa mindre skatter inte tagits med i denna rkatteslagsuppdelade tabell (t.ex. arvs— och gåvorkatt)

Skattereformen medförde övergångsvis merkostnader för förvaltningen som totalt kan beräknas till 400 mkr. Skatteförvaltningen fick en anslagsökning på 100 mkr som behövdes för RSV:s insatser främst avseende ADB och framtagande av nytt informationsmaterial/nya blanketter. I samband med skattereformen omprioriterades förvaltningens

resurser från kontroll till information och service eftersom tillskottet av resurser till skatteförvaltningen endast täckte del av övergångs- kostnaderna; det innebär att deklarationsgranskningen fick bedrivas med lägre ambitioner och att revisionsfrekvensen temporärt minskades. Detta innebär att skattereformen övergångsvis medfört vissa dolda kostnader i form av skatteförluster som inte kan direkt preciseras.

Det är svårt att mäta de långsiktiga och bestående effekterna av skattereformen för skatteförvaltningen. Granskningen av löntagar- deklarationema har förenklats medan skattereformen inom andra områden har medfört nya och delvis mer komplicerade regler. Skattereformen har dock haft övervägande positiva effekter för skatteförvaltningen. Några rationaliseringsvinster är det dock inte fråga om.

2.3. Skattereformen och svenska folket

Med "svenska folket" avses i detta sammanhang huvuddelen av befolkningen som enligt de rutiner som gällde t.o.m. 1994 — deklarerade i månaderna februari/mars (93 procent av alla inkomstdeklarationer). Redogörelsen bygger i stor utsträckning på RSV:s deklarationsundersökningar.

Observera att inkomsterna för 1991 taxeras år 1992. Detta innebär att taxeringsåret 1992 är det första året som man har att tillämpa skattereformens nya regler i sin deklarationsblankett.

De flesta anser att det varken blivit lättare eller svårare att deklarera efter skattereformen. Men det är fyra gånger så många som tycker att det blivit lättare än de som tycker att det blivit svårare.

Svenska folket Lättare eller svårare att deklarera etter

, .

10%

10% ååå; - M 0% " ' iMycket/något lättare Varken/eller Något/mycket svårare

En rad iakttagelser ger stöd för slutsatsen att det faktiskt blivit enklare efter skattereformen. Jämförelserna nedan avser taxeringsåret 1989 jämfört med taxeringsåret 1993 när man deklarerade med de nya reglerna för andra gången och således hade fått viss vana ("inlärning") av de nya reglerna och blanketterna.

- Fler kunde använda den förenklade självdeklarationen en ökning från 50 till 58% .

En klart högre andel av de som lämnat deklaration deklarerar helt på egen hand efter reformen (47—>56%) och färre har haft experthjälp (22—>15%).

- Skatteuträkningen har också blivit enklare. En större andel räknar också ut skatten själv efter skattereformen (andelen varierade åren 1987—1989 mellan 43 til 50%; 1993 är andelen 55%), En enkel illustration av hur skattereformen påverkat skatteberäkningen ges också av att antalet rutor på skatteuträkningsbilagan i "Dags att deklarera" för förenklad självdeklaration för makar gemensamt minskat från maximalt 125 till 61 st.

- Tidsåtgången och utgifterna för att deklarera minskade. Minskningen — förenklingen kan baserat på vissa antaganden (se nedan) värderas till 800 mkr eller 20 procent av fullgörandekostnadema.

Eftersom det inte fanns några undersökningar av fullgörandekostnaderna för svenska folket före skattereformen ombads de intervjuade att jämföra nedlagd tid och kostnader i samband med deklarationsarbetet år 1992 med året före skattereformen.

8. Tabell: Tidsåtgång vid deklaration tinningen 1992 jämfört med föregående år Kulla: RSV] deklarationsunderrokning 1992

Bas: Intervjuade rom har lämnat deklaration. Svari procent.

Samtliga Deklarerat på Pensionärer

deklaranter egen hand egen hand Mindre tid 26 33 21 Lika mycket tid 50 47 52 Mer tid 16 19 15 Deklarerade inte förra året 2 1 0 Vet ej 7 1 12

Fastän skattereformen innebar många nyheter för de skattskyldiga är det fler intervjuade som uppger att man la ner mindre tid än som uppgivit mera tid.

Det påföljande året (1993 års taxering) — när man lärt sig nya regler och blanketter —— har tid och utgifter för att deklarera minskat en inlärningseffekt. Tidsåtgången har minskat från i genomsnitt 2tim 21min till 1tim 42min. Utgiftsminskningen är mera marginell.

9. Tabell: Tid för att deklarera efter skatterefomien Kan Du uppskatta hur lång tid Du själv la ner på deklarationen i år, dvs att samla ihop uppgifter, skaffa blanketten läsa broschyrer, fylla i blanketter och räl-ma ut skatten?

Blankett Tid [ tim och min: Alla Man Kvinna 16—34 år 3.5—64 år 65—74 år FD AD Genomsnitt år 1992 2,21 3,05 1,33 1,33 2,49 2,34 1,16 3,51 Genomsnitt år 1993 1,42 1,48 1,36 1,09 1,48 2,31 1,08 2,31

Om man antar att tiden för att deklarera inte ändrats alls (jämför tabell 8) mellan 1991 och 1992 kan beräknas den minskning i nedlagd tid som inträffat i samband med skattereformen. Den sammanlagda minskningen av tid och utgifter kan kalkyleras och uttryckas i pengar. Två beräkningar har gjorts. I den ena värderas tiden till en normallön inklusive socialavgifter. Den andra baseras på normallön netto efter genomsnittslig skatt.

10. Tabell: Minskade fullgörandekostnader efter skatterefomien för svenska folket Belopp i mkr

Kalla: RSV:s deklmtiomundersokningar

Tid i års- Brutto”; inkl. Netto”; efter

arbetskrcfter socialavgifter skatt (35%)

Totalt 1992 13 700 3 570 2 290 Totalt 1993 9 700 2 760 1 830 Förändring -4 000 -810 -460

varav tid -730 —390

varav kostnad -70 -70 Förändring i procent -29% -23% -20% Minskade fullgörandekostnader ca 800 mkr drygt 450 mkr 105 lir/tim :) 52 kr/lim

Sammanfattningsvis ger undersökningarna vid handen att det blivit enklare att deklarera och räkna ut skatten för huvuddelen av befolkningen. Förenklingen kan baserat på vissa antaganden värderas till 800 mkr. Värderingen i kr beror på vilken värdering av tiden som används. Oberoende av vilken värdering man utgår från indikerar resultatet på "en förenkling" kring 20 procent mått som minskade fullgörandekostnader.

När man beräknar fullgörandekostnadema är det lätt att förbise att de skattskyldiga hjälper varandra med att fylla i deklarationsblanketten. Nära en tredjedel hjälper andra att deklarera och år 1993 lade dessa personer i genomsnitt ner 2 tim 45 min på att hjälpa andra. Det betyder att den totala arbetsinsatsen för hjälp åt andra uppgår till hälften av tiden för alla att göra sin egen deklaration.

Ett annat intressant resultat kan vara värt att nämna. 1993 tillfrågades de skattskyldiga som själv gjort sin deklaration: "Om Du kunde begära ersättning för jobbet med Din deklaration vad anser Du då skulle vara skäligt att ta betalt för det?" Svaret på denna fråga visar att den begärda ersättningen genomsnittligt sett uppgår till mycket högre belopp än vad en ren värdering av tidsåtgång och direkta kontanta utgifter summerar till. Den närmast till hands liggande förklaringen är att deklarationsarbetet innehåller psykologiska moment som upplevs som belastande. Detta ger en fingervisning om att ytterligare förenklingar av deklarationsarbetet är önskvärda sett ur deklarantens synvinkel. Särskilt stora förefaller de psykologiska kostnaderna vara för de som deklarerat försäljning av värdepapper. En slutsats är därför att man vid den slutliga utformningen

av skattereformen inte lyckats förenkla realisationsvinstbeskattningen vad gäller värdepapper.

Baserat på uppgifterna ovan och en analys av för hur många skattskyldiga som undersökningen har relevans för, har gjorts en kalkyl av fullgörandekostnaden för "svenska folket". Resultatet visar att fullgörandekostnaden för svenska folket uppgår till 2,8 mdr kr (inkl. sociala avgifter).

11. Tabell: Svenska folkets tid och kostnader för att deklarera inkomstskatt år 1993

Tabellen inkluderar inte de mer komplicerade deklarationema, framrt näringsverksamhet Kalla: RSV:s deklmtionxunderrokning 1993 och RSV:s antalrstatistik för 1992 års taxering

Tid uttryckt Värde, mkr, brutto Värde, mkr,

i antal års— inkl. skatt och netto

arbetskraner” arbetsgivovg. ]) efter skatt

Tidsåtgång för den egna deklarationen 6 467 1 222 605 Tidsåtgång gör att hjälpa andra 3 222 609 302 Summa för tidsåtgång 9 689 1 831 907 Tillkommer direkta utgiher 927 927 Total kostnad för medverkan 2 758 1 834 Dzo per deklarant (genomsnitt) i kronor 413 275

') 1800 timmar per år " lön 105 kr/tim (80 kr + socialavgifier) 52 kr/tim (so kr/tim - 35% skatt)

2.4. Skattereformen och företagen

Företagens fullgörandeko stnader uppgår efter skattereformen till totalt 6,5 mdr kr fördelat på följande delaktiviteter:

a) anställdas skatter och avgifter 1,2 mdr kr b) momshanteringen 3,2 mdr kr 0) inkomstdeklarationen 1,8 mdr kr (1) annan tredjemansmedverkan 0,3 mdr kr

Hur skattereformen påverkat fullgörandet samt fullgörandekostnademas storlek och karaktär inom vart och ett av dessa delområden redovisas nedan.

Skattereform ens inverkan

Företagen anser rent generellt att redovisningsrutinerna är bra när det gäller moms samt arbetsgivaravgifter och preliminärskatt. När det gäller inkomstskatten är man mer tveksam.

Fyra av fem företag uppger att de övergångsvis fått merarbete eller merkostnader till följd av skattereformen. Större företag och offentliga arbetsgivare svarade att övergångsvis har främst arbetet med uppbördsdeklaration och kontrolluppgifter varit belastande. De som yrkesmässigt bistår med redovisning och revision utpekar i stället arbetet med den allmänna självdeklarationen.

l fram tiden då företagen klarat av de övergångsvisa omställningsproblemen bedöms arbetet med inkomstdeklaration, uppbördsdeklaration och kontrolluppgifter ge något ökad belastning (bli svårare; se diagram nedan). Ökningen är dock marginell utom för stat och kommun som anser att de får ökad belastning vad gäller uppbördsdeklaration och kontrolluppgifter. Skälet härtill är det faktum att statliga och kommunala arbetsgivare, till följd av skattereformen, fick samma skyldigheter och regler att tillämpa som andra skattskyldiga och uppgiftslämnare.

12. Diagram:

lättare eller svårare med olika redovisningsområden i framtiden Betyg Betyg

Uppbå'drdeldaration/ Mamsdeklaratian Inkarmtdeklaratiai kontrolluppgift

När det gäller uppbördsdekImation/kontrolluppgift är redovisning av traktamenten och kost under tjänsteresa utan jämförelse de två områden som utpekas medföra ökad belastning i framtiden. Bilersättning är ett annat område. Övriga områden nämns av färre men det torde främst bero på att de är mindre ofta förekommande. Kost under tjänsteresa är det område som alla grupper svarande menar blir svårt framöver. Noteras kan

att offentliga arbetsgivare genomgående anser att det är "svårt" att redovisa förmåner och kostnadsersättningar, vilket dock inte är så underligt med tanke på att de inte hade sådan skyldighet tidigare.

När det gäller moms anser de flesta att det varken blir lättare eller svårare i framtiden. Man bör lägga märke till att frågan inkluderade de förändringar vad gäller reducerad moms på mat, resor och turism som redan trätt ikraft vid undersökningstillfället. (I samband med skattereformen beslutades om en enhetlig momsskattesats; denna fanns under ett år). Offentliga myndigheter var de enda för vilka man kan notera att det blev något svårare. Detta är inte heller särskilt förvånande eftersom deras momsredovisningsskyldighet ändrades kraftigt i samband med skattereformen.

När det gäller redovisningen i inkomstdeklarationen för företag eller företagsägare får den allmänna självdeklarationen godkänt. Räkenskapsschemat bedöms inte heller vålla stora problem utan de främsta orsakerna till att man anser att det blir svårare i framtiden är reglerna om skatteutjämningsreserv (SURV) och uppskovsbelopp samt reglerna om överutdelning och sparad utdelning. RSV har särskilt undersökt (genom ett slumpmässigt urval) hur de skattskyldiga klarat av att hantera systemet med SURV och sparad utdelning. Undersökningarna visade på många saknade och felaktiga uppgifter i deklarationerna. Det måste bedömas som tveksamt att ha regler som medför så många felaktiga och utelämnade uppgifter. (Reglerna om SURV har senare tagits bort och ersatts med ett system med periodiseringsfonder).

A nställdas skatter och avgifter

Vad gäller företagens kostnader för att hantera de anställdas skatter och avgifter baseras slutsatserna på en särskild enkätundersökning. Företag i tre storleksklasser har undersökts nämligen små företag (5—9 anställda), medelstora företag (10-50 anställda) och stora företag (50-499 anställda). Den genomförda undersökningen omfattade sålunda endast företag i storleksklassen 5-499 anställda.

Vid hanteringen av anställdas skatter och avgifter kan man urskilja tre skilda arbetsmoment:

1. den löpande beräkningen av underlaget för de anställdas preliminärskatt och socialavgifter i samband med utbetalning av lön och redovisning i uppbördsdeklaration (månatligen)

2. upprättandet av kontrolluppgifter och kontrolluppgiftssammandrag vid årets slut

3. avdrag (januari-mars) och redovisning (april) av kvarskatt för anställda

Kostnaderna för hanteringen av anställdas skatter och avgifter uppgår för dessa arbetsmoment för den undersökta gruppen företag till i genomsnitt 12 tkr per år eller 226 kr/anställd (tiden värderad till 125 kr/tim). Kostnaderna ökar med tilltagande företagsstorlek, men räknat per anställd har de små företagen väsentligt högre kostnader. Som framgår av diagrammet nedan är kostnaderna regressiva.

13. Diagram: Kostnaden för hantering av anställdas skatter och avgifter per anställd och per mkr i omsättning Storlek 1: Undersökta företag med 5-9 anställda resp. med upp till H) mkri omsättning

Storlek 2: Undersöka företag med 10-49 anställda resp med ll-40 mkr i omsättning Storlek 3: Undersöka företag med 50499 anställda resp. med över 41 mkr i omsättning

Kronor N O o o t

0 1 i | | Minsta Storlek 1 Storlek 2 Storlek 3 Största

j _'— anställda _D— omsättning

Detta diagram har också använts som utgångspunkt för att skatta kostnaderna för de största företagen (mer än 500 anställda) och kostnaderna för offentlig sektor när det gäller hanteringen av anställdas skatter och arbetsgivaravgifter varvid hänsyn tagits till dels stordriftsfördelar och — vad gäller offentlig sektor väsentligt lägre antal förmåner av olika slag. För de minsta företagen (1-4 anställda) baseras uppskattningen av kostnaderna (2000 kr/anställd) på en analys av de arbetsmoment som undersökningen omfattar och uppgifter från redovisningsexpertis (Sveriges Redovisningskonsulters Förbund).

14. Tabell: Fullgörandekostnad för hanteringen av anställdas skatter och avgifter Källa: SCB centrala företagr- och arbebstalleregistren. SAMU-92 nov.version.

A ntal Fullgörandekostnad

företag och A ntal per per myndigheter anställda anställd (kr) totalt (mkr) företag (tkr) 476 4

A rbetsgivare

1-4 anställda 125 394 237 935 2 000 5-9 anställda 28 083 182 133 1 265 230 8 10-49 anställda 22 278 434 926 530 231 10 50-499 anställda 4 562 573 982 123 71 16 500- anställda 487 771 754 86 66 136 Offentligt anställda 2 068 1 398 021 69 96 46 Sunmla 182 872 3 598 751 298 1 170 6

Som framgår av tabellen kan företagens fullgörandekostnad för anställdas skatter och avgifter beräknas till 1,2 mdr kr och två tredjedelar av kostnaden ligger på företag med mindre än 10 anställda. Den genomsnittliga kostnaden per arbetsgivare är ca 6400 kr. Räntevinsten för arbetsgivarna (kalkylränta 10%) som deltar i skatteuppbörden uppgick med den kredittid som gällde vid kartläggningstillfället till 1,4 mdr krz. Offentliga arbetsgivare och företag med fler än 10 anställda utgör 16 procent av antalet företag men har 88 procent av antalet anställda. Detta innebär att dessa arbetsgivare har räntevinster som med bred marginal överstiger deras fullgörandekostnad.

Vid sidan av arbetsgivarna finns även andra som lämnar information s.k. tredjemansmedverkan. Det handlar om 23 miljoner uppgifter (räntor, utdelningar, pensioner etc.) som lämnas till skattemyndighetema av t.ex. banker, försäkringsbolag och Riksförsäkringsverket. Beträffande kostnaderna för detta uppgiftslämnande har inga undersökningar gjorts. Uppskattningen av kostnaderna för olika typer av uppgiftslämnande utgår från de kostnaderna som stora företag har haft för kontroll- uppgiftslämnande inkl. kontrolluppgiftssammandrag och har beräknats uppgå till 0,3 mdr kr.

ZKredittiden har förkortats med 8 dagar fr.o.m. 1995. Detta innebär ett räntevinsten minskar till 1,1 mdr kr.

Mervärdesskatt

Vad gäller företagens kostnader för momshanteringen baseras slutsatserna på en särskild enkätundersökning. Företag i tre storleksklasser har undersökts nämligen små företag (5-9 anställda), medelstora företag (10— 50 anställda) och stora företag (SO-499 anställda). Den genomförda undersökningen omfattade sålunda endast företag i storleksklassen 5-499 anställda.

I företagens momshantering kan man urskilja två arbetsmoment nämligen ]. löpande momshantering vid kontering av verifikationer etc. 2. upprättande av momsdeklarationer.

Spridningen är tämligen stor vad gäller antalet nedlagda timmar för löpande momshantering och uppgår i genomsnitt till 183 timmar per år för de undersökta företagen. Ju större företaget är desto fler timmar har det gått åt. Tidsåtgången är dock inte proportionell mot företagsstorleken hur man än mäter.

När det gäller tiden för arbetet med momsdeklarationema kan noteras att det knappast alls är någon skillnad mellan företagen i nedlagd tid. Företagen har med andra ord i denna del ungefär lika stora fullgörandekostnader oavsett storlek i genomsnitt 20 timmar per år.

Till tidskostnaden skall läggas vissa kostnader för extern hjälp — i snitt ca 1800 kr. De totala kostnaderna för momshanteringen genomsnittligt sett för hela den undersökta gruppen företag uppgår till ca 27 tkr per år eller 524kr/anställd. Kostnaderna stiger med ökande företagsstorlek, men räknat per anställd har små företag väsentligt högre kostnader kostnaderna är kraftigt regressiva (se diagram nedan).

En intressant iakttagelse, som kom som något av en överraskning, var relationen mellan företagens kostnader för moms och kostnaden för anställdas skatter och avgifter fullgörandekostnaden för moms är mer än dubbelt så stor som kostnaden för anställdas skatter och avgifter.

15. Diagram: Kostnaden för hantering av mervärdesskatt per anställd och per mkri om— sättning

Storlek ]: Underrökta företag med 5-9 anställda resp. med upp till 10 mkri omsättning Storlek 2: Undersökta företag med 10—49 anställda resp med 11-40 mkr i omsättning Storlek ?: Undersökta företag med 50-499 anställda resp. med över 41 mkri områttning

4000 3 500 — 3000 — 2 500 T

2000

Kronor

1500— 10001-

500

0 1 1 l 1 t

Minsta Storlek 1 Storlek 2 Storlek 3 Största

_'— anställda _D— omsättning

Detta diagram har också använts som utgångspunkt för att skatta kostnaderna för de största företagen (mer än 500 anställda) och kostnaderna för offentlig sektor varvid hänsyn tagits till dels stordriftsfördelar och vad gäller offentlig sektor väsentligt lägre antal momstransaktioner. För de minsta företagen (1-4 anställda) baseras uppskattningen av kostnaderna (4000 kr/företag) på en analys av de arbetsmoment som undersökningen omfattar och uppgifter från redovisningsexpertis (Sveriges Redovisningskonsulters Förbund).

Även de allra minsta företagen betalar moms som en följd av skattereformen. Den administrativa lösningen blev att låta dessa lämna sin momsredovisning i inkomstdeklarationen. Med hänsyn till det stora antalet företag det rör sig om kan man uppskatta att företagens fullgörandekostnad vad gäller moms skulle blivit nästan 1 miljard kronor högre om man inte i samband med skattereformen valt systemet med redovisning i inkomstdeklarationen för de minsta företagen.

16. Tabell: Fullgörandekostnaden för hanteringen av mervärdesskatt Källa: SCB centrala företags- och arbetsställeregiltren. SAMU-92 nov.venion samt RSV:s momrregister

A nlal F ullgörandekostnad

företag och per totalt per anställd (kr) (mkr) företag (tkr) 4

Registrerade A ntal

till moms myndigheter anställda

0-4 anställda” 369 822 237 935 1 479 5-9 anställda 28 083 182 133 3 125 569 20 10-49 anställda 22 278 434 926 1 141 496 22 50-499 anställda 4 562 573 982 295 169 37 500- anställda 487 771 754 207 159 327 Offentligt anställda 2 068 1 398 021 165 231 112 Delsumma 427 300 3 598 751 863 3 104 7 Oregistrerade till moms ( 0,2 mkr” 280 000 -- 140 0,5 Totalsrmuna 707 000 3 244

l) Kostnaden för denna grupp uppskattas till 4 000 kr per företag 2) Företag med mindre än 200 tkr antas redovisa i inkomstdeklaration och ha 100 tkr i omsättning Kostnaden för den löpande momshanteringen per företag har uppskattats till 0,1'5 tkr = 500 kr

Som framgår av tabellen kan företagens fullgörandekostnad för moms beräknas till 3,2 mdr kr. Räntevinsterna för de skattskyldiga på grund av kredittiderna i momsuppbörden (10% kalkylränta) uppgår till 2,8 mdr kr. Emellertid svarar 4 procent av företagen (i stort sett de med mer än 10 anställda) för ca 74 procent av inbetald mervärdesskatt. Detta innebär att räntevinsterna i genomsnitt är mer än dubbelt så stora som dessa företags fullgörandekostnad. Slutsatsen är att det är de små företagen som får bära nettot av fullgörandekostnaderna för moms.

Företagens och företagarnas inkomstdeklaration

Fullgörandekostnaderna vid inkomsttaxeringen kan för juridiska personer och för fysiska personer med svårare deklarationer (i första hand egenföretagare med anstånd att lämna deklaration) beräknas till totalt 1,8 mdr kr. Uppgifterna baserar sig på två enkätundersökningar en enkätundersökning till personer som yrkesmässigt sysslar med skatteredovisning ("skatteredovisningsenkäten") och en till företag med fler än 50 anställda.

17. Tabell. Mgörandekostnad för inkomstdeklarationen hos företag/företagare.

Fullgörandekostnad

per företag totalt ( Ik r) ( m kr)

Kategori

Antal

Fysiska personer med svårare deklarationer” 325 000 2,0 650 Juridiska personer med färre än 50 anställda" 326 000 3,3 1 075 Juridiska personer med fler än 50 anställda” 5 042 6,7 34 Summa 656 042 1759

Genomsnittskostnaden baseras på uppgifter om arvoden för olika typfall erdigt rkatteredovrrningrenkäten Genomsnittskosmaden baseras på företagens egna uppgifter om nedlagd tid (värderad till 125 ler/tim) och utgifter enligt skatteredovisningsenkilten

2.5. Totala driftskostnader för skattesystemet

Totalkostnaderna för skattesystemet för skattemyndigheter m.m. (administrativa kostnaderna) och för de skattskyldiga (fullgörande- kostnaderna) uppgår, med de beräkningsförutsättningar som beskrivits ovan, till 14 mdr kr vilket motsvarar 1 procent av BNP. Kostnaden utgör 1600 kr per invånare och 2 kr per hundralapp i skatt.

18. Tabell: Totalkostnader för skatter och avgifter fördelade på skatteslag Belopp i mkr

A dm inistrations- Fullgärande- Per hundra- Per skatt— Skatteslag kostnad kostnad Summa A ndel lapp i skatt skyldig Inkomstskatt 3 284 5 3991) 8 683 62% 2,73 kr 1 171 kr Arbetsgivuavgiher 486 585 1 071 8% 0,55 kr 5 857 kr Moms 784 3 244 4 028 29% 3,11 kr 9 100 kr” Punktskatter” 58 60 118 1% 0,19 kr ”

4 612 9 288 13 900 100% 1,97 kr 1 599 kr”

Andel av totalsumman 34% 66% 100%

Summan ovan som andel iprocent av BNP utgår 1,0 % Summan ovan utgör 2,0 % av skatteintäkterna

Fullgårandekostnad/A dm inistrationskostnad är Z."!

l)1 summan ingår kostnad för preliminärskatt 585 mkr + annan 3:e mansmedverkan 297 mkr Per momsregistrerad Som administreras av RSV ') Går ej att beräkna då det finns många tillfälliga skattskyldiga ” Avser kostnaden per invånare

3 Dock är vissa av kostnaderna att karaktärisera som arbete i hemmet och värdet ingår därför inte i BNP.

Inkomstskatten drar 62 procent av totalkostnadema och momsen 29 procent. Om kostnaden ställs i relation till skatteintäkten är momsen dyrast av de stora skatterna. Det understryker betydelsen av enkla momsregler och få skatteprocentsatser.

19. Diagram: Skattesystemets driftskostnader totalt 14 mdrkr fördelade på skatteslag

Belopp 1 kronor

0,1 mdr

Inkomstskatt

:l Arbetsgivaravgifter

[: Moms

8'7 mdr & Punktskatter

Fullgörandekostnaderna är dubbelt så stora som administrationskost- naderna. Diagrammet visar att skillnaden mellan fullgörandekostnad och administrativ kostnad är störst för momsen.

20. Diagram: Driftskostnader per hundralapp i skatt

3,50 3,00 2,50 2,00 1,50 1,00 0,50 0,00

kronor

Inkomstskatt Arbetsgivar- Moms Punktskatter Alla skatter avgifter

I Administrationskosmader Firlkgörarrdekosmader

Beräkningarna ovan inkluderar inte räntevinster och andra positiva effekter som företagen/arbetsgivare har genom att delta i skattesystemet.

Men beräkningarna tar inte heller hänsyn till psykologiska kostnader hos de skattskyldiga som av allt att döma i vissa fall är ganska stora.

Beräkningarna av totala driftskostnaderna är i första hand känsliga för vilken timkostnad man använder i kalkylerna över fullgörandekost- nadema.

I kalkylerna över fullgörandekostnaderna för vanliga fysiska personer har använts normal timlön 105 kr inkl. socialavgifter. När det gäller arbetsgivare/momsregistrerade företag har tillämpats 125 kr/tim. Det använda kostnadsbeloppet är närmast en särkostnad. Om alla gemensam- ma kostnader ( t.ex. frånvaro, arbetsledning, lokaler, expenser, ADB) skulle medräknas år det fråga om väsentligt högre belopp. Om man istället antar att timkostnaden för företagen är 250 kr medför detta att fullgörandekostnaderna ökar med 4,5 mdr kr (från 9,3 till 13,8 mdr kr) och relationen mellan fullgörandekostnad och administrationskostnad blir 321 istället för 211.

Skattereformen har haft övervägande positiva effekter på administrations- kostnaderna inom skatteförvaltningen. Vanliga deklaranter bedöms ha fått relativt stora sänkningar av sina fullgörandekostnader. Kostnadsökningar finns för företag och arbetsgivare främst inom offentlig sektor. Men om skattereformens enhetliga moms bibehållits är det sannolikt att skattere- formen totalt sett skulle inneburit en förenkling även för företag/arbets- givare. En sammanfattande slutsats är därför att skattereformen lett till lägre driftskostnader för skattesystemet totalt sett.

3 Skatteplanering

Sammanfattningsvis dras här följande slutsatser.

Andelen lågredovisare ("nolltaxerare") har minskat högst avsevärt bland höginkomsttagama. De har kraftigt minskat sina skulder. Den skatt höginkomsttagama betalar på sin arbetsinkomst efter skattereformen svarar i högre grad mot den formella skattesatsen jämfört med före reformen. Skatten på arbetsinkomster har sänkts jämfört med boendet och annat som skattesystemet tidigare subventionerade.

Baserat bl.a. på en enkät till Skatterådgivare görs bedömningen att skattereformen har minskat möjligheterna och omfattningen på skatteplanering genom lägre lönsamhet på sådana transaktioner främst genom sänkta marginalskatter, likformigare beskattning av olika inkomster och genom att kapitalinkomster beskattas separat och proportionellt.

Därutöver har en minskning av skatterådgivningen skett till följd av lågkonjunkturen.

Undersökningarna täcker i första hand utvecklingen t.o.m. år 1992. Utvecklingen på omfattningen av skatteplaneringen åren därefter är det svårt att uttala sig om. Skattesystemet har dessutom ändrats i flera viktiga hänseenden efter skattereformen.

3.2 Inledning

Under 1980-talet växte det fram en ökad insikt om att höga marginalskat- ter hade samhällsekonomiskt skadliga effekter t.ex. på löne- och kapital- bildning. Olika studier visade också att främst skattskyldiga med höga marginalskatter på olika sätt anpassade sig så att den faktiska skatt man betalade var lägre än vad de formella skattesatserna gav uttryck för. Det finns flera förklaringar till att det blev så. Av stor betydelse var be- skattningen av boendet som var skattemässigt gynnat. En annan viktig faktor var att skattesystemet utnyttjades för olika former av skatte- planering.

Ett uttalat syfte med skattereformen var att nå. större likformighet och horisontell rättvisa i individbeskattningen i meningen att "lika skulle beskattas lika". Skattereformen skulle motverka skatteplanering.

Detta kapitel disponeras på följande sätt. Först redovisas resultatet av en undersökning där den skatt hö ginkomsttagarna faktiskt betalt jämförs med

den skatt de skulle betalt om de endast haft sin arbetsinkomst. Genom en analys av skillnaden dras vissa slutsatser om hur ändrade skattesatser m.m. påverkat det ekonomiska handlandet. Beskrivningen ger indirekt en uppfattning om skattesystemets roll när det gäller att uppmuntra olika beteenden — beteenden som i en del fall kan ha karaktär av skatteplanering.

Därefter behandlas skatteplaneringen. Begreppen definieras och förutsättningama för skatteplanering behandlas.

Den betydelse externa rådgivare har för skatteplaneringen uppmärksammas samt rådgivamas syn på skatteplaneringen före och efter skattereformen. Slutligen berörs frågan om skattereformen påverkat efterfrågan på skatterådgivningstjänster.

3.3 Lyckades skattereformen öka de formella skattesatsemas genomslag?

Syftet med beskrivningen nedan är att försöka belysa hur det faktiska skatteuttaget förändrats i förhållande till de formella skattesatser som finns uttryckta i lagstiftningen före och efter skattereformen och vad eventuella differenser beror på.

3.3.1 Vilken marginalskatt mötte höginkomsttagama under 1980-talet?

De formella marginalskattesatserna vid högre inkomstnivåer uppgick under första hälften av 1980-talet till 80 a 85 procent. De högsta marginalskattema utgick vid inkomster kring 500 000 kr räknat i 1990 års penningvärde. Men som framgår av diagrammet nedan låg inkomst- tagama redan vid inkomster kring 300 000 kr mycket nära dessa högsta marginalskattesatser.

21. Diagram: Malginalskatt för inkomsttagare med en beskattningsbar inkomst om 500 000 kr, 300 000 kr resp 150 000 kr (uttryckt i 1990 års pemiingvärde)

500.000 kr

80 _0_ 70 få 60 .......390.-.009.kf... % 50 ;. 150.000 kr 5 30 . .. .. _ .. _ . |:

20

10

0 | + i 4 i | F t o t 4. 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992

T.o.m. år 1990 träffade marginalskatten alla inkomster. Genom skattere- formens separatbeskattning av inkomstslaget kapital uppkom olika marginalskatter på förvärvsinkomster och kapitalinkomster. Diagrammet ovan visar fr.o.m. år 1991 marginalskatten på förvärvsinkomst.

Normalt sparande gav negativ real avkastning samtidigt som nettokost- naderna för skuldräntor efter skatt blev små (se diagram nedan). Skattenedsättningen vid underskott i kapital ledde till att inkomsttagarna i de övre lägena i början av 1980-talet endast behövde stå för 15% av kostnaderna för sina kapitalunderskott. Den verkliga kostnaden var ännu lägre eftersom hög inflation hjälpte till att "amortera" skulderna realt sett.

De problem som var förknippade med det gamla skattesystemet gällde i första hand beskattningen av sparandet och underskottsavdragens värde. Under större delen av 1980-talet fanns en ganska klar uppfattning om att skattesystemet missgynnade sparande på bank och gynnade låntagande. Debatten om "nolltaxerare" fäste uppmärksamheten på underskottsav- dragens värde främst för höginkomsttagare och i skattesystemet vidtogs olika åtgärder för att minska värdet av dessa avdrag. För att mildra beskattningen på sparande, främst för folk med måttligt sparande, infördes vissa former av skattegynnat sparande. Sett ur dagens perspektiv är det uppenbart att beskattningen av kapital redan i början av 1980-talet inte passade in i ett beskattningssystem med höga marginalskatter.

Nedanstående diagram visar den maximala marginalskatten som träffade ett överskott respektive den reduktion som gavs för ett underskott t.ex. i inkomstslaget kapital.

22. Diagram: Marghralskatt/skattenedsätining för höginkomsttagare vid överiunderskotti inkomstslaget quilal inkomståren 1978-1992

sparskattereduktion införs allemmupar inför:

100

1 maximal mlrginalskntt vid kapitalöverskott

/

skattereformen

rlntuvdragens vlrd: begrlnnr

ta o

maximal Skattenedsluning vid kapitalunderskott

wmmwmrmm I %

efter skattereformen

(] | * | ——| | | | | | | | 4 |

1978197919801981 19821983198419851986198719881989199019911992 Inkomstir

Redan inkomståret 1979 infördes en sparskattereduktion på belopp som nysparades på särskilt s.k. skattespar- eller fondsparkonto, Denna spar- form avvecklades i samband med tillkomsten av det skattefria alle- manssparandet i juli 1984. Det första steget i att reducera värdet av underskottsavdrag (t.ex. i inkomstslaget kapital) togs 1983 då ett system med grundbelopp och tilläggsbelopp infördesi den statliga beskattningen. Ett överskott beskattades med summan av de tre skattesatserna kommu- nalskatt+grundbelopp+ti11äggsbelopp för det aktuella inkomstläget medan den skattemässiga nedsättningen för ett underskott bara motsvarade summan av kommunalskattesatsen och grundbeloppet. Under påföljande år reducerades värdet av underskott dels genom sänkta marginalskatter men också genom att omfördela det statliga skatteuttaget i de övre in— komstskikten från grundbelopp till tilläggsbelopp.

Redan 1985 hade värdet av ränteavdragen reducerats till 50 procent. Denna nivå låg kvar t.o.m. 1988 varefter en successiv nedtrappning skedde till de 30 procent som gäller efter skattereformen (1991).

3.3.2 Simuleringsstudie av det formella skatteuttagets sammansättning

Av särskilt intresse då man studerar hur de formella skattesatserna slagit igenom är de individer som har höga arbetsinkomster. I syfte att belysa hur de formella skattesatserna i individbeskattningen slagit igenom i praktiken för höginkomsttagama har SCB på kommitténs uppdrag gjort simuleringar av den skatt dessa skulle ha betalat om de bara haft sin

arbetsinkomst? Simuleringarna har gjorts på ett riksrepresentativt urval av individer (SCB:s s.k. HINK-undersökning). Denna simulering av ett formellt skatteuttag på arbete jämförs med den skatt som verkligen betalts ("faktiska slutliga skatten") då hänsyn tagits till alla andra inkomst-, av- drags- och förmögenhetsförhållanden personen har haft. För att få visst perspektiv på de förändringar som inträffat över åren har simuleringar gjorts dels för åren 1980 och 1985 dels för skattereformsperioden 1989- 1991 samt 1992.

För att studera höginkomsttagama har individerna sorterats efter storleken på sin förvärvsinkomst och de 10% av individerna som har högst för- värvsinkomst ("decil 10") har specialstuderats. Höginkomsttagargruppen omfattar med denna avgränsning ca 450.000 individer. För att ge en uppfattning om vilka inkomstnivåer som fångas upp i denna grupp kan nämnas att nedre gränsen för denna decil år 1992 låg vid en för- värvsinkomst på 246.200 kr (och genomsnittet för decilen på 341.000 kr).

Det kan kanske förefalla som en teoretisk konstruktion att i efterhand "återsimulera" den skatt som formellt skulle tagits ut om individerna bara haft sin arbetsinkomst. Metoden motiveras med att den på ett illustrativt sätt kan visa hur två helt olika skattesystem som 1980-talets och dagens fungerar och hur individernas beteenden anpassat sig till vad som premierats skattevägen.

Förekomsten av "lågredovisare" —— ett mindre problem än tidigare

Massmedia har då och då uppmärksammat enskilda fall där höginkomst- tagare lyckats trolla bort hela skatten genom olika transaktioner och bli "nolltaxerare". Men rapportering om sådana fall förefaller ha blivit alltmer sällsynt om alls förekommande imassmedia under senaste åren. Vad har faktiskt hänt? Har nolltaxerarna försvunnit?

Nedan ges ett bredare perspektiv på företeelsen att "få ned sin skatt" än vad man fångar genom att bara isolerat se till specialfallet nolltaxerare. Den studerade höginkomstgruppen delas in efter i vilken grad man i det enskilda fallet fått ned sin slutliga skatt i förhållande till den formella skatten på arbete. Resultatet återges som en kvot enligt indelning i tabellen nedan.

". Simuleringama har gjorts på. de taxeringsmässiga begreppen inkomst av tjänst+nåring. För enkelhetens skull används termerna "arbetsinkomst" eller "förvärvsinkomst" som synonym till inkomst av tjänst+näring även om detta egentligen inte är helt överensstäm- mande begrepp.

23. Tabell: Fomrella skattesatsernas genomslag bland höginkomttagama (decil 10).

Faktiskt betald slutskatt i % av Höginkomsttagamas fördelning (%) eller formell skatt på arbete enligt grad av skatteredovisning skatteskaloma 1980 1985 1989 1990 1991 1992 under 50% "extrem lågredovisare" 10,0 2,6 2,1 0,7 0,6 0,2 50-75% "lågredovisare" 24 22 18 12 7 8 75-100% "normalredovisare" 54 65 69 75 76 77 över 100% "högredovisare" 12 10 11 13 16 15 Slmrma - 100 100 100 100 100 100

Som framgår av tabellen har lågredovisama minskat över åren. Andelen extrem lågredovisare (faktiska slutliga skatten mindre än hälften av den formella skatten på arbete) har minskat från 10 procent (42.000 personer) 1980 till ett par promille (ca 1000) 1992. Man kan säga att skatterefor— mens idé om horisontell rättvisa och att lika ska beskattas lika har fått synbart genomslag för personer med högsta arbetsinkomstema. Man kan (även om antalet är litet) fundera över vilka som fortfarande är lågredovisare 1992. Är det gamla förlustavdrag som "härrör" från det gamla skattesystemets dagar som spökar?

Det är att märka att andelen lågredovisare och extrem lågredovisare minskat redan 1985. De skatteomläggningar som gjordes under första hälften av 1980-talet bidrog således också till att de formella skattesatserna i skatteskaloma slog igenom. Skattereformen 1990—1991 har emellertid också haft påtagliga effekter medförande ett högre genomslag för de formella skattesatserna.

Gapet sluts mellanform ell skatt på förvärvsinkomst och faktisk skatt

Simuleringarna visar att det verkliga skatteuttaget med beaktande av samtliga inkomstförhållanden genomsnittligt sett ligger lägre än den formella skatten på enbart förvärvsinkomst. Detta innebär att inkomst-, avdrags- och förrnögenhetsförhållanden m.m. vid sidan av arbete ger en "skatterabatt" jämfört med referensnivån som är de formella skattesat- serna. Hur stora skillnaderna är mellan den formella skatten på arbete och den faktiska slutliga skatten för höginkomsttagama framgår av dia- grammet nedan. För att möjliggöra jämförelser över tiden har skatten alla åren uttryckts i procent av arbetsinkomsten.

24.Diagram: Höginkomsttagare. Simulerad fomrell skatt på förvärvsinkomst sanrt faktisk slutlig skatt uttryckt i % av förvärvsinkomsten.

andel av förvärvsinkomst

1980 1985 1989 1990 1991 1992 Inkomstlr

Diagrammet visar att simulerad formell skatt på förvärvsinkomst, uttryckt som andel av förvärvsinkomsten, minskat med 11,5 procentenheter mellan 1980 och 1991 (från 52,6 till 41,1%). Den faktiska slutliga skatten har under samma period "bara" minskat med 2,3 procentenheter ( från 42,1 till 39,8% av förvärvsinkomsten). Detta innebär att skatterabatten till följd av inkomstförhållanden vid sidan av arbete har minskat kraftigt. 'Minskningen av rabatteringen uppgår till 9,2 procentenheter varav 4,1 procentenheter i samband med skattereformen och 5,1 procentenheter tidigare under 1980-talet.

Delar man in perioden i tre delperioder första hälften av 1980-talet, andra hälften fram till skattereformen samt skattereformsåren finner man att dessa har helt olika karaktär vad gäller förändringar i skatteuttaget för höginkomsttagama.

Perioden 1980-1985 minskade det formella skatteuttaget på arbete för höginkomsttagama vilket dock från skattefinansiell synpunkt nästan helt uppvägdes av att skatterabatten för andra inkomstförhållanden sjönk i motsvarande män. Den faktiska slutliga skatten sjönk därför endast marginellt.

Perioden 1985-1989 karaktäriseras av ökat formellt skatteuttag på arbete och en ännu kraftigare ökning av den faktiska slutliga skatten. Till ökningen av den slutliga skatten bidrog inte bara de formella skattesatserna utan även ökade reavinster (jämför tabell 25).

Perioden 1989-1991 kännetecknas av skattereformens sänkningar av de formella marginalskattesatserna och den fristående kapitalbeskattningen. Det formella skatteuttaget på arbete för höginkomsttagama minskar med 9,4 procentenheter (från 50,5 till 41,1% av arbetsinkomsten) samtidigt som skatterabatten på grund av andra inkomstförhållanden minskar med

4,1 procentenheter. Den faktiska slutliga skatten minskar således denna period med 5,4 procentenheter (från 45,2 till 39,8% av förvärvsinkomsten).

Mellan 1991 och 1992 ökar gapet mellan formell skatt på arbete och den faktiska slutliga skatten, Orsaken är att reavinsterna går ned från den höga nivå de låg på åren 1989-1991 (se vidare nedan).

Vad består gapet av?

Ovan har den formella skatten på förvärvsinkomst för höginkomsttagama jämförts med den faktiska slutliga skatt som betalats av samma individer då hänsyn tas till de samlade inkomstförhållandena. Avvikelsen mellan simulerad formell skatt på förvärvsinkomst och det verkliga skatteuttaget var 1980 hela 10,5 procentenheter. 1989 har gapet halverats till 5,4 procentenheter och efter skattereformen (1991) uppgår avvikelsen endast till 1,3 procentenheter.

En uppfattning om vad "gapet" mellan den simulerade skatten och den faktiska består av kan fås genom att simulera skatten för olika delkomponenter i hierarkiska pålagringssteg enligt följande:

Steg 1: Skatt på inkomst av tjänsH-nän'ng

Steg 2: + pålagrad skatt på boende + pensionsförsäkringsavdrag Steg 3: + pålagrad skatt på övrigt dock ej reavinst Steg 4: + pålagrad skatt på reavinst

Summa steg 1 till 4: = Faktisk slutlig skatt

Boende och pensionsförsäkringar skiljs ut i en särskild grupp (steg 2). Övriga inkomstförhållanden som inte är kopplade till arbete, boende och pensionsförsäkringsavdrag eller reavinster skiljs ut i ett särskilt simule- ringssteg (steg 3). Detta steg är särskilt intressant som indikator på skatteplanering eftersom det inkluderar de samlade effekterna på beskattningen av alla andra aktiviteter såsom t.ex. upplåning för annat än boende, beskattning av sparande i olika former och förmögenhetsbe- skattningen. Det sista simuleringssteget (steg 4) avser reavinst. Detta är en inkomstpost som är mycket känslig för konjunkturförhållanden och utvecklingen på fastighets- och värdepappersmarknadema varför det finns anledning att separatredovisa den.

Tabellen nedan visar hur det formella skatteuttaget för hö ginkomsttagarna är sammansatt för de olika pålagringsstegen i simuleringarna och hur skatteuttaget förändrats över tiden.

25.Tabell: Decil 10.Simulerat fomrellt skatteuttag lör inkomstområden vid sidan av förvärvsinkomst uttryckt i % av förvärvsinkomsten

Pålagrad skatt för

steg 4 Summa

boende/ Simulerad annat med reavinst pålagrad skatt

form ell skatt

Faktisk slutlig skatt

pensionsförs. undantag för annat än

År på arbetsinkomst avdrag av reavinst arbetsinkomst

För höginkomsttagama var gapet som tidigare nämnts 10,5 procentenheter 1980. Av tabellen ovan framgår att till detta gap bidrog boende och pensionsförsäkringsavdrag med 7,5 och "övrigt" med 3,2 procentenheter. Skatten på reavinst var obetydlig. År 1992 har gapet som är att tillskriva boende och pensionsförsäkringsavdrag halverats till 3,7 procentenheter och skattegapet på grund av "övrigt" minskat till 0,4 procentenheter,

Boendet har hela tiden varit den faktor som i stor utsträckning förklarar differensen mellan formell skatt på förvärvsinkomst och den faktiska slutliga skatten. Efter skattereformen bidrar skatt på övriga inkomstför— hållanden (dvs annat än boende och reavinst) mycket lite till gapet. Skatt på reavinst har under perioden 1989 till 1991 varit en viktig faktor bakom att gapet slutits. Den höga nivån på reavinster dessa år är att tillskriva dels en stor volym på köp/försäljningar dels värdestegringar under senare delen av 1980-talet. Men mellan 1991 och 1992 minskar reavinsterna för höginkomsttagama och gapet mellan formell skatt på arbete och faktisk slutlig skatt ökar till följd härav.

Skattesystem ets resp. beteendefårmdringars inverkan

En fråga man ställer sig är i vilken utsträckning orsaken till att gapet minskar står att finna i att skattesatserna som sådana ändrats och i vilken utsträckning individerna ändrat sitt faktiska beteende. Vissa ledtrådar finner man genom att studera höginkomsttagamas skuldsättning.

26. Diagram: Låneskulden uttryckti % av förvärvsinkomsten

160% 140%

120%

_åneskuld annat

andel av förvärvsinkomstel

60% -- ' ' 40% -

låneskuld _opplat till boende 20%

0%

1980 1985 1989 1990 1991 1992 Inkomstår

Höginkomsttagarna hade 1985 en låneskuld motsvarande 148% av förvärvsinkomsten5. Låneskulden ökade svagt till 1989. Men mellan 1989 och 1992 minskade höginkomsttagama sin belåning mycket kraftigt från ca 150% av inkomst av tjänst-t'näring till strax under 110%.

Orsakerna till att gapet mellan simulerat skatteuttag på förvärvsinkomst och verklig slutlig skatt minskat förefaller för perioden före skatterefor- men i första hand vara att tillskriva förändringar i skatternas regelsystem. Förändringar i individernas ekonomiska beteende tycks inte ha givit något bidrag till den minskade differensen. För skattereformsåren 1990 och 1991 kan minskningen av gapet för höginkomsttagama tillskrivas såväl förändringarna i skattesystemets utformning som beteendeförändringar hos individerna.

3.4 Skatteplanering definitioner och förutsättningar

Vad avses med skatteplanering, skatte/lykt och skattefusk

Skatteplanering är ett lagligt förfarande, skattefusk ett olagligt. Skatteflykt ett oklart begrepp däremellan.

Det skall inledningsvis understrykas att några klara gränser för vad som är skatteplanering, skatteflykt och skattefusk inte kan dras och att

5Tyvärr kan inte motsvarande uppgift anges för 1980 eftersom totala låneskulden inte fanns med bland HINKens variabler detta år.

förskjutningar av gränserna sker till följd av samhällets utveckling, ändrad lagstiftning och rättspraxis.

1 den allmänna debatten under senare delen av 1980-talet och början av 1990-talet har "skatteplanering" och "avancerad skatteplanering" diskuterats livligt. Ordet skatteplanering ges ibland olika innebörd. I bland avser man därmed förfaranden som gränsar till skatteflykt eller rent skattefusk. Begreppet skatteplanering fick under 1980-talet en negativ klang, vilket till en del beror på att rådgivare som skatteplanering mark— nadsförde förfaranden vars rättsliga innehåll ifrågasatts av skattemyndig— heterna eller vid en rättslig prövning föranlett beskattning. Till denna attity dförskjutning har också bidragit såväl åtgärder från lagstiftarens sida som den massmediala exponeringen både av "vanliga" skatteplaneringsråd till allmänheten och exempel på genomförd skatteplanering med mycket stora belopp.

Sammanfattningsvis kan man definiera begreppen skatteplanering, skattetlykt och skattefusk på följande sätt:

Skatteplanering: Att inom ramen för gällande lagstiftning och utan att komma i konflikt med lagstiftningens grunder välja mellan till buds stående handlingsaltemativ på sådant sätt att skattekostnaden minimeras.

Skatteflykt: Att i strid mot lagstiftningens grunder genom utnyttjande av luckor i lagstiftningen företa transaktioner som medför att skattekost- naden nedbringas utöver vad som följer av skatteplanering. Typiskt sett framstår skatteflyktsåtgärder som om de företagits inom ramen för gällande lagstiftning och deras huvudsakliga syfte är att uppnå skatteför- delar.

Skattefusk: Att i strid mot gällande lagstiftning företa åtgärder som innebär en lägre skattekostnad jämfört med om gällande lagstiftning följts. Sanktioner mot skattefusk är straff enligt skattebrottslagen samt skatte- eller avgiftstillägg.

Förutsättningar för skatteplanering

Ekonomisk planering i vilken skatteplanering är en viktig del sker för enskilda personer med utgångspunkt från. den egna ekonomin. Målsättningen bör inte vara att minimera skatten (skatteplanera) utan att maximera inkomst- och förmögenhet efter skatt med hänsyn tagen till familj ens behov och andra faktorer som riskbenägenhet etc. Men ju större betydelse skatten har för det ekonomiska utfallet desto betydelsefullare

blir själva skatteplaneringen.

Det torde stå klart att en mycket viktig aspekt vid utformningen av regelverket kring skattereformen var att minska incitamenten till

handlande betingat av Skatteöverväganden. Samhället har tidigare ingripit främst mot privatpersoners skatteplanering. Man ville genom skattereformen komma bort från skatteplanering också i företagssektorn.

Två förutsättningar krävs för skatteplanering nämligen för det första möjligheter som ges av själva skattesystemet och för det andra tillgång på information (kunskap) om dessa möjligheter som man kan skaffa på egen hand eller med hjälp av rådgivare.

Om man ser till de möjligheter som ges av skattesystemet kan man uppställa fem generella kriterier som bidrar till skatteplanering:

Inkomster beskattas olika

Inkomstskatt uttas efter en progressiv skala Skattesubjekt beskattas olika Beskattningsunderlaget för skatten är inte entydigt bestämd på grund av osäkra värderingsprinciper, inkomstkriterier och periodiserings- principer

5. Möjligheten till skattekredit

ADJN—A

Skatteplanering inom laglig ram går därför ut på

1. att omvandla inkomst av ett slag till en inkomst som inte beskattas eller beskattas lägre,

2. att inte bli drabbad av progressionen genom att jämna ut inkomster mellan år och inom familjen,

3. att föra över inkomst eller förmögenhet till någon annan fysisk eller juridisk person

4. att utnyttja möjligheten till låg värdering av tillgångar, senarelägg- ning av inkomster och tidigareläggning av avdrag.

5. att skjuta beskattningen på framtiden

Den andra faktorn av betydelse för skatteplanering är, som ovan nämnts, tillgång på information (kunskap) om skatteplaneringsmöjligheterna. Den utvecklas närmare i avsnittet nedan.

3.5 Skatterådgivama och skatteplaneringen 3.5.1 Betydelsen av externa rådgivare

Skatteplanering och skatteflykt är inte produkter av den senaste tidens samhälle. Vad som inträffat i mitten av 1980-talet är att skatteplaneringen eller rättare uttryckt skatteflykten fått en mer kommersialiserad inriktning efter mönster från USA och att avdrag tillhandahållits mot provisionsersättningf Bidragande orsaker till denna utveckling har varit

6. Jfr Grosskopf, Göran, Balans 1984 nr 8, Skatteproblemen likartade världen över.

utvecklingen på fondbörsen och fastighetsmarknaden och den ökade konkurrensen mellan banker och finansbolag. Även mer traditionella näringslivsrådgivare affärsadvokater, revisorer och redovisningsbyråer har kraftigt utökat sin verksamhet inom detta område.

Sammantaget har detta lett till en tilltagande exponering av skatteplane- ring i den skattepolitiska debatten, i massmedia, och i olika "branscher" (bank, försäkring, leasing, investeringsrådgivning) där man konkurrerat med sina produkter som marknadsförts med skatteargument.

Skatterådgivningen är inte lagreglerad i Sverige och inga krav uppställs på de som yrkesmässigt sysslar med skatterådgivning. Etiken bland skatterådgivare är ojämn och dåligt utvecklad. Skatterådgivning omfattar både skatteredovisning (upprättande av deklarationer etc.) och rådgivning i bestämda beslutssituationer, främst investeringsrådgivning. Inslaget av skatteplanering är större i det sistnämnda fallet.

Mycket betydelsefullt när det gäller skatteplanering, framför allt när det gäller företag, är skattesubjektets samlade organisatoriska och personella resurser och därvid spelar nätverket av externa skatterådgivare stor roll, jfr nedanstående figur som har sin förebild i en principskiss upprättad av Lars Fallan.7

27. Figur-..Betydelsen av externa rådgivare [ör skatteplanering - en modell

A. Skattesystemet

l

B. Det område som det är möjligt att skatteplanera inom

_j—

D. skattesubjektets samlade organisatoriska och personella resurser j

?

E. Nätverk av externa skattekompctcnta aktörer ]

Fallan konstaterar att hans undersökning visar att många skattesubjekt inte använder särskilda externa skatterådgivare. Det är främst revisorn och redovisningsbyrån som utnyttjas som skatterådgivare. Med tilltagande resurser hos skattesubjektet ökar användningen av revisor och advokat.

7. Fallan, Lars. Skatteplanlegging og skatteplanleggingsadferd i naeringsvirksomhet. Norges Handelshöyskole, rev. okt 1989.

En svensk undersökning8 i samarbete med SCB visar att 69 procent av svenska företag med 0-99 anställda utnyttjade redovisningskonsult och den enskilda tjänst som hade störst andel var skatterådgivning. Hela 72 procent av klienterna vid byråer med auktoriserad och godkänd revisor anlitade byrån för skatterådgivning.

Sammanfattningsvis torde den slutsatsen kunna dras att rådgivarna spelar en stor roll när det gäller företagens/kapitalägarnas skatteredovisning. De har också även i framtiden stor betydelse både för inriktning och omfattning av skatteplaneringen. Om skattereformen har någon effekt på bl.a. efterfrågan på skatteplaneringstjänster borde det vara möjligt att fråga rådgivarna om detta.

3.5.2 Skatterådgivarnas syn på skatteplaneringen före och efter skattereformen

Att försöka fånga upp skattereformens effekter på skatteplaneringen genom att tillfråga Skatterådgivama är förknippat med en rad problem. Här pekas på ett par.

Den faktiska omfattningen av skatteplanering före skattereformen är inte känd oavsett om man menar den tid som läggs ner på dessa aktiviteter eller de belopp som "undgår" beskattning. Även med bortseende från de definitionsproblem som är förknippade med begreppen är det knappast möjligt att göra en undersökning av omfattningen vare sig före eller efter skattereformen.

Förutom de rent praktiska svårigheterna kan vidare konstateras att en sådan undersökning i hög grad påverkas av den allmänna konjunktumed— gången, prisfallet på aktier och fastigheter och därav följande minskade realisationsvinster. Prisfallen på fastigheter och aktier minskar också underlaget för krediter med sådana tillgångar som säkerhet och vidare har kreditförlusterna inom den finansiella sektorn lett till restriktivare kredit- givning. Det är därför svårt att renodla just skattereformens inverkan.

Om efterfrågan på Skatterådgivning minskat borde även rådgivarna tvingas minska sina personella resurser i vart fall den del som avser skatterådgivning. Det är dock troligt att skattereformens många föränd- ringar i sig skapar en ökad efterfrågan på mer "vanliga" råd. Den typen av rådgivning lämnas troligen i första hand av redovisningsbyråer och liknande. Detta borde då återspegla sig i svaren om man riktar sig till flera Olika kategorier av rådgivare. Därmed har antytts ett problem med att fråga rådgivarna nämligen att det kan vara svårt att sortera skattepla-

'. Nominering av redovisningskonsulter, betänkande av utredningen om kontroll av redovisningskonsulter. SOU 1989259, bilaga 2.

neringsråd från andra råd — t.ex. om gällande rätt och den ändrade lag- stiftningens konsekvenser.

Trots den indikerade problematiken genomfördes under december 1992 en enkät till olika kategorier av näringsidkare som yrkesmässigt biträder de skattskyldiga och företagen i frågor med anknytning till skatter (för ägaren, företaget och anställda). Undersökningen har riktat sig till advokater, banker, försäkringsföretag,revisorerochredovisningskonsulter. Verksamheten på varje ort har ingått i urvalet. En rikstäckande bank eller revisionsbyrå kan därför ingå i undersökningsresultatet med mer än en enkät. Det är förhållanden/erfarenheter vid det egna företaget på orten som ska ha varit avgörande för de som svarar _ inte vad de tror gäller generellt i landet.

Svaren på frågorna avser att belysa rådgivamas syn på i vilka avseenden skattereformen påverkat bl.a. skatteplaneringen och efterfrågan på skatterådgivning.

I Skatterådgivningen kan urskiljas dels sådan som vänder sig till privat- personer dels sådan som vänder sig till företag. Skatterådgivning sker dels när skatt ska redovisas (vid upprättande av deklarationer etc.) dels i vissa beslutssituationer (t.ex. vid köp- och försäljning av tillgångar). Det är främst rådgivning i bestämda beslutssituationer som man förknippar med skatteplanering.

Rådgivamas egen uppfattning om skatteplaneringen under 1980—talet

Fyra av fem (79%) skatterådgivare svarade att skatteplaneringen ökade under 1980-talet.

De som svarat att skatteplaneringen ökat har fått rangordna (1—3) de tre faktorer som de ansett haft störst betydelse för ökningen av skatte- planeringen. De har haft att ta ställning till ett antal fasta svarsalternativ och möjlighet att lägga till något eget. Man har i flera fall rangordnat färre än 3 alternativ — i genomsnitt har man angett 2,17 och svars- frekvensen skiljer sig mellan olika grupper. I nedanstående tabell har dessa skillnader eliminerats. Av tabellen framgår således för de som svarat på frågan hur svaren fördelar sig oberoende av rangordning.

28. Tabell: Orsaker-till ökningen av skatteplaneringen under 1980—talet Kan Du ange vad som betytt mest för ökningen av skatteplaneringen?

De svarande skulle rangordna tre alternativ. Tabellen anger för varje grupp hur svaren fördelar sig mellan olika alternativ.

Alla A dvo- Fåmäk- Revi- NÄMN T A LTERNA TIV svarande kat Bank n'ng sion Högkonjunkturen 8% 8% S% 7% 12% Stigande börs- och fastighetspriser 11% 9% 13% S% S% Ökad tillgång på krediter 8% 11% 7% 9% 10% Ökad konkurrens om rådgivningen 1% 0% 2% l% l% Förväntningar på rådgivarna och massmedial exponering 8% 6% 9% S% 7% Bristfälligt skattesystem med stora möjligheter till skatteplanering 19% 20% 18% 21% 19% Höga marginalskatter 26% 27% 26% 22% 28% Hög förmögenhets-, arvs- och gåvoskatt 12% 17% 13% 10% 10% Bristande etik i samhälle/näringsliv 3% 0% 3% 7% 3% Otillräckliga samhällsreaktioner mot skatteplanering S% 0% 3% 6% 1% Annat 1% 2% 0% l% 0% Vet ej 1% 0% l% 3% 0% Summa 100% 100% 100% 100% 100%

De svarande anger att höga marginalskatter och det bristfälliga skattesys- temet med stora möjligheter till skatteplanering betytt mest för ökningen av skatteplaneringen. Noteras bör den i alla grupper samstämmiga uppfattningen om marginalskatternas betydelse för den ökade skatteplane- ringen under 1980—talet. Hög förmögenhets, arvs- och gåvoskatt anges också av många. Sammanlagt utgör 57 procent faktorer med koppling till skatterna.

Men även faktorer med koppling till den ekonomiska utvecklingen är frekventa. Högkonjunktur och stigande börs- och fastighetspriser och tillgång på krediter utgör sammanlagt 27 procent av nämnda alternativ. Förväntningar på rådgivarna, konkurrensen dem emellan och den massmediala exponeringen av Skatterådgivningen utgör 9 procent medan bristande etik i samhälle och näringsliv samt otillräckliga sam- hällsreaktioner mot skatteplanering svarar för 6 procent av de nämnda alternativen.

Några andra alternativ än svarsformulärets som rådgivarna själva nämnt är 1) de många ändringarna av reglerna som kräver ny planering/anpass— ning, 2) ökad lönsamhet på skatteplaneringen samt 3) en ökad medveten— het om skatteplaneringens utbredning "andra gör det".

Betydelsen av själva skattesystemet framträder än klarare om man studerar förstahandsvalet som de svarande gjort. Hela 71 procent av

Redo— visning 9% 10%

l l% 2%

9%

17% 25% 9% S%

3%

2%

1% 100%

förstahandsalternativen har koppling till skatter medan faktorer med anknytning till den ekonomiska utvecklingen "bara" utgör 15 procent.

Den slutsatsen torde kunna dras att höga marginalskatter och utform— ningen av skattesystemet bidragit mest till ökningen av skatteplaneringen under 1980-talet.

Skaltereform en och möjlighetema till skatteplanering

Skatterådgivama fick svara på frågan om skattereformen minskat eller ökat möjlighetema till skatteplanering. Hela 85 procent av rådgivarna ansåg att möjligheterna till skatteplanering minskat till följd av skattereformen. Några rådgivare, som kommenterat frågan, har påpekat att möjligheter fortfarande finns men att lönsamheten av skatteplanering minskat främst till följd av lägre marginalskatter.

Skatterådgivare som svarat att Skatterådgivningen minskat —— har fått ange vad som betytt mest när det gäller de minskade möjligheterna till skatteplanering. Det har varit fråga om ett antal fasta svarsalternativ med möjlighet till egna tillägg. Svaren från de som svarat fördelar sig på följande sätt:

29. Tabell: Skatterefomren och möjligheterna till skatteplanering

Kan Du ange vad som betytt mest när det gäller de minskade möjlighetema till skatteplanering? (I tabellen anges vad man uppgivit som den viktigaste faktorn - förstahandsvalet)

Fårsäk— Redo-

ring Sion visning

A lla MEST BETYDELSEFULL T svarande Likformigare beskattning

Revi—

av olika inkomster 26% 32% 25% 18% 35% 21% Sänkta marginalskatter 31% 32% 26% 35% 34% 42% Att kapitalinkomster beskattas separat och proportionellt 21% S% 31% 12% 11% 13%

Likformigare beskattning av olika skattesubjekt S%

Säkrare värderingsprinciper, inkomst-

14% S% 6% S% S%

kriterier och periodiseringsprinciper 0% 0% 0% 0% l% 0% Minskade möjligheter

till skattekredit l% 0% l% 0% $% 3% Sänkt förmögenhetsskatt,

arvs- och gåvoskatt 0% S% 0% 2% O% 0% Alla faktorer lika viktiga 9% 9% $% 16% 7% 13% Annat 2% 0% l% 4% 3% 2% Vet ej 3% S% 3% 8% l% 3%

Summa

När det gäller skattereformen har sänkta marginalskatter och likformigare beskattning av olika inkomster betytt mest för de minskade möjligheterna till skatteplanering. Men även den separata och proportionella kapitalin- komstbeskattningen tillmäts betydelse av många.

Några rådgivare som kommenterat frågan har pekat på betydelsen av den slopade rätten till underskottsavdrag mot inkomst av tjänst. Några har också framhållit betydelsen av minskade vinster i näringslivet.

Skattereform en och efterfrågan på skatterådgivning

Rådgivarna har fått svara på den allmänna frågan om efterfrågan på Skatterådgivning ökat eller minskat efter skattereformen dvs. under år 1992.

En majoritet (57%) av rådgivarna svarade att efterfrågan på skatterådgiv- ning minskat under 1992. 1 kommentarer till frågan nämns bl.a. att det är för tidigt att svara på den ställda frågan (frågan ställd i december 1992) och att skatteplaneringen kommer att minska när reformen är inarbetad. Andra anger att omfattningen av olika "upplägg" har gått ner men att alla nya regler ställer krav på mer information/planering. Flera framhåller lågkonjunkturen och minskade vinster som orsaker till minskad efterfrågan på skatteplanering.

Till medlemmar i FAR, SRS, SRF och vissa advokater i Sveriges Advokatsamfund, främst affärsadvokater ställdes även den mer konkreta frågan om hur den debiterade tiden för Skatterådgivning förändrats under 1992 och hur man bedömde år 1993 och framåt. Sammanlagt uppskattas företagen som ingått i undersökningen ha haft ca 6 tusen anställda och Skatterådgivning i olika former utgör givetvis bara en mindre del av deras verksamhet.

En beräkning av volymen Skatterådgivning uttryckt i debiterad tid för den undersökta gruppen ger vid handen att minskningen för de båda åren uppgår till drygt 10 procent vilket beräknas motsvara 250-300 anställda. Skatterådgivning utövas emellertid dessutom av andra yrkesgrupper främst banker och försäkringsbolag varför totalsiffran sannolikt är högre.

Rådgivarna har tillfrågats vad som betytt mest för minskningen i efterfrågan på skatterådgivning. Den minskade efterfrågan förklaras av faktorer som antalsmässigt till två tredjedelar kan hänföras till skatte- systemet och till en tredjedel till konjunkturen och andra ekonomiska faktorer.

I vilken utsträckning det är skattereformen eller lågkonjunkturen som bidragit mest till den minskning som kunnat registreras är det omöjligt att ha någon uppfattning om. Kanske är det som en skatterådgivare ut—

tryckt det: "Efterfrågan har inte minskat till följd av skattereformen. Efterfrågan har minskat till följd av att likviditets- och överlevandefrågor har kommit i förgrunden. Många företag har inga skatteproblem till följd av att de visar förlust. Dessutom har många inte råd att betala skatteråd- givarens arvode."

En allmän övergripande bedömning, som kan göras, är dock att både skattereformen och lågkonjunkturen haft stor betydelse för den minskade Skatterådgivningen och att minskningen i Skatterådgivningen i första hand ha gått ut över rådgivningen i bestämda beslutssituationer dvs. själva skatteplaneringen. När det gäller mera vanliga råd har det nämligen funnits ett ökat behov till följd av alla ändrade regler.

Skatterådgivningen ska naturligtvis löna sig i form av minskad skatt för uppdragsgivaren och ge täckning för egen tid, skatterådgivarens arvode och ev. risker i kommersiellt, skatterättsligt och processuellt hänseende. I den utsträckning minskningen av Skatterådgivningen gått ut över den egentliga skatteplaneringen t.ex. olika "upplägg" torde ändå den minskning som kunnat noteras vara av viss betydelse också statsfinan- siellt.

4 Skattefusk

Skadeverkningarna av skattefusk uppkommer genom en omfördelning av skattebördan mellan olika inkomsttagare och från effekterna på den samhällsekonomiska resursanvändningen. Omfördelningen kan upplevas som orättvis och ha negativa effekter på skattemoralen, på det politiska systemet och samhällets funktionssätt.

Nedan kommer frågan om hur skattereformen påverkat skattefusket att tas upp utifrån tre olika infallsvinklar. För det första redovisas olika metoder att försöka skapa sig en bild av det totala fuskets omfattning. Därefter ställs frågan om man utifrån den officiella kriminalstatistiken kan säga något om skattefuskets utveckling, Slutligen redovisas hur skatterådgivare och allmänhet uppfattat skattereformens inverkan på skattefusket. Det tidsperspektiv som studeras är i första hand utvecklingen under skattere— formsåren fram t.o.m. 1992.

Sammanfattningsvis är bedömningen att nivån på skattefusket kan diskuteras däremot finns inget som tyder på ett ökat fusk totalt sett under perioden 1980-1992. Det finns möjligen tecken på ett ökat momsfusk under senare år.

Med avseende på möjligheterna att undandra skatt bedöms skattereformen rent tekniskt inte ha inneburit några väsentliga förändringar. Vissa förbättringar som bedöms ha haft en sänkande effekt på skatteundandra- gandet har gjorts t.ex. ökad uppgiftsskyldighet och preliminärskatteav— drag.

Lägre skattesatser till följd av skattereformen bedöms ha små effekter på olagliga beteenden. Men i den mån skatteplaneringen minskar kan detta ha betydelse för hur man uppfattar att andra fullgör sin skattskyldighet och därmed benägenheten att skattefuska. I detta hänseende bedöms skattereformen haft en viss positiv effekt på skattefusket i sänkande riktning.

Statistiken över anmälda och dömda för skattebrott visar en minskning mellan 1988-1992. Utvecklingen såsom den ser ut enligt brottsstatistiken torde inte återspegla utvecklingen av denfaktiska brottsligheten. Minsk- ningen torde Vara en effekt av att skattereformen och omorganisationen av skatteförvaltningen, som genomförts samtidigt, temporärt krävt att resurser omprioriteras från kontrollverksamhet till information och utbildning. Denna omfördelning har bl.a. resulterat i en minskning av antalet revisioner av företag och ett minskat antal anmälningar om skattebrott. En annan orsak är att skattemyndighetema tagit hänsyn till

"arbetsbelastningen" hos polis och åklagare och underlåtit att anmäla mindre allvarliga fall.

Allmänheten och Skatterådgivama har olika uppfattning om skattefuskets utveckling. En majoritet bland allmänheten tror den ökat medan få skatterådgivare är av denna uppfattning. En samstämmighet förefaller dock finnas om att skattereformen om den påverkat skattefusket så är det i minskande riktning.

4.2. Kan man mäta skattefusket? 4.2.1 Allmänt om vad som fångas upp med olika mätmetoder

Att kartlägga omfattningen av dold verksamhet och skatteundandragande är av lätt insedda skäl behäftat med betydande svårigheter och hela sanningen kan man knappast räkna med att kunna fastlägga. Det finns olika metoder att studera skatteundandragandet.

Begrepp som skattefusk och skatteundandragande används ofta parallellt med begrepp som svart och dold ekonomi. Det finns flera definitioner av dessa begrepp. Nedanstående figur illustrerar sambanden mellan vit, svart och dold ekonomi i nationalräkenskapssammanhang.

30. Figur-: Nationalekonomiska definitioner av vit, svart och dold verksamhet

| Varor ochtjänster erhållna som rsulmt av mänsklig verksamt | Produktiv verksamt Ej moduktiv verksamt Illepl (muslim, Legal . . . hamta-ämne, (mvat och offentlig) prostitution, mrkotikalandel)

Ej medi svenska

Medisvmskanationalräkmskaper natiomlråk ] per

Utanför nationalräkenskapssystan ]

Begreppet svart ekonomi fångar in fel- eller ej redovisade inkomster kopplade till legal produktiv verksamhet. Rent illegal verksamhet ligger däremot utanför svarta sektorn.

Principskissen nedan illustrerar vilka typer av skatteundandragande som fångas in med olika metoder. Ingen metod fångar in allt.

31. Figur. Principskiss över skatteundandragandets förhållande till nationalekonomiska beräkningar av svart sektorioredovisade inkomster och skattefel som kan upptäckas/bevisas vid skattekontroll

(Anm. Storleken på cirkelytoma är godtyckligt valda)

Det totala skattetmdandragandet (dvs.såväl avsiktliga san oavsiktliga skattefel san kan upptäckas/ skattefel) bevisas av & skattemyndighetema vid skattekontroll

Den svarta sekwm och aedovisade inkom-inter enligt natimalräkenskaper (tränat legal produktiv verksarrdret)

skattefel som inte är kopplad till legal produktiv verksamhet (rmlisatimsvinster, felaktiga bdcslutsdispositimer, vissa utlandstransaktioner samt rena beåägerier)

Div. svartarbete (nonfilers _letc.) som inte går att upptäcka/ bevisa vid skattekmtroll

Förfaranden san inte går atti

& efterhand påvisa (Lex. arbets-

byten inan tjänstesekta'n)

I det totala skatteundandragandet inräknas alla former av skatteundan- dragande dvs. även skattefel till följd av organiserad och ekonomisk brottslighet. Vad gäller omfattningen på skatteundandragandet begränsas framställningen till den svarta sektorn enligt nationalräkenskapema (skuggad yta i figuren ovan).

4.2.2. Svart sektor baserat på hushållssektom

Makrometodiken för att mäta svarta sektorngår ut på att för hus- hållssektom i nationalräkenskapema jämföra inkomstanvändningen (inkluderar de svarta inkomsterna) med vad som faktiskt rapporteras i inkomstdeklarationer och företagsbokföring. I princip kan skillnaden mellan dessa två serier betraktas som en grov uppskattning av den inkomst som inte har redovisats till skattemyndighetema.

Beräkning av skatteundandragandet baserat på nationalräkenskapsdata för hushållssektom har gjorts vid två tillfällen i Sverige. Den första gjordes 19849 och en ny beräkning har gjorts år 1993 av Åke Tengblad på uppdrag av KUSK”).

9. Ingemar Hansson. Sveriges svarta sektor. Beräkning av skatteundandragandet i Sverige. RSV Rapport 1984:5.

'". Åke Tengblad: Århundradets skattereform, del II. Beräkning av svart ekonomi och skatteundandragandeti Sverige 1980-1991. Beräkningen för 1992 har utförts av SCB/Natio- nalråkenskapema.

Avgränsningen av svarta sektorn är i stora drag densamma i de båda studierna även om den inte är helt identisk. I den första gjordes på grund av osäkerhet i nationalräkenskapema en låg och en hög beräkning. I den senare har endast gjorts en kalkyl och hur osäkerheten i underliggande nationalräkenskapsdata skulle kunna ändra bilden diskuteras resone- mangsvis.

Utvecklingen av den svarta sektorn framgår av nedanstående diagram.

32. Diagram: Sveriges svarta sektor”

10

&

4

2

0 f 0 t i l | 0 4 # +

1970 1772 1974 1976 1978 1980 1982 1984 1986 1988 1990 1992 "" "" LågskauningVaBNP ' ' * "HEgMningVoBNP Scanning%BNP

') Oredovisad legal produktiv verksamhet samt ränteinkomster/utdelningar

Beräkningar baserade på nationalräkenskapsdata över hushållens inkomstanvändning ger vid handen att den svarta sektorn främst om- fattningen av oredovisade inkomster under perioden 1970-1992 inte ökat utan förefaller vara relativt konstant eller svagt minskande. Den svarta sektorn utgör med den använda beräkningsmetoden ca 5 procent av total bruttonationalprodukt, BNP. De svarta inkomsterna motsvarar 8 procent av hushållens disponibla inkomster eller ca 8 tkr per invånare (1991). De oredovisade inkomsterna är sannolikt ojämnt fördelade men det är svårt att ha någon säker uppfattning om hur de förändrar bilden av inkomstfördelningen.

Man kan särskilja räntor/utdelningar i kalkylen. Beräkningarna visar att andelen räntor och utdelningar som inte kommer fram till beskattning har minskat mellan 1980 och 1991. I början av 1980-talet låg den andelen på ca 1 procent av BNP. 1991 hade den fallit till några tiondels procent av BNP vilket bl.a. torde sammanhänga med en bättre skattekontroll (kontrolluppgifter har införts under perioden).

Hur stort skatteundandragandet är på de oredovisade inkomsterna går inte att beräkna mer exakt. En kalkyl av skatteundandragandet blir av flera skäl till sin karaktär en hypotetisk beräkning. Det beror bl.a. på att den svarta verksamheten sannolikt skulle ha skett i en annan omfattning och

med andra priser om den varit beskattad. I praktiken är det också en omöjlighet att uppdaga all svart verksamhet. Den kalkyl som Tengblad gör över skatteundandragandet (1991) bortser från dessa komplikationer. Kalkylen tar inte heller hänsyn till skatteundandragande i andra former än på legal produktion och ränteinkomster/utdelningar. Kalkylen visar ett skatteundandragande på ca 46 mdr kr eller drygt 3 procent av BNP.

Det bör i sammanhanget påpekas att de kalkyler som gjorts baserat på hushållssektom i nationalräkenskapema inte fångar upp alla former av skatteundandragande, jfr. figur 31. De fångar upp oredovisade inkomster i anslutning till den produktiva verksamheten samt oredovisade räntor och utdelningar. Det fusk som finns vid redovisning av skattepliktiga reavinster ingår inte eftersom det inte utgör produktiv verksamhet och på grund av att statistik för att göra en bedömning av den sannolika storleken saknas. Allmänt gäller dock att alltfler transaktioner i in- komstslaget kapital har belagts med kontrolluppgifter och kontroll- möjligheterna har ökat varför volymen skatteundandragande av detta slag bör vara avtagande. Tengblads beräkningar fångar inte heller upp skatteundandragande ivit sektor — där inkomsterna är korrekt redovisade —— men avdragen är felaktiga t.ex. överdrivna reseavdrag eller ränteav— drag. Fr.o.m. inkomståret 1994 kommer kontrolluppgift att lämnas för låneräntor varför detta problem minskar framöver. Arbetsbyten som sker yrkesmässigt men där betalning i pengar inte förkommer torde också till stora delar ligga utanför skattningen av den svarta sektorn.

4.2.3. Uppskattning utifrån individdata

En för Sverige ny metod att försöka uppskatta omfattningen av de oredovisade inkomsterna hos gruppen egenföretagare redovisas av Mikael Apel”. Studien går ut på enjämförelse av utgifter och disponibel inkomst mellan företagar- och löntagarhushåll. Utifrån dessa jämförelser skattas storleken på de oredovisade inkomsterna hos egenföretagarhushållen.

I en statistisk analys (regressionsanalys) skattar Apel de oredovisade inkomsterna för egenföretagarhushållen till 30 procent av egenföretagar- hushållens disponibla inkomster. Man bör dock vara försiktig med att dra slutsatsen att det verkligen är fråga om svarta inkomster. Apels, som det kan förefalla höga skattning av de oredovisadee inkomsterna hos egenföretagama, motsägs dock inte av kalkyler baserade på national— räkenskaperna.

”. Mikael Apel: An Expenditure-Based Estimate of Tax Evasion in Sweden. July 1993. First draft. Nationalekonomiska institutionen, Uppsala universitet.

Med tanke på osäkerheten i dessa kalkyler skall man kanske ändå inte dra alltför långtgående slutsatser om det faktiska skattefusket hos egen- företagarna.

4.2.4. Momsfusket utifrån nationalräkenskapsdata

Utifrån nationalräkenskapema kan man även med en annan metod skapa sig en totalbild av de svarta inkomsterna och den undandragna mervär- desskatten. Metoden utgår från en jämförelse av det teoretiska momsinne— håll i produktionen som kan räknas fram utifrån nationalräkenskapema med de momsintäkter som redovisas i verkligheten till myndigheterna.

Den använda metoden där jämförelsen görs med verklig momsuppbörd innebär att man inte bara fångar upp oredovisad moms på svart produk- tion utan även rena momsbedrägerier. Med detta mått har den undandrag- na momsen under 1980-talet motsvarat ca 1 procent av BNP eller ca 13 procent av momsintäktema. Dock kan periodiseringsproblem i samband med ändrade uppbördsrutiner störa jämförelsen. Detta inträffade 1989 vilket är orsaken till den låga momsdiskrepansen detta år.

33. Tabell: Jimförelse mellan teoretiskt kalkylerad moms enligt national—

räkenskapema (NR) och faktiskt uppburen moms. Kalla: Åke Tengblad. Beräkning av svart ekonomi och skatteundandragandet i Sverige 1980-1991. SCB/N R år 1992.

1 989 I 990 199] 1992 100,1 128,1 149,0 34,6 60,5 93,3 1 12,4 127,4 114,6

4,8 7 4 6,8 15,7 21,6 11,0

Mdr kr i löpande priser.

Kalkylerad moms enl NR Faktiskt uppburen moms Momsdiskrepans Momsdiskrepansen i % av 13,9% 12,2% 7,3% 14,0% 17,0% 9,6% 0,6% 1,2% 1,5%

- faktiskt uppburen moms - BNP

Som framgår av tabellen har momsdiskrepansen varierat kraftigt de senaste åren. Variationerna är sannolikt inte ett uttryck för att moms- fusket skulle växla på detta sätt mellan enskilda år. Förklaringarna torde i stället vara att söka i periodiseringar m.m. i nationalräkenskapema eller att statistikunderlaget har andra brister. Sett i genomsnitt perioden 1989— 1992 är momsdiskrepansen, uttryckt i procent av faktiskt uppburen moms, ca 12 procent vilket är samma storleksordning som tidigare under 1980-talet.

Skattemyndigheterna har under 1993 och 1994 funnit mer felaktigheter i företagens momsredovisningar än tidigare. Det är dock svårt att bedöma om den ökning skattemyndighetema iakttagit är en effekt av att moms- kontrollen förstärkts eller om den också till del är att tillskriva ökat fusk.

I den mån momsfusket verkligen har ökat kan man spekulera i orsakerna. En indikation på att företagen har problem att få fram pengar till momsbetalningarna är den ökade restföringen av moms under senaste åren. (Medan den totala skatteskulden ökat med 25 procent mellan år 1991 och 1992 har den skuldförda momsen ökat med 55 procent.) Det är möjligt att detta tecken på likviditetsproblem också tar sig uttryck i fusk. Att inte betala moms kan ha blivit ett sätt att överleva i konkurrensen. Skattereformen har genom breddningen av skattebasema kommit att inkludera en rad nya branscher inom bl.a. tjänstesektorn som är mycket svårkontrollerade. Efter skattereformens genomförande har momsen differentierats vilket försvårar kontrollen och öppnar nya möjligheter till fusk.

4.2.5. Möjligheten att upptäcka skatteundandragande genom revision

En intressant fråga är hur mycket av det totala skatteundandragandet som revideras fram vid de revisioner som skatteförvaltningen utför. Det kan nämnas att skattemyndighetemas kontrollverksamhet 1992 resulterade i nettohöjningar av skatterna med 11 Mdr kr.

Det hade naturligtvis varit intressant om det utifrån revisionsresultatet hade gått att uppskatta det totala omfånget på skatteundandragandet eller i vart fall det som går att revidera fram. Det är av flera skäl inte möjligt idag. Det främsta skälet till det är att skattemyndighetemas urval inte görs slumpmässigt.

En uppräkning av revisionsresultatet kan således inte användas för att uppskatta skatteundandragandet. Däremot ger en sådan uppräkning en indikation på hur effektivt skattemyndighetemas urval är när det gäller att uppdaga framreviderbara felaktigheter. Det sålunda uppräknade revi- sionsresultatet visar på felaktigheter som satt i relation till förädlingsvär- det uppgår till hela 19 procent och motsvarar 13 procent av BNP.

Vid fördjupad kontroll av vissa betydelsefulla uppgifter i företagens deklarationer år 1992”, och som gjordes med statistiska urvalsmetoder, fann man att det främst var de stora företagen som gjorde fel till sin fördel i sin deklaration. Därav bör inte slutsatsen dras att de stora företagen orsakar störst skatteförluster. Det finns anledning att anta att de mindre företagen och enskilda näringsidkare fuskar på annat sätt t.ex. genom att undanhålla inkomster från beskattning.

lZSkattereformens nya regler om överutdelning resp. sparad utdelning samt den nya reglerna för resultatutjämning via avsättning till skatteutjämningsreserv (SURV).

4.3. Skattefusket såsom det avspeglar sig i brottsstatistiken

Den frågeställning som nu kommer att tas upp är om man genom att studera omfattningen och utvecklingen av brottsligheten i kriminalsta- tistiken kan säga något om skattefuskets utveckling. Det kan tyckas som om det borde finnas en parallellitet mellan utvecklingen av anmälda och lagförda skattebrott och omfattningen av den faktiska skattebrottsligheten.

34. Figur. Förhållandet mellan faktiska brott och brottsstatistik

FAKTISKA BROTT

. UPPKLARADE B ROTT

Det visar sig dock, som kommer att framgå av genomgången nedan, att den anmälda och lagförda brottsligheten ger en dålig bild av utvecklingen av den faktiska brottsligheten. Däremot säger uppgifter om anmälda, uppklarade och lagförda brott en hel del om myndigheternas och rättsapparatens hantering av skatte- och gäldenärsbrott.

Rent principiellt kan man undandra skatt på två sätt nämligen genom att undgå att bli beskattad eller genom att undgå att betala debiterad skatt.

Undgå att bli beskattad

I vilken utsträckning upptäcker och anmäler skattemyndighetema straffbara beteenden när det gäller att "undgå att bli beskattad"?

Utvecklingen under senare år, som den återspeglar sig i statistiken över anmälningar och dömda enligt skattebrottslagen framgår av diagrammet nedan.

35. Diagram: Skattebmttslagen

3500 3000 2500 2000 1500 1000

0 o o o o 4- 1 . ,__ __ . T" .. I" .. H*

1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993

Skattemyndsanmälnmgar '___ Amaldömda Varav fängelse

Den senaste tioårsperioden har antalet personer som dömts för skattebrott stadigt minskat. Antalet dömda för skattebrott har föga samband med frekvensen på skattebrott utan är främst en funktion av skattemyndig- hetemas kontrollverksamhet och deras vilja att anmäla brotten till åtal,

När det gäller domar mot skattebrott har dessa sjunkit med 20 procent under tiden 1988-1992. Den kraftiga minskningen av antalet anmälningar år 1992 är dock troligen av engångsnatur och kan hänföras till lägre revisionsvolym till följd av skattemyndighetemas omorganisation och arbetet med skattereformen. Antalet dömda under senare år uppgår till mellan 300 och 450 per år varav kring en fjärdedel —— ca 100 resulterat i fängelsedom. Andelen fängelsedomar är relativt konstant eller svagt sjunkande. Sannolikheten för en person att bli dömd till åtminstone dagsböter för skattebrott är mindre än att bli miljonär genom spel.

Antalet anmälningar eller antalet dömda speglar inte den verkliga frekvensen på skattebrott. Lika lite som svärdet släcker elden kan man utrota brottslighet med straff. Men antalet straffade för skattebrott måste bedömas som otillräckligt. Myndigheternas förmåga att upprätthålla den preventiva effekten av det straffrättsliga sanktionssystemet måste därför bedömas som låg och står inte i överensstämmelse med målsättningen att komma till rätta med det väsentliga skatteundandragandet.

Nu har behandlats skatteundandragande,genom att inte deklarera och lämna oriktiga uppgifter. Nu ska belysas den andra metoden, att inte betala påförd skatt.

Undgå att betala skatt

Frågan gäller kan man från utvecklingen av skatteskulder m.m. och utvecklingen av gäldenärsbrott säga något om skattefuskets utveckling?

Kan man bakom bristande betalningsförmåga skönja ett tilltagande skatteundandragande eller annan brottslighet?

Ett väl fungerande uppbördssystem för skatterna som så nära som möjligt ansluter till inkomsternas intjänande är en viktig förutsättning för att minimera förlusterna till följd av att de skattskyldiga inte betalar. Upp- bördssy stemet fungerar bra för löntagare m.fl. I anslutning till skatterefor- men infördes preliminärskatteavdrag för bankräntor. Genom de nya reglerna fr.o.m. 1993 om preliminärskatteavdrag på sidoinkomster från annan än huvudarbetsgivare har systemet förbättrats ytterligare.

Det finns många orsaker till att företag och personer råkar i betalnings- svårigheter och inte betalar. Något uppsåt att undandra sig betalnings- skyldighet mot staten eller andra fordringsägare behöver givetvis inte föreligga. Men staten tillhör en av dem som påverkas av bristande betalningsförmåga bl.a. genom att skatter inte betalas.

Den högkonjunktur som avslutade 1980—talet har följts av finanskris och en djup lågkonjunktur något som ofta lett till att företag och personer fått betalningssvårigheter. Antalet konkurser har tredubblats mellan 1989 och 1992 och uppgick sistnämnda år till 22 tusen. Flertalet konkurser beror på att de företagsekonomiska förutsättningama inte funnits för verksamheten eller att oförutsedda händelser inträffat.

Det ökande antalet konkurser är en viktig orsak till att de fordringar som lämnas över till kronofogdemyndighetema (KFM) ökat. Den årliga restföringen ställd i relation till skatteuppbörden har från 1989 till 1992 vuxit från 0,8 procent (5,6 mdr kr) till 1,6 procent (11,9 mdr kr). Relativt sett har restföringen av moms ökat kraftigast. Kronofogdemyn- digheterna driver inte in samma andel av nytillkomna skulder som tidigare.

I ungefär var fjärde konkurs rapporterar konkursförvaltarna om att det finns brottsmisstanke. Den vanligaste misstänkta brottsligheten är nu som tidigare bokföringsbrott. Antalet förvaltarberättelser med brottsmisstanke uppskattas ha tredubblats från år 1989 till 1992, vilket givetvis samman- hänger med det ökade antalet konkurser. Det finns anledning att anta att det tar tid att utreda brott mot borgenärer m.m.. I vart fall kan man inte i den officiella rättsstatistiken ännu spåra effekterna av det kraftigt ökade

antalet misstänkta brott vilket framgår av nedanstående två diagram. Båda diagrammen visar antalet personer som godkänt strafföreläggande om ordningsbot eller dömts efter huvudbrott och huvudpåföljd.

36. Diagram: Brott mot borgenärer m.m.

Källa: SCB kriminalstatistik.

1200 1000 800 600 400

o r 4 . . . . . .. .

1982 1983 1984 1985 1986 1987 1988 1989 1990 199] 1992 1993

_Antal " Varaviängelse

37. Diagram: Boldöringslrmtt

Källa: RSV: [infomation om skattebrott 5/94.

1200 1000 800 w 600 400

200

0 + | 1 + » t | | t *r |

1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993

Rättsstatistiken vad gäller brott mot borgenärer och bokföringsbrott visar således inte på någon ökad brottslighet. Frågan är då om det finns några andra indikationer på att brottsligheten ökat.

Närtngsförbud kan meddelas gäldenär som i samband med konkurs förfarit grovt otillbörligt mot borgenär eller om en person upprepade gånger förekommit i samband med konkurs, vid brottslighet som inte är ringa eller om en person i avsevärd omfattning inte har betalt vissa skatter, tullar eller avgifter.

38. Tabell: Antalet personer med näringsförbud vid årets slut Källa: RSV: Kronofogdemyndighetemas verksamhet 1992

År 1987 1988 1989 1990 1991 1992 1993

Nya näringsförbud 45 34 42 38 36 50 49 Totalt vid året slut 174 143 143 141 154 156 163

Antalet näringsförbud har inte ökat nämnvärt under åren 1987-1993. Men som så ofta när det gäller brottsstatistik finns det anledning att vara försiktig med att därav dra slutsatsen att antalet brott inom ramen för näringsverksamhet inte skulle ökat nämnvärt.

Hur förhåller det sig då med den anmälda uppbördsbrottsligheten enligt uppbördslagen?

39. Tabell: Antalet anmälningar från skattemyndighetema och dömda tör uppbördsbrott (79-8155 uppbördslagen)

Källa: RSV:s infomation om skattebrott 8/93

Å r 1987 1988 1989 1990 1991 1992 1993

Anmälningar 1582 1426 1412 1629 1862 659 1071 Dömda 351 388 325 327 375 435 301

Som framgår av tabellen ovan har antalet anmälda uppbördsbrott fallit mycket kraftigt under 1992. Denna minskning torde dock inte vara en följd av minskat antal straffbara handlingar utan främst vara en följd av bristande resurser till följd av skattereformen och ändrad organisation för skatteförvaltningen. Under 1993 har antalet anmälningar ökat men ligger fortfarande på en lägre nivå än vad som varit normalt tidigare år.

Slutsatser om brottsstatistiken och den faktiska brottsligheten

Av statistiken över anmälda brott och lagförda brott bör inga slutsatser dras om utvecklingen av den faktiska skattebrottsligheten. Svärighetema att tillämpa straffbestämmelser är inte unika för skattebrott. Motsvarande gäller mer eller mindre uttalat all strafflagstiftning som syftar till att reglera näringslivet. Kriminella handlingar med ekonomisk inriktning kan begås inom ett utomordentligt brett spektrum av handlingar inom affärslivet. Det är också förhållandevis enkelt att dölja eller försvåra utredning av ekonomiska brott.

Beskrivningen visar främst på en stark sållning vid lagföring av brotten. Men sållning sker inte bara där. Sållning sker i alla led i gransknings- som utredningsförfarandet och hänger samman med bl.a. myndigheternas vilja (prioriteringar) och tillgängliga resurser totalt sett.

Det är oklart vilka effekterna är av sållningsmekanismerna och de långa utredningstiderna dels med avseende på vilka brott som blir utredda (de

enklare att bevisa?) och dels vilka personer som i slutändan blir dömda (den sociala profilen). Det är också svårt att komma till rätta med skattebrott som begås hos en juridisk person där själva handlingen utförs av företrädare eller anställda utan direkt ekonomiskt intresse i företaget.

4.4. Allmänhetens och rådgivamas uppfattning om skattefusk och skattekontrollen

I RSV:s serviceundersökning har allmänheten fått svara på frågor om skattefusket. Frågor har också ställts till Skatterådgivama. Frågorna ställdes hösten 1992.

Allmänheten och rådgivarna har olika uppfattning om skattefuskets utveckling. En majoritet bland allmänheten (59 procent) tror det ökat medan få skatterådgivare år av denna uppfattning (7 procent). En samstämmighet förefaller dock finnas om att skattereformen om den påverkat skattefusket så är det i minskande riktning.

En tänkbar förklaring till skillnaderna i synen på skattefuskets utveckling kan vara att de tillfrågade rådgivarna i första hand kommer i kontakt med övervägande seriösa företag. Det kan möjligen också vara så att företagen i det konjunkturläge som rådde när frågan ställdes hade kredit- och lönsamhetssvårigheter och därför i större utsträckning behövde ta upp sina intäkter i redovisningen. Den breda allmänheten har uppfattningen att skattefusket ökat p.g.a. sämre moral och därför att de antar att intresset för svartjobb ökar under lågkonjunktur.

Till rådgivarna ställdes frågan om hur skattereformen påverkat möjlig- heterna till skattefusk. En majoritet (51%) av rådgivarna anser att skattereformen minskat möjligheterna till skattefusk. Ytterst få rådgivare är av motsatt uppfattning.

1 kommentarer till frågan menar några rådgivare att det rena fusket påverkas i mycket begränsad omfattning av ändrade regler utan att detta beror mer på individen.

Vad gäller kontrollens omfattning är det mycket få rådgivare som är av uppfattningen att skattekontrollen är för stor medan 43% anser den vara för liten.

40. Diagram.

Vad anser Du om skattekontrollens omfattning? Skatterådgivare hösten -92

45% 43% 40% : " 35% 30% 25% 20% 15% 10% S% 0%

ic,/35 ' 10% :; ,:w %%? '.'/%:??? __9'

För liten För stor Ingen åsikt

I kommentarer påpekar några rådgivare att myndigheterna har bristande utredningsresurser och verkar vara mer intresserade av intressanta processer. Man menar att effektiviteten är låg när det gäller det avsiktliga fusket särskilt vad gäller de som struntar i att ha någon redovisning eller när det gäller mycket stora belopp i företags- och fastighetsaffärer. Effektiviteten är hög när det gäller enklare förhållanden som berör bilar, representation och förmåner till företagsledaren dvs. sådant som går att få fram ur de etablerade företagens redovisning.

I sammanhanget kan nämnas att riksdagens revisorer (Rapport 1993/94.6) har granskat den ekonomiska brottsligheten och rättssamhället och funnit att den ekonomiska brottsligheten (brott som utnyttjar företagsformen) förvärrats. Revisorerna pekar på resurs- och kompetensbrist inom rättsväsendet (s. 224 ff) och stora brister vad gäller rättstryggheten medborgarna skyddas dåligt mot denna typ av brott, eftersom de är svåra att upptäcka och lagarna i praktiken inte tillämpas annat än delvis (s.230).

r -- var: _._-'I: %- .1' _: I.

.. :|"..uh1 1111 "IE'.1.'1!"1 111113 111.111: &.111211 1: -|. -.1. '11' 11.11] | Fl'litlnllllllw' - "zu-Lu [111- 411111 1-11 nu ut]-1.1 mm 111 1111141111 1111 Hl'Hdl 111011 ."1' -.=i.1:n.-.1 .:.1m [W' 61,1... '. Mumma-111111” 111161:- | . "'.'-'1|1.'11"111F1'|'. 111111! ' 1:11 1'1211: | ":i: ' '* '.1.'|".'1|'.1—.1 'utmi 11.1?1'11'15'171.

| :. . tm m» 1 _. ”"" . F- '1111'11111111111'111. 01-11 11111 '. . . '1 m ' , skancil'tmk och _ihntmk' m .. . :::'. .:: ,gu . :, '. *_ . ' . ..., ",”_ .'.v . . . ' .'H5911111'1 n... 1": '. .:”J'lkl mu] ._,9]. mot! Imi warm

:: : : _) :E? 1 ”111131! 1133? in nu; . . V ':'" Äg. :::::: aaaeålitwa. . .

1111?111'r'1:1 11913: 111511: Ira 11:11W'15w511'n1 151153 1:11 13111

: : ':'9111 ahlin 11.11 1911 611135 Et iviht utan 1 :I'. 11 I.” ' ' :'.JIE'1|..'1r: '.'11131 'rflincli.g::&|1 Må:? "EP-1:93? ::::

m 111 kfh'jij'tn 01... 1 1'1'II'1' " .1 12:1-

311511. W&Wäntåaä '1'”

:W im ._111r ::::urll'l'vål Wifi:

äm'liål mä [Nha-row 511151 '111 11; ..j ingen-.men mrafleq

. 111111 1111 111. '. :::::'::""1'1' " "111311" ”Wi—1:11;

1-

:a? nnan-6.103. . -_:c'1'1:'r::':|1111nm|.'1akr.l: rilrujlipifimrmu 1111- :::1'1111111'11'..=_Tltm1 firådgit'uru ._ 11.311 anknutning

=P.-NIH" " 1'11 11.1an 'I'|-.'1'1:.|1' |""[!|' "1-131-11'11' 11:11 1101 11'1'18 11131”!!! ... _; ._jxjj'.1.:l,1,'|_-1 hc gjuumj .nu] 11117.th 1l'l |"11'1|.1er—1|.|£"|:'|_ ut'"; ut! H.,-Ju. ”' 1 111. '1111'.|"r."l

- ... 111.311 hmuohuw 01111111011115 En 14 1.1' elin.-1111 IM:-Ewan mm .11'.:i'1' r-mpe'n all Fk'ntkkuhlrg'ltnn 111 I:"; :'(-1 mulm" 113-'. man. '111'11.'1".'411"

=

Bilaga 3

Århundradets skattereform?

Politik och opinion kring 1991 års skattereform

Rapport till KUSK av Rune Åberg

(bygger på en rapport som ursprungligen publicerades hösten 1993)

Rune Åberg är professor i sociologi vid Umeå universitet.

lnnehåH

Politik och opinion kring skattereformen 1990-1991 161

Svensk skattepolitik under efterkrigstiden och skattereformen 1991 162 Partisympati och skatteopinion 168 Skatteopinionens bestämningsfaktorer 172 Egenintresse, allmänintresse, moral och tillit 172 Bestäm ningsfaktorer i sam verkan 174 Den kognitiva dimensionen 178 Hur stabilt blev det nya skattesystemet? 184 Referenser 189

Förteckning av tidigare utgivna rapporter och artiklar från projektet "Opinioner kring 1991 års skattereform" 192

Politik och opinion kring skattereformen 1990-1991

Under 1980-talet initierades eller genomfördes skattereformer i en rad länder. Så skedde bl.a. i USA, Australien, Canada, Nya Zeeland, England och Sverige. Andra länder var också på väg att ersätta sina gamla skattesystem med nya. Utmärkande drag i alla dessa reformer var att skattebasen breddades genom att exempelvis avdragsmöjligheter begränsats och alla kapitalinkomster beskattats. Undantagen från indirekt beskattning av varor och tjänster reducerades avsevärt. De indirekta skatternas andel av skatteintäkterna ökades och de direkta minskades. ln- komstskatten gjordes mer enhetlig och kom att variera mellan ett färre antal inkomstskikt. Exempelvis har antalet nivåer i den svenska skatteska- lan minskat från 10 till 2. De mest uppmärksammade förändringarna var dock de reducerade marginalskattema. I USA sänktes den från maximalt 50 till 28 procent, i Canada från 34 till 29 procent, i Australien från 60 till 49 procent, i Nya Zeeland från 66 till 43 procent, i England från 80 till 40 procent och i Sverige från 72 till 50 procent (Whalley 1990).

Den svenska skattereformen var således inte unik i internationell jämförelse men den kom ändå under den debatt som fördes i anslutning till reformarbetet att kallas för "århundradets skattereform". Det berodde på att den var mer genomgripande än tidigare skattereformer under efterkrigstiden och att det nya skattesystemet antogs bygga på principer som skulle göra systemet robust och kunna bestå i decennier. Till saken hör också att reformen initierades och genomfördes av en socialdemokra- tisk regering. Socialdemokraterna hade mer än andra satt sin prägel på efterkrigstidens skattepolitik men denna gång var det inte så lätt att se hur reformen kunde förenas med traditionella socialdemokratiska värderingar och mål. Hur skulle en sådan radikal skatteomläggning mottas av medborgarna?

Svensk skattepolitik under efterkrigs- tiden och skattereformen 1991

Andra världskrigets speciella förhållanden tvingade fram särskilda skattehöjningar. Bl.a. hade en särskild värnskatt och en serie punktskatter införts. Från borgerlig sida ville man efter kriget sänka skattetrycket och återgå till en "normal" nivå medan socialdemokratema, med sina planer på nya sociala reformer, inte ville reducera statens inkomster men väl sänka skatten för låginkomsttagama vars skattebörda man ansåg vara för tung. Så skedde också efter hård politisk strid kring 1947 års skattere- form. Dock beslöts i samförstånd att effekterna av förändringarna i skattesystemet skulle utredas. Resultatet redovisades i betänkandet Den statliga direkta beskattningen (SOU 1951:51). Här påtalades de höga marginalskatternas skadeverkningar för arbetsvilja, sparande och skattemoral samt behovet av att inflationsskydda skatteskaloma. Man talade om ett utbrett "skattetänkande" som dämpade arbetsutbudet. En sänkning av marginalskatter så väl som en sänkning av den totala skattenivån förordades av utredningen, som också föreslog att man skulle utreda om inte en ökad användning av indirekta skatter vore något för svensk skattepolitik. Men, med hänvisning till det statsfinansiella läget, genomförde inte den socialdemokratiska regeringen skattesänkningsför- slaget. Man återkom dock med en ny reform 1956 där inkomstskatten sänktes, också denna gång i första hand för låginkomsttagama.

Socialdemokraternas skattepolitiska linje under en stor del av efter- krigstiden var att skapa finansiellt utrymme för sociala reformer. Erlander sade i sitt berömda anförande i remissdebatten 1956 bl.a. att den ekonomiska utvecklingen nu lett till "de stora förväntningarnas missnöje" vilka tog sig uttryck i allt större krav på samhällets engagemang för utbildning, bostadsbyggande, vägar etc. Detta, menade han, krävde höga skatter och ett starkt samhälle. Från borgerligt-håll, i första hand från högern men också från folkpartiet, krävde man däremot skattesänkningar och motsatte sig kraftigt socialdemokraternas linje. De menade att ramen för det allmännas förfogande över medborgarnas inkomster borde krympa och att mycket av det Erlander ansåg att samhället skulle ansvara för borde lösas på privat väg (Elvander 1972 s. 106 - 107). Ungefär på samma sätt har ställningarna i denna ideologiskt särskiljande fråga sett ut under hela efterkrigstiden. Men socialdemokraterna, som hade makten fram till 1976, realiserade sina reformplaner. För detta fick de väljarnas stöd vilket tydde på en villighet hos breda folklag'er att också skattevägen bidra till finansieringen. De flesta, inte bara arbetarklassen, måste känna att de fick ut något som ungefär motsvarade deras bidrag. Det satte vissa gränser för hur långt det gick att använda skattepolitiken i inkomstutjäm- nande syfte. Den indirekta, i praktiken regressiva, omsättningsskatt som

infördes 1959 blev således en viktig källa för nya skatteinkomster, vilka i sin tur kunde användas för inkomstomfördelande reformer.

Skattesystem måste ständigt anpassas till nya förhållanden och är därför i ständig förändring. Mot slutet av 1950-talet började man allt oftare beskriva skattesystemet som ett "lapptäcke". I syfte att göra en grundlig översyn av systemet tillsattes en allmän skatteberedning 1960 och i direktiven till den återfinns bl.a. uppmaningen att finna vägar för ytterligare omfördelning från direkt till indirekt beskattning, att diskutera avvägningen mellan beskattning och avgifter som instrument för omför- delning samt att minska den progressiva skatten på mindre inkomster. Men kravet var också att alla förändringar skulle totalfinansieras och således det totala skattetrycket förbli oförändrat (Elvander 1972, s 199). Utredningen arbetade fram ett genomgripande förslag i enlighet med utredningens direktiv vilket presenterades i betänkandet Ny tt skattesystem (SOU 1964125), 1 den efterföljande debatten välkomnades utredningens förslag från borgerligt håll men i de socialdemokratiska leden blev reaktionen i allmänhet negativ. Reformen hade en fördelningsprofil som ansågs orättvis. LO-ordföranden Arne Geijer tog i ett tal på Arosmässan i Västerås avstånd från utredningens förslag. Gunnar Sträng menade även han att skattepolitiken också framgent borde användas för att utjämna inkomstolikheterna och lade så fram en proposition som inte nämnvärt minskade progressiviteten i skatteskaloma, Detta bör ses mot bakgrund av att j ämlikhetsfrågorna, i mitten av 1960-talet, hade börjat få en alltmer framträdande plats i samhällsdebatten. Som indikation på detta kan nämnas att man tillsatte en låginkomstutredning 1964.

Då hade också könsrollsdebatten kommit igång. På det skattepolitiska området innebar det att diskussionen om sambeskattning intensifierades. En familjebeskattningsutredning tillsattes 1965 och i samband med 1970 års skattereform beslutades att äkta makar skulle särbeskattas. Skattelätt- nader infördes för låginkomsttagare och barnfamiljer. Övergången från direkt till indirekt beskattning fortsatte. Både mervärdesskatt och socialförsäkringsavgifter höjdes.

I början av 1980-talet var inte längre fördelningsfrågoma centrala i samhällsdebatten. Skattesystemet utsattes för ny och intensifierad kritik. Det ansågs komplicerat och lapptäckesmetaforen kom till flitig an- vändning igen. Systemet ansågs orättvist därför att det så lätt gick att undgå skatt genom skatteplanering och återigen korn kritiken av de höga marginalskattema i förgrunden, denna gång med begreppet "skattekil" som debattekniskt verktyg. En skattekil utgörs av skillnaden mellan det pris som måste betalas för att ett arbete skall bli utfört och ersättningen efter skatt till den som utför arbetet. Skattekilen blir särskilt stor för extraarbete utfört av höginkomsttagare om marginalskatten är hög. Det antas minska sannolikheten att dessa skall utföra extra arbetsinsatser vilket i så fall snedvrider resursallokeringen. Stora skattekilar kan också skapa incitament för skattesmitning. Ett annat problem som blev särskilt

påtagligt i slutet av 1970-talet var att underskottsavdragen sköt i höjden, särskilt bland höginkomsttagare. Genom ränteavdragen kunde skatten reduceras och med inf1ationens hjälp skulden betalas, Således kom den faktiska progressiviteten i skatteuttaget att avta trots att skatteskaloma förblev oförändrade (Åberg, Selén och Tham 1984). Skattesystemet som fördelningsinstrument hade blivit mindre effektivt. I syfte att åtgärda dessa problem genomfördes en relativt radikal marginalskattereform 1982. Marginalskatten sänktes då till 50 procent för de flesta heltidsarbetande inkomsttagare, men för höginkomsttagama förblev den högre, drygt 70 procent. Värdet av underskottsavdragen begränsades samtidigt till 50 procent.

Trots dessa förändringar fortsatte kritiken mot skattesystemet. Kritiken var densamma som före reformen och det föreföll som om de förändring- ar i systemet som faktiskt genomförts varit betydelselösa. Skattesystemet ansågs forfarande inte ha någon nämnvärd inkomstutjämnande effekt; det karaktäriserades fortfarande som krångligt och lätt att utnyttja för skatteplanering —— en kritik som den politiska vänsteropinionen kunde dela. Från moderat håll var det i första hand det höga skattetrycket som angreps, men också de höga marginalskatternas skadeverkningar för tillväxt och skattemoral kritiserades. Också finansminister Feldt gjorde hösten 1986 ett angrepp på marginalskattema. Från SACO presenterades ett av många lovordat förslag till nytt skattesystem som hade vissa likheter med det som infördes i USA samma år (Lindencrona m.fl. 1986). Knappt någon samhällsdebattör försvarade det gamla systemet och man kunde också i opinionsmätningar notera ett växande missnöje bland med- borgarna med det existerande skattesystemet (Riksskatteverket 1993). Kritiken hade gett effekt men fortfarande var synen på skattepolitiken en ideologiskt särskiljande fråga bland befolkningen. Av borgerliga partisympatisörer var det 48 procent som accepterade ett progressivt skattesystem och 43 procent som ville ha en skattegräns på högst 50 procent; bland socialistiska partisympatisörervar motsvarande procent- andelar 63 procent och 21 procent. Höginkomsttagarna bland socialisterna hade en uppfattning som låg rätt nära de borgerliga sympatisöremas (Finndahl 1986).

Året därpå, 1987, tillsatte regeringen tre olika skatteutredningar, bl.a. en om reformerad inkomstbeskattning (RINK). Dess direktiv var att sänka skattesatserna och minska progressiviteten i skatteskaloma, att begränsa avdragsmöjligheterna, att skapa större enhetlighet ikapitalbe skattning och stimulera sparande, att förenkla systemet och utforma det så att det kunde bli bestående under lång tid. Men också denna gång var direktivet att en framtida reform till fullo skulle finansieras (SOU 198933).

1 valrörelsen 1988 kom skattepolitiken att få en framskjuten plats. Moderaterna drev som vanligt kravet på skattesänkningar. Folkpartiets ledare, Bengt Westerberg, förde fram förslag om genomgripande reformering av skattesystemet. Det innehöll förslag om begränsning av

marginalskatten för alla heltidsarbetande till 40 procent vilket skulle finansieras genom nedskärningar på det sociala området och med en sänkning av grundavdraget. Förslaget betraktades som orättvist och oacceptabelt ur fördelningssynpunkt av socialdemokraterna, som gjorde kampen mot Folkpartiet och deras skatteförslag till den viktigaste måltavlan i valrörelsen. Socialdemokraterna vann valet men omedelbart därefter började det stå klart att deras egna strävanden skulle gå åt samma håll som folkpartiets i denna fråga (Åsard och Bennett 1992).

Kjell—Olof Feldt (1991) berättar i sina memoarer hur Erik Åsbrink, ordförande i de tidigare tillsatta skatteutredningarna, tidigt på hösten 1988 presenterade honom skissen till en genomgripande skattereform som "... gick långt utöver vad för mandat vi än kunde sägas ha fått av partikong- ressen. Och den avlägsnade sig nog ännu mer från vad socialdemokrater i allmänhet väntade sig av våra reformplaner" (a.a. s 380). Detta krävde att förslaget, som fick Kjell-Olof Feldts och Ingvar Carlssons gillande, förankrades på olika nivåer i partiet — i regeringen, hos LO, i riksdags- gruppen. Så skedde också med insatser från centrala aktörer, i första hand finansminister Feldt, vars betydelse för utgången troligen är fullt jämförbar med Reagans insatser för den amerikanska skattereformens tillblivelse. Förslaget till nytt skattesystem måste slutligen godkännas av riksdagen vilket krävde stöd från ett annat parti. Det blev Folkpartiet som ju tidigare hade varit inne på samma reformlinje som den skisserade. Slutligen borde även partivänner ute i landet vinnas för de nya skattepoli- tiska idéerna, vilket bl.a. skulle ske i ett rådslag. Emellertid inväntade man inte resultatet av detta innan man gjorde upp med Folkpartiet. Förslaget om ett nytt skattesystem kunde därefter antas av riksdagen. Denna process står i bjärt kontrast mot det ihärdiga och utdragna förankringsarbete som Gunnar Sträng ägnade sig åt innan den inom den socialdemokratiska rörelsen kontroversiella omsättningsskatten infördes 1959 (Elvander 1972 5.145 och 321-322).

För att vinna de egna för reformförslaget var det viktigt att bemöta kritiken om att förslaget skulle vara fördelningspolitiskt orättfärdigt. Det gjorde man genom att hävda att reformen måste ses i sin helhet och inte enbart som en marginalskattesänkningsreform. Betraktad på det sättet menade man att de flesta skulle tjäna på den. Skälen var bl.a. att högin- komsttagarnas underskottsavdrag skulle bli mindre värda och kapitalskat- ten skärpas, barnbidragen höj as och ökade hyreskostnader balanseras med höj da bostadsbidrag. Sannolikt skulle också de dynamiska effekterna leda till ökad tillväxt och höjda löner. Allt måste ses i ett sammanhang och utredningar visade att fördelningseffekterna inte skulle bli negativa.

En sådan utredning var den som gjordes inom ramen för RINK (Eklind och Johansson 1989). Förutsättningarna i dessa kalkyler var att de dynamiska effekterna skulle leda till en inkomstökning på 1 procent på kort sikt och 4 procent på lång sikt samt att reformen var överfinansierad på lång sikt vilket gjorde att nästan 10 miljarder av momshöjningen

skulle kunna återföras till hushållen. Därutöver beaktade man kända regeländringar och basbreddningar enligt förslaget. Barnbidragshöjningen liksom justeringarna i bostadsbidraget beaktades också. Några antaganden om beteendeförändringar utöver de som ligger i antagandet om dynamis- ka effekter gjordes inte. Resultatet blev att endast de med mycket låga och mycket höga inkomster skulle få sänkt disponibel inkomst på kort sikt. På lång sikt identifierades inga förlorare. Alternativet med uteblivna dynamiska effekter beaktades inte. Det var då inte konstigt att utfallet korn ganska nära det som i ekonomisk välfärdsteori brukar kallas paretoeffektiv förändring, dvs. en förändring som leder till förbättring för någon utan att medföra försämring för någon annan. I debatten kom sedan reformens tillskyndare att framför allt utpeka nolltaxerare och skatteplanerare som reformens förlorare.

lnom LO gjorde man också beräkningar av reformens fördelningseffekter men utan att anta dynamiska effekter och utan att beakta barnbidragshöj- ningen vilket ledde till att rätt många beräknades förlora på den. Utredningen kritiserades hårt för sina orealistiska antaganden och för att individers inkomster och skatter beräknats på felaktigt sätt. Man gjorde då en ny "hushållsstudie" som visade att reformen inte skulle resultera i ökad inkomstspridning (LO 1989). Rättviseprincipen i denna studie var inte den paretoeffektiva. Istället undersökte man om skillnaden mellan grupper skulle öka eller minska, vilket är det intressanta måttet för den som föredrar en relativ rättviseuppfattning. Gustafsson och Schwarz (1990) visade också att inkomstspridningen sannolikt inte skulle påverkas negativt av reformen, men de påtalade den stora osäkerhet, särskilt på lång sikt, som ligger i att beteendeantaganden inte kunnat beaktas.

Dessa fördelningsanalyser utgjorde viktiga argument mot dem som vände sig mot reformen därför att den hotade försämra den "vertikala rättvisan". Ingen kunde förneka att marginalskattesänkningen skulle gynna högin- komsttagare, men genom att betona helhetsperspektivet kunde man hävda att reformen faktiskt låg i linje med socialdemokratisk reformtradition på skatteområdet _ att förskjuta tyngdpunkten i fördelningspolitiken från skatter till transfereringar, att förskjuta finansieringen från inkomstskatter till indirekta skatter och socialavgifter samt att reformera kapitalbe- skattningen och bredda skattebasen. Betraktad i sin helhet skulle således reformen inte göra avkall på de fördelningspolitiska ambitionerna men ändå befrämja den ekonomiska tillväxten; i så fall, en reform i linje med traditionell socialdemokratisk politik. Dessutom skulle den "horisontella rättvisan", där alla med samma skatteekonomiska förutsättningar behandlas lika, förbättras radikalt. Det skulle nu inte gå lika lätt att skatteplanera och undgå skatt för dem som kunde knepen.

Ledande socialdemokrater och fackföreningsfolk kom, efter det att vissa modifieringar i det ursprungliga förslaget gjorts, att acceptera skattere- formen och därmed också de förväntade konsekvenser den kunde få för inkomstfördelningen. Man får utgå ifrån att deras bedömning var att

reformen inte skulle leda till ökad inkomstspridningl. Men på den punkten var i så fall åsiktsklyftan mellan dem och folket stor. Samtidigt som ekonomin gick på högvarv i slutet av 1980-talet och budgetunder- skottet hade eliminerats gjorde den socialdemokratiska regeringen klart att den offentliga sektorn måste bantas. Särskilt de accelererande utgifterna för socialförsäkringarna måste sänkas och någon höjning av skattetrycket kunde inte komma ifråga. Ett helhetsperspektiv på politiken gav intryck av att en sänkning snarare än av höjning av de fördelnings— politiska ambitionerna stod för dörren. Skattereformen, betraktad som en del i ett större ekonomiskt-politiskt sammanhang, kunde lika gärna uppfattas som ett av stegen bort från en ambitiös jämlikhetspolitik, som en reform i linje med densamma. Av data som redovisas längre fram i denna text, kan konstateras att människor i allmänhet, höginkomsttagare såväl som låginkomsttagare, oavsett inkomstnivå, uppfattade att skattere— formen gynnade höginkomsttagama och missgynnade låginkomsttagama. Men om de fördelningspolitiska effekterna skulle bli de förväntade borde en sådan uppfattning hos medborgarna ändras då det verkliga utfallet blev känt. Då skulle höginkomsttagama se att de inte varm så mycket som de trodde och låginkomsttagama se att det inte var de som var förlorarna. Det nya skattesystemet skulle gradvis accepteras bland socialdemokratins väljargrupper.

' Se t.ex. LO-ordföranden Stig Malm, Dagens Nyheter 1989-10-09, "... vi ställer helhjärtat upp på radikalt sänkta marginalskatter. Detta kan vi göra mot bakgrund av att vi nu har en helhetsbild av hur ett reformerat skattesystem skulle kunna konstrue- ras"; eller TCO-ordföranden Björn Rosengren, Svenska Dagbladet, 1990-04-29, "Skattebördan får inte vältras över från höginkomsttagare till låginkomsttagare. Utsatta grupper får inte drabbas av generella försämringar. De villkoren år av allt att döma uppfyllda. "

Partisympati och skatteopinion

En opinionsundersökning utförd av DN/T emo strax efter det att det nya skattesystemet trätt i kraft, januari/februari 1991, visade emellertid att så många som 60 procent av de socialdemokratiska sympatisörerna stödde reformen. Av vänsterpartiets sympatisörer var stödet bara 30 procent (Dagens Nyheter, 1991-03-10). Ändå tillskriver somliga valanalytiker skattereformen en stor del av förklaringen till socialdemokraternas valförlust 1991 (Korpi 1993). Klart är att många socialdemokrater inte kände igen sitt parti i slutet av 1980-talet och, som tidigare nämnts, var det svårt att se hur skattereformen var förenlig med den politiska retorik partiet utvecklade inför valet 1988. T.ex. visade Statistiska Centralbyråns partisympatiundersökning i november 1990 att av dem som röstade på socialdemokraterna 1988 var det så många som 42 procent som inte visste vilket parti de skulle rösta på eller om de alls skulle rösta inför valet 1991. Denna siffra brukade vid tidigare jämförbara tillfällen vara ca 10 procent (Åberg 1991). Skattereformens betydelse i sammanhanget är svår att fastställa men den politiska vänsteropinionen, för vilken fördelningsfrågor är centrala, hade svårt att acceptera skattereformen. Det jämförelsevis starka stöd för reformen inom socialdemokratin som ovanstående data indikerar är sannolikt ett resultat av att denna vänster- opinion i partiet blev relativt svag därför att så många av dem då inte längre identifierade sig med partiet. Socialdemokraterna hade ju, vid tiden för DN/Temos undersökning, tappat uppemot 30 procent av sina forna sympatisörer. Kvar var de sympatisörer som stod längre till höger och de stödde reformen till stor del. Att det just var vänstersympatisörema som lämnade partiet under denna period framgår av den valanalys Korpi gjort (Korpi 1993, s 23).

Moderaterna hade också invändningar att resa mot reformen. De var naturligtvis inte emot marginalskattesänkningen men man var missnöjd med att den skulle finansieras till fullo. Under 1940 och 1950-talen drev Högern en hård skattesänkningslinje. Under 1960-talets samförståndsanda tonades dessa krav ned men de intensifierades igen av Moderata samlingspartiet under 1970 och 1980—talen. Bakom denna skattepolitiska syn ligger tron på det höga skattetryckets skadeverkningar för den ekonomiska tillväxten, uppfattningen att skatten inskränker friheten och att det är orättvist att hårt beskatta höga inkomster och stora förmögenhe- ter. Fördelningsfrågorna är också viktiga på den politiska högerkanten, men rättviseuppfattningarna är här inte desamma som inom den politiska vänstern. Inom Bondeförbundet, sedermera Centerpartiet, har man haft en syn på fördelningsfrågoma som i vissa avseenden legat nära socialde— mokratemas, men man har ofta ställt sig tvekande till det höga skatte- trycket. Dock får man säga att partiets profili skattefrågor varit något otydlig. Folkpartiet har traditionellt legat relativt nära Moderaternas uppfattning om marginalskattema, men de har inte betonat skattesänk- ningskravet lika starkt som dem. Det var också Folkpartiet som gjorde

upp 1989 med socialdemokraterna och accepterade därmed att reformen skulle totalfinansieras. De gjorde också upp med socialdemokraterna 1981 ("den underbara natten", 23 - 24 april) om relativt kraftiga marginalskat- tesänkningar i det som blev 1982 års skattereform. Nu, 1993, försvarar partiet den generella välfärdspolitiken och går kraftigt emot moderaternas skattesänkningspolitik.

Moderater kan således antas ha gillat marginalskattesänkningen men 0 gillat totalfinansieringen och skärpningen av kapitalskatten, centerpartis- ter ogillat marginalskattesänkningen och kapitalskatteskärpningen men i övrigt varit osäkra på sin hållning. Folkpartister var måhända de vars politiska preferenser bäst stämde överens med skattereformens inriktning. Den nämnda opinionsundersökningen visade också att det bland folk— partiets sympatisörer var nästan 60 procent som stödde reformen. Bland moderater var stödet drygt 50 procent och bland centerpartister drygt 30 procent. Lägst var stödet bland miljöpartister där det låg på ca 20 procent. Ny demokrati var ännu inte bildat.

Stödet för reformen varierade således med partisympati men kanske inte så mycket som man kunnat förvänta sig i en fråga av sådan partipolitisk betydelse, en fråga mitt i den politiska höger-vänsterdimensionen. Huvudskälet till detta är den tidigare nämnda rörligheten i partisympati. Denna rörlighet är inte oberoende av de värderingar som hänger samman med inställning till skattereformen, vilket senare Opinionsundersökningar om skattereformen visat. Sådana har genomförts vid fyra tillfällen mellan mars 1991 och september 19922. Vid första mätningen stödde 45 procent av medborgarna reformen och vid sista mätningen var siffran 46 procent. Motståndet hade sjunkit från 20 procent till 15 procent och osäkerheten ökat från 35 procent till 38 procent (Åberg och Edlund 1993). Opinions- förskjutningarna i befolkningen som helhet var således ytterst små under de arton första månaderna efter det att reformen trätt i kraft. Däremot visar diagram 1 att stödet förändrats inom olika politiska partier.

2 Undersökningarna. som ingår i projektet "Opinioner kring 1991 års skattereform". har finansierats av Kommittén för utvärdering av skattereformen (KUSK) och utförts vid sociologiska institutionen, Umeå universitet. Tre av datainsamlingarna har gjorts genom att tilläggsfrågor ställts till ett urval på ca 4000 personer i arbetskrafts- undersökningarna. Detta skedde i mars och september 1991 samt september 1992. Den fjärde datainsamlingen utfördes som postenkåt, mars 1992, till ett riksrepresentativt urval på ca 2000 personer. Bortfallen blev i samtliga fall omkring 25 procent.

Diagram 1 Andel som stöder skatterefomlen efter partisympati i DN/Temos skattning januari 1991 och vid två olika undersökningarmars 1992 (A från "Konsensuell fattigdom", B från "Opinioner kring 1991 års skatterefonn'T.

Procent

Diagrammet uppvisar dock större förändringar än vad som faktiskt var fallet. En hel del av förändringarna kan tillskrivas slumpfel, bortfallsfel och mätfel. Särskilt är förändringar inom små partier osäkra eftersom bastalen här är mycket små. Andra skillnader beror på att olika datain- samlingsmetoder använts. Därför är det meningslöst att kommentera alla enskilda förändringar. Dessa problem med Opinionsundersökningar illustreras genom att det i diagrammet finns redovisat resultat från två oberoende undersökningar utförda i mars 19923. Den viktiga slutsats som dock kan dras från dessa data är att stödet för skattereformen gradvis minskat inom det socialistiska blocket och stärkts inom det borgerliga. Detta understryks ytterligare av data från undersökningen i september 1992. Då ställdes ingen fråga om partisympati men väl en fråga om det var bra för landet att Sverige fick en ny regering efter valet 1991. (Den socialdemokratiska regeringen ersattes då av en borgerlig fyrpartirege- ring.) Om man antar att de som svarade nej på frågan i de flesta fall tillhörde det socialistiska blocket, och de som svarade ja borgerligheten, så var stödet för skattereformen bland de borgerliga 64 procent men bara 35 procent bland socialisterna och ungefär lika lågt bland de osäkra till nyttan av regeringsskiftet. *

3 Undersökning A är en intervjuundersökning av ca 1000 individer medan under— sökning B är en postenkät till ca 2000 individer. Dessutom är frågeformuleringarna något olika i de båda undersökningarna. Undersökning A ingår i projektet "Konsensu- ell fattigdom" (Halleröd m.fl. 1993) och B är den postenkät som ingår i "Opinioner kring 1991 års skattereform", båda utförda vid sociologiska institutionen, Umeå universitet.

Detta samband mellan stödet för skattereformen och en politisk höger- vänster dimension har troligen varit stabilt under hela den studerade perioden men sambandet mellan partisympati och reformstöd kan ha ändrats allteftersom människor rört sig ut ur och in i olika partier. Särskilt inom socialdemokratin har Opinionsbilden härigenom ändrats, något som kan ha stor betydelse för reformens framtida öde. Men det är viktigt att ha i minnet att de som inte stöder reformen endast till liten del utgörs av dem som är motståndare till den; de flesta av dem är osäkra och för många börjar troligen det gamla skattesystemet att alltmer falla i glömska.

Skatteopinionens bestämningsfaktorer Egenintresse, allmänintresse, moral och tillit

De som utgår ifrån ett så kallat "public choice"-perspektiv vid analyser av politiskt beteende har som grundantagande att människor tar ställning i olika politiska frågor utifrån en individuell nyttokalkyl. De ser med andra ord egenintresset som det som styr inställningen till politiska reformer. 1 konsekvens med detta antagande skulle man förmoda att de som tror sig vinna på en skattereform, eller ett existerande skattesystem, också skulle vara positivt inställda medan förlorarna skulle reagera negativt. Denna grundhypotes om Skatteopinionens bestämning är också den som de flesta studier om attityder till skatter tar som första ut- gångspunkt. Exempelvis fann Vogel (1974), som studerat inställningen till det svenska skattesystemet 1969, klara samband mellan inkomst och missnöje med marginalskattema liksom med det totala skatteuttaget; motståndet mot skattesystemet var starkare bland höginkomsttagama än bland låginkomsttagama. Scholz, McGraw and Steenbergen (1992), som studerat de opinionsmässiga följderna av den amerikanska skattereformen 1986, fann att de som trodde sig tjäna ekonomiskt på reformen också såg positivt på den i andra avseenden, bl.a. ur rättvisesynpunkt, medan förlorarna var negativt inställda. Hadenius (1986), som studerat den svenska skatteopinionen 1981/82, finner däremot inget samband mellan inkomst och missnöje med skatterna men väl ett starkt samband mellan den subjektiva uppfattningen om den egna ekonomiska situationen och inställningen till skatterna; de som anser sig ha det dåligt ställt är mer missnöjda med skatterna än de som anser sig ha det bra. Lewis (1982), som gjort en översikt över forskningen om "skatternas psykologi", använder "the economic man"-metaforen i detta sammanhang och menar att den upplevda ekonomiska situationen tycks betyda mer än den faktiska inkomsten för inställningen till skatterna men likväl är det en individuell nyttokalkyl som ligger i botten. Denna "egenintressehypotes" ges också visst stöd i de data som presenteras i tabell 1 där man kan se att stödet för skattereformen är betydligt större bland de subjektiva vinnarna än bland förlorarna.

Emellertid har föreställningar om "the economic man" och "public choice"-skolans grundantagande ofta ifrågasatts. Man kan ju tänka sig att nyttokalkylen inte är så kortsiktig och inte heller alltid så egoistisk som där antas; den kan ju ha det långsiktiga helhetsperspektivet i fokus. Detta leder tankarna till begrepp som allmänintresse och "det gemensamma bästa". Leif Lewin (1988) har, med stöd i empirisk forskning, hävdat att allmänintresset oftare är starkare än det kortsiktiga egenintresset då det gäller att ta ställning i viktiga politiska frågor. Argumentet att skattere- formen skulle åstadkomma dynamiska effekter och vara bra för sam- hällsekonomin är ett argument som kan sägas vädja till allmänintresset eller det gemensamma bästa. På lång sikt kan man anta att de flesta tjänar på en reform som leder till sådana effekter. Tabell 1 visar också att

de som tror på denna argumentation oftare stöder reformen än de som inte tror på den.

En annan typ av kritik mot " public choice"-antagandet är att de kriterier gentemot vilket individer värderar politiska åtgärder inte behöver vara ekonomisk vinst eller högsta effektivitet. Det kan också röra sig om moraliska värden. Etzioni (1988) är en av dem som utförligt diskuterat den moraliska dimensionens betydelse för mänskligt handlande och därvid kort berört den betydelse den kan ha för inställningen till skatter. Han betonar att ett legitimt skattesystem är ett system som svarar mot rådande moraluppfattningar. Problemet, som han inte diskuterar närmare, är emellertid att dessa moraluppfattningar på skattepolitikens område inte är enhetliga utan varierar mellan människor och samhällsklasser. I vissa grupper är t.ex. jämlikhet och social rättvisa högt värderade värden. En skattereform som inte svarar upp mot dessa värden bland dem som omfattar dem, uppfattas inte där som legitim. I tabell 1 kan vi till exempel se att de som anser reformen vara rättvis oftare stöder den än de som anser den vara orättvis.

Legitimiteten kan också vila på ett förtroende och stöd för det som skatterna går till. Tror man att pengarna används till vettiga ändamål är det också troligt att man betalar skatt med mindre motvilja än om man tror att de slösas bort eller går till sådana som inte borde få del av dem. 1 Sverige tycks dock stödet för det som en stor del av skattemedlen går till, nämligen välfärdspolitiken, vara relativt starkt. De som anser att den mängd skattepengar som går till sjuk- och hälsovård, stöd till äldre, stöd till barnfamiljer, till skola och forskning och till sysselsättningspolitiska insatser bör öka är betydligt fler än dem som vill minska utgifterna för dessa ändamål. Tvärt om är det dock med bostadsbidrag, socialbidrag och offentlig administration. Men opinionsövertaget för den förstnämnda gruppen av offentliga utgifter, skola och forskning undantagen, är större, och opinionsunderläget för den senare gruppen mindre bland kvinnor än bland män, bland arbetare än bland högre tjänstemän och företagare. De lägre tjänstemännen intar här en mellanställning. Vidare har de med borgerliga partisympatier alltid haft en betydligt svalare inställning till välfärdsutgifterna än de med socialistiska sympatier. Den bilden har framträtt i alla undersökningar om välfärdsopinionen sedan början av 1980-talet (Hadenius 1986; Svallfors 1989", Svallfors l992b). Den skattereform som genomfördes 1990/91 hade emellertid lite att göra med utgiftssidan. Den innebar i huvudsak att skattepengarna inkasserades på ett nytt sätt varför det knappast finns någon anledning att tro att det skulle finnas något samband mellan inställningen till ändamålet med skatterna och skattereformen. Möjligen kan man anta att de som är missnöjda med det utgifterna går till och samtidigt uppfattar sig som skattereformens förlorare borde vara särskilt missnöjda med reformen; vinnare som är missnöjda med utgifterna borde vara särskilt nöjda med reformen. Data som inte redovisas här visar dock att om man konstant- håller för uppfattning om reformens utfall för egen del, finner man ingen

skillnad i stödet för reformen mellan dem som anser att skatterna är för höga, med hänsyn till de förmåner som staten ger, eller dem som accepterar skattenivån.

Men frågan om legitimitet kan också ha att göra med förtroende och tillit till den som företräder ett förslag. En av Etzionis kritikpunkter av rationalitetsantagandet går ut på att många handlingar utförs, och attityder tillägnas, utan att någon nyttokalkyl alls äger rum. Man gör som man alltid gjort och förlitar sig på dem man tidigare förlitat sig på. Ex- empelvis kan en socialdemokrat därför komma att stödja reformen enbart därför att det var ett förslag som kom från det parti han eller hon har förtroende för; en moderat kan av samma skäl ta avstånd. Här visar det sig emellertid att stödet bland borgerliga sympatisörer är starkare än bland socialister.

Tabell 1 Samband mellan uppfattningar om refomiens effekter och stödet för lefomien, september 1992.

Anser du att det var ett riktigt beslut att införa det nya

skattesystemet? Ja Nej Vet ej Antal

Tillhör reformens

—— vinnare 77 8 15 100% 812 — förlorare 25 36 39 100% 757 Anser att reformen

— bra för samhällsekonomin 79 5 17 100% 743 — dålig för samhällsekonomin 32 33 35 100% 971 — försvårar skatteplanering 63 15 22 100% 1138 —- underlättar skatteplanering 59 18 24 100% 338 — är rättvis 81 5 14 100% 823 är orättvis 35 33 32 100% 1047 Anser att det var

— bra med regeringsskiftet 64 8 29 100% 1244 _ dåligt med regeringsskifte 35 24 41 100% 1400

*För varje fråga finns också neutrala svar (varken eller) eller "vet ej"-svar. Dessa har utelämnats ur tabellen.

Bestäm ningsfaktorer i samverkan

Så här långt kan konstateras att det finns flera bevekelsegrunder utifrån vilka människor formulerar sina åsikter om skattereformen, och alla tycks de få visst stöd i data. Detta är knappast förvånande eftersom de tenderar att hänga samman med varandra. I enlighet med Heiders balansteori

(1958) försöker människor att undvika oförenliga ståndpunkter, åsikter och attityder. Visserligen förekommer ofta sådana hos en och samma individ men som regel är detta ett instabilt tillstånd. Det är stor sannolik- het att en åsikt i en för individen mindre väsentlig fråga ändras om den är oförenlig med hennes mer grundläggande värderingar. T.ex. är det troligt att en person som uppfattar skattereformen som orättvis men tror sig tillhöra skattereformens vinnare, tror på dess samhällsekonomiska fördelar och har borgerliga politiska värderingar, så småningom neglige- rar betydelsen av rättvisefrågan i sitt ställningstagande till reformen och kanske även börjar se reformen som rättvis. Normkällan är inte heller oväsentlig i sammanhanget. Den person som uppfattar reformen som orättvis kan vara socialdemokrat med starkt förtroende för partiets politik. Det faktum att reformen förts fram av hans parti med samhällsekonomis- ka argument och försäkringar om att resultatet inte skall bli orättvist kan få honom att tvivla på sin inställning i rättvisefrågan, alternativt att här se rättviseargumentet som underordnat. Men, det kan också gå tvärt om som vi sett. Rättvisekänslan, särskilt om den är understödd av egenintres- set, kan vara starkare än tillit och partilojalitet varför personen ändrar sina partisympatier. Den eftersträvansvärda värderingsharmonin kan således uppnås på många olika sätt. 1 tabell 2 ges en illustration till hur åsikterna om skattereformens effekter hänger samman. Reformens uppfattade effekter för den egna ekonomin har där relaterats till uppfattningar om dess effekter i andra avseenden'l.

Tabell 2 Sambandet mellan reformens fömiodade effelder på den egna ekonomin och uppfattningar om dess effekter för samhällsekonomi, skattemoral, rättvisa samt politisk grundvärdering, september 1992.

Tror sig tillhöra...

Vinnarna Varken eller/ Förlorare Alla Vet ej

Tror på förbättrad _ samhällsekonomi 36 20 14 23 skattemoral 48 29 34 35 —— rättvisa 47 21 12 25 Stöder regeringsskihet 51 37 26 38 Tror på försämrad _— samhällsekonomi 21 25 50 30 —— skattemoral 12 9 1 1 10 _— rättvisa 27 23 58 32 Stöder ej regeringsskiftet 35 39 60 43 Antal 813 1695 758 3265

4Sambandet mellan de olika åsikterna om skattereformens effekter har på ett mer ingående sätt analyserats i Åberg och Edlund 1993.

Tabellen visar att de som själva uppfattar sig som vinnare oftare än andra tror att reformen har gynnsamma effekter på samhällsekonomin och skattemoralen samt att det nya skattesystemet är mera rättvist än vad det gamla var. Bland vinnarna återfinns oftare borgerliga sympatisörer än socialistiska. Bland dem som ser sig som reformens förlorare är bilden den motsatta.

Sambandet mellan människors egenintresse och deras uppfattningar om det gemensammas bästa är ur politisk synpunkt synnerligen centralt. Nästan all politisk argumentation och retorik går ut på att framställa den egna politiken som det bästa för allmänintresset eller som det moraliskt nödvändiga, ibland också som det enda möjliga. Sällan är det med renodlade gruppegoistiska argument den politiska debatten förs. Det är lätt att övertyga dem som upplever sig som gynnade av en viss politik att denna också är rättvis och/eller nödvändig för hela samhället på lång sikt. Svårare är det för dem som anser sig förlora på politiken att acceptera att deras förlust skall vara nödvändig för det gemensammas bästa, särskilt om man befinner sig i de lägre inkomstskikten och det är framför allt där man finner dem som anser sig ha förlorat på skattereformen (Tabell 3).

Tabell 3 Uppfattningar om att vara reformens vinnare eller förlorare i olika inkomst- klasser', september 1992.

Månadsinkomst, kr. (8.000 842.000 12—16000 16-20.000 >20.000

Andel som ser sig som reformens

— Vinnare 12 17 28 56 73 — varken eller 37 40 42 32 18 förlorare 33 30 22 8 4 vet ej 19 14 9 5 5

100% 100% 100% 100% 100% Antal 294 695 738 286 153

Medborgarnas uppfattning om skattereformens . fördelningseffekter är relativt entydig. Höginkomsttagarna uppfattar sig som vinnare och låginkomsttagama uppfattar sig som förlorare eller också är de osäkra om fördelningseffekterna. Stödet för reformen är också betydligt starkare bland höginkomsttagare än bland låginkomsttagare; det är starkare bland högre tjänstemän än bland arbetare, och det är starkare bland män än bland kvinnor. Det är med andra ord bland socialdemokratins traditionella väljargrupper som stödet är svagast. Detta mönster har varit detsamma i alla undersökningarna, möjligen har det skett en viss polarisering så till vida att de högre tjänstemännen blivit något' mer övertygade om reformens fördelar och arbetarna något mindre övertygade (tabell 4).

Tabell 4 Andel positiva till det nya skattesystemet efter kön, yrke och inkomst vid tre tidpunkter. Pmcentandelar skattade med s.k. logit-analyss.

Kön Yrkesgrupp Inkomst 1991 1991 1992 kr. Mars September September

Mim Ej facklård arbetare 8- 12.000 48 41 43 Facklärd arbetare 8-12.000 48 45 37

12-16.000 52 52 48

Lägre tjänsteman 12- 16.000 57 62 65 Mellan tjänsteman 12-16.000 64 72 71

16-20.000 71 80 76

Högre tjänsteman >20.000 79 87 91

Kvinna Ej faeklård arbetare 8- 12.000 30 25 26 Facklärd arbetare 8-12.000 30 29 29

12-16.000 34 35 40

Lägre tjänsteman 12-16.000 39 45 46 Mellan tjänsteman 12-16.000 46 45 52

16-20.000 54 56 59

Högre tjänsteman >20.000 64 84 74

A nm. Inkomsten avser genomsnittlig bruttohushållsinkomst/månad av lön per vuxen person i hushållet. Yrkesklassiticeringen sker enligt SEI. Företagare och lantbrukare ingår ej i analysen.

Även en rad andra faktorers betydelse för en positiv inställning till reformen har studerats. Bland dessa kan nämnas sektor (offentlig privat), utbildning, ålder, bostadstyp, ortstyp och familjetyp. Inga av dessa variabler har signifikanta effekter i multivariata analyser där också yrkesgrupp, inkomst och kön ingår. Kvinnornas åsikter skiljer sig från männens så till vida att de oftare uppger "vet ej"—svar på frågan om reformbeslutet var riktigt eller ej. Allt annat lika, anser de också oftare än män att reformen varit orättvis (Åberg och Edlund 1993; Andersson 1992).

Återigen finner vi att det är inom de borgerliga partiernas väljarbas som stödet är starkast medan det i den politiska vänsterns Välj arbas är svagare. Frågan är om man rätt uppfattat reformens faktiska effekter.

5Fördelen med att använda förväntade värden, skattade från den loglinjära modellen, istället för observerade värden är att variablernas effekter då renodlas eftersom effekter från icke-signifikanta interaktioner elimineras. Dessutom skulle de mycket små bastalen i en mångdimensionell tabell göra skattningama osäkra. En mera fullödig redovisning av de statistiska parametrarna i modellen återfinns i Åberg och Edlund 1993.

178 Opinionens bestämningsfaktorer Den kognitiva dimensionen

En analys av Opinionsbilden kring det nya skattesystemet skulle vara ofullständig om den inte också belyste den kognitiva dimensionen. Hur något år beskaffat och vad man vet om det är naturligtvis viktigt som grund för vad man skall tycka om saken. Kunskapen kan vara begränsad och felaktig, ofta styrd av selektiv perception på ett sätt som bekräftar den bild man vill se, men någon typ av föreställning om hur verkligheten är beskaffad finns alltid. Dock får man konstatera att det i fråga om skattereformen är många som inte vet vad de skall anse. På de olika frågorna om skattereformens effekter ligger ofta andelen "vet ej "-svar på mellan 30 och 40 procent. Men detta kan knappast tas som tecken på okunskap om hur reformen är utformad utan enbart om osäkerhet om dess effekter. Den mest initierade kan ju vara osäker om detta. Gröndahl (1986) fann dock att det, i mitten av 1980-talet, endast var en av tre som kunde förklara vad marginalskatt egentligen är. Det tyder på relativt stor okunnighet men det finns skäl att tveka inför en sådan slutsats. En indikation på okunskap är omfattningen av oförenliga svar på olika frågor i opinionsundersökningarna. T.ex. var det i enkätundersökningen, februari 1992, tio procent som ansåg att marginalskattema var för höga och samtidigt önskade höja skatten för höginkomsttagama; tre procent som ansåg att skattebördan fördelas rättvist men samtidigt vill höja eller sänka den för någon inkomstgrupp, vilket inte nödvändigtvis behöver tolkas som oförenliga ståndpunkter. Detta är, med tanke på skrivfel, kodningsfel etc., inte särskilt omfattande inkoncistenser.

I den Gallupundersökning som genomfördes efter 1947 års skattereform (SOU 1951z51) fann man också att okunskapen om skattesystemet var mycket stor. Då tog man detta som argument mot ett utbrett "skattetän— kande"; för hur skulle människor kunna anpassa sitt beteende till skattesystemet då deras kunskaper om det var så bristfälliga, resonerade man. Man skulle kunna vända på det resonemanget och säga att om människor förändrar sitt beteende i enlighet med den förändrade incitamentsstruktur som reformen medfört så är detta tecken på kunskap om reformen. I opinionsundersökningarna om 1990/91 års skattereform ställdes en del frågor om sådana beteendeförändringar som antogs ha direkt samband med det nya skattesystemet. Därigenom har det kunnat konstateras, redan i den första undersökningen, att det i ett par avseenden tycks ha skett beteendeförändringar i rätt betydande omfattning. Det gällde övertidsarbete och sparande. Tabell 5 visar utbredningen av dessa beteendeförändringar i olika inkomstskikté.

6En mer fullständig analys av beteendeförändringar'i samband med skatterefor-

men, såsom de kommit till uttryck i opinionsundersökningarna, återfinns hos Halleröd 1992 och 1993.

Tabell 5 Andel som uppgivit förändringari sparande och övertidsarbete till följd av skattereformen efter inkomst, september 1991 (endast utställda som uppgivit månadsinkomst ingår).

Månadsinkomst, kr.

(12.000 12—16.000 16-20.000 >20.000

Har du till följd av det nya skattesystemet betalt av på lån ' 4 7 9 16 _ sparat mer 10 16 23 40 —— sparat mindre 11 9 6 4 . — ökat övertidsarbete 4 5 6 6 —— pengar istället för

ledighet vid övertid 12 15 12 8

Antal 989 738 286 153

Sänkningen av marginalskatten gjorde det mer lönande att övertidsarbeta och att ta ut ersättning för detta i pengar snarare än i ledighet. Föränd— ringarna i kapitalskatten gjorde det mindre lönsamt än tidigare med ränteavdrag, men mer lönsamt med ränteinkomster vilket stimulerade sparandet. Till detta kom den kraftiga sänkningen av inflationen och den höga realräntan som också bidrog till det ökade sparandet och den minskande skuldsättningen.

Möjligheterna att anpassa sina finansiella transaktioner till nya skattereg— ler är ojämnt fördelade. För den vars hela inkomst går till konsumtion är marginalerna små för sparande och skuldreducering. Bland dem med lägre inkomster finner vi därför en lika stor benägenhet att minska sitt sparande som att spara mera, något de intervjuade alltså tillskriver skattereformen då den ju bidragit till att fördyra konsumtionen i en rad avseenden. Bland höginkomsttagama, däremot, går de finansiella omdisponeringarna i huvudsak från lånande till sparande och detta i stor omfattning.

Statistik från SCB visar att för hushållssektom som helhet var bank- och försäkringssparandet under 1990 och 1991 ungefär av samma omfattning som 1989 men skuldsättningen slutade att öka 1990 och minskade avsevärt året därpå. Netto förblev hushållens skulder oförändrade under 1991 men sparandet ökade med 34 miljarder. Under 1992 fortsatte återbetalningen till bankerna och finansinstituten att öka med 27 miljarder. Summan av ökat sparande och minskat lånande blev 55 miljarder. Exakt vilken roll skattereformen har i denna finansiella anpassningsprocess är svårt att fastställa men de regeländringar som det nya skattesystemet medfört innebär starka incitament för de beteenden som faktiskt observerats. Ett rimligt antagande är att de personer som kan dra nytta av dessa incitament också känner till dem och beter sig därefter.

Ett syfte med skattereformen var också att den skulle stimulera till arbete på olika sätt genom extraarbete, övertidsarbete, längre ordinarie arbetstid och ökad rörlighet på arbetsmarknaden. Detta verkar hittills ha skett i obetydlig utsträckning. En ökning av övertiden har observerats i opinionsundersökningarna men det är mycket få som anger att de till följd av reformen tagit extraarbete, ökat sin arbetstid eller bytt arbete. En av orsakerna till detta kan vara att sådana beteendeförändringar får mycket större implikationer för individens liv än vad en finansiell omplacering får varför den incitamentsförändring som skattereformen medfört inte förmår mer än att ge små effekter i detta avseende. Under den studerade perioden har emellertid efterfrågan på arbetskraft sjunkit dramatiskt varför någon ökning av arbetsinsatser inte varit att vänta ens med oändligt starka incitament för arbete.

Medan människors kännedom om skattereformens effekter på privateko- nomin, åtminstone vad gäller betydelsen av ändringar i skatteskalor, avdragsregler och'kapitalskatt, kan antas vara relativt goda så är det ytterst tveksamt på vilket verklighetsunderlag åsikterna om det nya systemets betydelse för skattemoralen, för den samhällsekonomiska effektiviteten och för inkomstfördelningen vilar. Hur reformen påverkar skattemoralen är det minst problematiska. Antagandet att skattesmitning och skatteplanering skall minska bygger på principen om större enhetlig- het för hur olika inkomster beskattas och på de begränsade avdragsmöj- lighetema. Det är inte svårt att förstå att detta sannolikt leder till de avsedda effekterna, något de flesta också verkar tro.

Svårare är det då att veta vad skattereformen betytt för samhällsekonomin och inkomstfördelningen. Att fånga den konkreta innebörden av dynamiska effekter är inte så lätt. Visst kan man förstå att det är fråga om att få ekonomin att fungera bättre men genom vilka olika mekanismer uppkommer denna effekt? De teoretiska argumenten för dynamiska effekter är inte alltid så lätta att följa och de empiriska beläggen är inte entydiga. Folk i allmänhet har här inget annat val än att lita på de forskare som levererar analyser och åsikter samt att låta sig övertygas av politiker och andra debattörer som deltar i skattedebatten. Ställnings— tagandet bygger i denna fråga i betydande utsträckning på tro och tillit snarare än på vetande. Som vi sett är det framför allt personer på den borgerliga sidan och personer som själva tror sig tjäna på reformen som tror på skattereformens dynamiska effekter. Med socialister och lågin- komsttagare är det tvärt om. Där säker kunskap saknas är utrymmet för selektiv perception stort.

Med synen på fördelningseffekterna är det ännu mer komplicerat. Av de skattetabeller, och de kalkyler över skattereformens vinnare och förlorare, som publicerades i tidningarna torde de flesta ha dragit den slutsatsen att höginkomsttagama skulle bli de Verkliga vinnarna. Men mot detta argumenterades att ingen inkomstgrupp skulle förlora på reformen. Möjligen skulle de med mycket låga eller mycket höga inkomster

kortsiktigt få vidkännas vissa försämringar. Det hade de tidigare referera- de utredningarna visat. Men det kan inte ha varit lätt att förstå varför det som såg ut att leda till ökad ojämlikhet i själva verket inte skulle göra det. Också i bedömningen av reformen ur fördelningssynpunkt blir det individuella ställningstagandet en fråga om tro och tillit. Som vi sett är det höginkomsttagama som ser sig som vinnare och låginkomsttagama som förlorare och det är framför allt de senare som uppfattar reformen som orättvis.

Kunskapen om det nya skattesystemet vid tidpunkten då det genomfördes grundades i stor utsträckning på beräkningar om dess effekter vilka i sin tur baserades på en rad antaganden och gissningar. Den breda allmän- heten fick sin bild genom massmedia och den offentliga debatten. Efterhand ökar dock möjligheterna att på erfarenhetsgrund bilda sig egna kunskaper om systemet och dess effekter. Bl.a. av det skälet gjordes en serie Opinionsundersökningar för att se om Opinionsbilden skulle ändras med tiden. Resultatet blev dock att människors egna erfarenheter av det nya skattesystemet inte inneburit att opinionen över lag förändrats. Enskilda individer kan naturligtvis ha ändrat uppfattning men sådana förändringar har i så fall lika ofta gått i negativ riktning som i positiv. Opinionsbilden är mycket stabil, vilket bl.a. framgår av tabell 4.

Ett viktigt element i kunskapsbilden om skattereformen blir de under- sökningar som för närvarande görs om reformens effekter. Frågan är om den ledde till det som förutspåddes av politiker och experter i t.ex. RINK. Svårigheterna att ge säkra svar är emellertid mycket stora. T.ex. är det några år efter reformen omöjligt att på empirisk grund hävda att den lett till dynamiska effekter, men reformanhängarna kan då hävda att det beror på den mycket ogynnsamma konjunkturutvecklingen och att situationen skulle ha varit värre utan skattereformen. Andra kan hävda att reformen fördjupat krisen genom den mycket kraftiga ökningen av hushållens sparande som skattereformen stimulerat fram7. Men det ökade sparandet kan också förklaras med den ängslan som spritt sig bland befolkningen i lågkonjunkturens spår. Vidare har det visat sig att reformen i själva verket blev underfinansierad med ca 12 miljarder (Hansson och Larsson 1993). Reformen har på det sättet ökat budgetunderskottet och bidragit till ränteproblemen. Dessa exempel på aktuella resonemang några år efter reformbeslutet visar att förutsättningama ständigt ändras och att alternativa perspektiv på frågan om reformens samhällsekonomiska effekter är möjliga. Därför är det knappast troligt att säker kunskap om

7Den kraftiga ökningen av sparandet stämmer inte alls med de bedömningar som gjordes i RINK. Där konkluderades, efter en reservation om att de samlade spareffekterna av reformen varit svåra att fastställa: " .. att hushållens sparkvot stiger något till följd av skattereformen, dock inte mer än att det bara delvis motverkar ökningen av hushållens realt disponibla inkomster. Därmed skulle skattereformen under de tre första åren förväntas leda till en viss ökning av den privata konsumtio- nen." (SOU 1989:33 Bilaga 4, s 35)

detta någonsin nås. Utrymmet för ideologiskt färgade tolkningar av skattesystemets betydelse för samhällsekonomin kommer även framgent att vara mycket stort.

Inte heller är det lätt att få säker kunskap om skattereformens för- delningseffekter. I en specialanalys av inkomstfördelningen 1991 inriktas huvudintresset på skattereformens fördelningseffekter (Jansson 1993). Där framgår bl.a. att mellan 1989 och 1991 minskade inkomstskatten, utöver den genomsnittliga inkomstskattesänkningen, i decilgrupperna 4 till 9, mest i grupperna 5 till 7; den ökade i den lägsta decilgruppen och även något i den högsta. De tio procent som tjänade mest kom att betala en större andel av den totala inkomstskattesumman 1991 än vad de gjorde 1989. Detta skulle tala för att den nya inkomstskatten kanske inte bidragit så mycket till förändringen av den disponibla inkomstens fördelning; höginkomsttagama har fått betala mer vilket minskat spridningen och låginkomsttagama har också fått betala mer vilket ökat spridningen. Men skatteomläggningen innebar också att priserna steg på en rad områden p.g.a. att basen för konsumtionsskatter breddades och vissa avgifter infördes. Detta har troligen minskat konsumtionsutrymmet proportionellt sett mer för låginkomsttagama än för höginkomsttagama. Den äter- betalning av lån som gjorts, i första hand bland höginkomsttagare, har visserligen gjort att deras skatt blivit högre än den annars skulle ha blivit, men samtidigt har deras konsumtionsutrymme ökat eftersom de minskade ränteutgiftema överstigit den ökade skatten. Pensionsfondsbeskattningen har missgynnat höginkomsttagama. Ingen har beräknat hur alla skatteef- fekter belastat eller gynnat olika inkomstgrupper. De samlade förändring— ar i faktorinkomster, transfereringar och skatter tycks i alla fall ha lett till att ojämlikheten i disponibel inkomst ökat kraftigt mellan 1989 och 1991. Tjänstemän på mellannivå och högre tjänstemän har ökat sina disponibla inkomster med 26,3 respektive 28,5 procent under perioden medan arbetare och lägre tjänstemän ökat sina inkomster med 22,5 resp. 23,1 procent, vilket är ett par procent över prisstegringarna under perioden; endast decilgrupperna 7 till 10 har haft en ökning av den disponibla inkomsten som överstiger prishöjningarna; gini-koefficienten beräknad på disponibel inkomst har gått upp från 0,246 till 0,261.

Låginkomstgrupperna har alltså inte kunnat hålla jämna steg med prisutvecklingen vilket delvis kan bero på skattesystemet. Att högin- komsttagama fått förbättrade disponibla inkomster realt sett tillskrivs lö- neutvecklingen för dem. Också detta kan ha samband med skattereformen på olika sätt; tjänstemännen kan ha fått lönekompensation för att tidigare Obeskattade förmåner kommit att beskattas; dessa förmåner togs tidigare inte upp som inkomst men gör det nu; möjligheterna att förskjuta inkomster till kommande år, vilket varit lönsamt 1990 och 1991, har säkerligen varit större bland höginkomsttagare än bland låginkomsttagare. 1 den utsträckning det är så kommer ojämlikheten att minska 1992, men om detta vet man ännu inget. Kunskaper om skattereformens fördelnings— effekter är fortfarande begränsade. Också här kommer det alltid att vara

problematiskt att avgöra vilka förändringar i inkomstfördelningen som beror på skattereformen och vilka som har andra orsaker. De direkta fördelningseffekterna av inkomstskatten går att beräkna men med andra skatter och alla indirekta effekter är det betydligt svårare. Förhoppnings- vis kommer ändå de studier i denna fråga som initierats av Kommittén för utvärdering av skattereformen (KUSK) att ge oss bättre kunskaper på området.

Hur stabilt blev det nya skattesystemet?

Skattereformen 1990/1991 har, som tidigare redovisats, mottagits med blandade känslor. Somliga, i synnerhet manliga högre tjänstemän med höga inkomster, är överlag positivt inställda; över 90 procent av dem stöder reformen. Andra har varit mer tveksamma, t.ex. lågavlönade arbetarkvinnor, där stödet för reformen bara ligger på 26 procent. Detta är emellertid extremgrupper. De flesta intar en mellanposition i synen på skattereformen och har kanske efter reformen ändrat sin inställning till skattesystemet i svagt positiv eller svagt negativ riktning. Nettoeffekten av dessa förändringar tycks ha gått i svagt positiv riktning. Som indikation på detta kan nämnas att balansmåttet, beräknat på frågan om det var ett riktigt beslut att införa ett nytt skattesystem, var +31 procentenheter i september 1992 (46 procent för och 15 procent emot). Hur inställningen till skattesystemet som helhet har förändrats kan också belysas genom att göra jämförelser med tidigare Opinionsundersökningar i ämnet. 1 tabell 6 redovisas en sammanställning av hur medborgarna svarat på identiska frågor som upprepats i några undersökningar utförda vid olika tidpunkter.

Tabell 6 måste tolkas med stor försiktighet. Svarsfördelningar i opinions- undersökningar är känsliga för sådant som datainsamlingsmetod och bortfallsmönster. Det bör därför vara stora skillnader mellan under— sökningamas procentfördelningar för att man skall kunna lita på att det är verkliga opinionsförändringar man observerat. De förändringar som kan utläsas ur tabellen bekräftar dock den tidigare slutsatsen, nämligen att inställningen till skattesystemet blivit något mer positiv efter refor- men. Inställningen till skattetrycket, vilket för övrigt inte tycks vara särskilt negativt, har inte ändrats. Det är framför allt missnöjet med marginalskattema som minskat och, som tidigare redovisats, har marginalskattesänkningen särskilt uppskattats av dem som själva hade höga marginalskatter tidigare.

Tabell 6 Andel instämmande svarpå några påståenden om skattesystemeti olika undersökningarställda vid olika tidpunkter: Inom parentes anges bdansmått (andelen positiva till skattesystemet minus andelen negativa)”.

19651 19811 1986rr 19891" 199213

Med hänsyn till de för- måner som staten ger medborgarna är skatterna inte för höga 43(-11) 56(+17) 53(+13) 58(+2l)

Marginalskattema är alldeles för höga 70(-51) 82(-70) 59(-30)

Vårt skattesystem ger en rättvis fördelning av skattebördan 34(-29) 16(-63) 26(—39)

Vad tycker du i stort am skattesystemet, dvs Skattemas storlek och

reglemas utfarm ning? (andel bra eller mycket bra) 23(-39) 10(-55) 25(-11) Källor 1 Vogel 1970; 2 Laurin 1986; It Svallfors 1989; 4 Riksskatteverket 1993; 5 Svallfors 1992!)

Men samtidigt är det just på denna punkt man också kan notera ett relativt utbrett missnöje med skattesystemet. Det var, i september 1992, 47 procent som ansåg att skatterna för folk med höga inkomster var för låga. Inte oväntat är de som anser detta kraftigt överrepresenterade bland dem som menar att skattereformen varit orättvis, bland arbetare och låginkomsttagare och bland dem som ogillade regeringsskiftet 1991.

Det finns således en opinion som anser sig missgynnad av skattereformen och som önskar förändra skattesystemet i riktning mot högre skatter för höginkomsttagare; det finns också en opinion som vill försvara det uppnådda och kanske sänka marginalskattema ännu mer. De förra bärs upp av låginkomsttagares egenintressen men också av en relativt utbredd rättviseuppfattning om att inkomstskillnadema bör minska och att välfärden fördelas jämnare. Av reformens vinnare är det faktiskt 40 procent som vill höja skatten för höginkomsttagare och 27 procent som anser reformen orättvis. Marginalskattesänkningen bärs i huvudsak upp

8Det är viktigt att hålla i minnet att balansmått inte alltid har en entydig tolkning. Om värdet på måttet är mycket högt , nära 100 eller »100, är saken enkel. Då är måttet ett otvetydigt tecken på opinionsövervikt. Ett lågt balansmått, däremot, kan produceras på två olika sätt: 1) Genom en starkt polariserad opinion där ungefär hälften är för och hälften emot. 2) Genom att de flesta är neutrala, osäkra eller ointresserade och endast ett litet fåtal är för eller emot. I båda fallen är det fortfarande riktigt att opinionsövervikten är liten, men om det beror på lågt engagemang eller på polariserad intressebalans går inte att utläsa. Därför redovisas i tabellerna både andelen instämmande svar och balansmåttet.

av höginkomsttagamas egenintressen uppbackad av en tro på att låga marginalskatter är bra för samhällsekonomin och i vissa fall av åsikten att höga marginalskatter är orättvisa. Den åsikten har emellertid inte trängt in bland reformens förlorare lika mycket somjämlikhetsvärdering— arna trängt in bland vinnarna.

Tabell 7 Sambandet mellan refomiens tömiodade et'fektersamt dess betydelse t'örpolitiskt ställningstagand etter åsikter om beskattning av höginkomsttagare och tömiodade eifekter på den egna ekonomii September 1992. Höginkomsttagare skall beskattas som nu eller lägre hårdare Tror Sig tillhöra reformens vinnare varken förlorare _ vinnare varken förlorare eller eller Andel positiva svar och balansmått* avseende reformens effekter för — samhällsekonomi 45 (32) 24 (8) 21 (-12) 23 (-11) 15 (-22) 10 (-49) — skattemoralen 53 (42) 29 (21) 32 (24) 42 (28) 29 (18) 35 (22) — rättvisan 55 (38) 25 (11) 19 (-20) 34 (-8) 15 (-21) 8 (-60)

Andel för vilka skattereformen har betydelse för politiska sympatier idag 20 14 22 18 18 34 Antal 493 983 270 320 710 487 100% 15 30 8 10 22 15 * Se fotnot 8

Av de tillfrågade är det 45 procent som inte vill höja skatten för höginkomsttagare och som inte själva anser sig ha förlorat på reformen. Här dominerar också tron på reformens olika fördelar. Det är 37 procent som inte vunnit på reformen och som vill höja skatten för höginkomstta- gare. Här dominerar misstroendet mot reformen, effekterna på skattemo- ralen undantagen. Särskilt förlorarna i denna grupp tillmäter reformen stor betydelse för deras politiska ställningstagande. 1 mellangrupperna, förlorarna som inte vill höja de högavlönades skatt (8 procent) och vinnarna som vill göra det (10 procent), dominerar en tveksam inställning till reformens samhällsekonomiska nytta och det rättvisa i den, men man tror att den höjt skattemoralen.

En ambition med det nya skatteförslaget var att det skulle bli ett stabilt system som skulle kunna fungera i decennier framöver. Men skattesystem anpassas ständigt till nya ekonomiska och politiska förhållanden; så även detta system. Redan hösten 1991 hade det förändrats på 25 punkter och en rad förslag till ytterligare förändringar förelåg. Den förändringspro- cessen har fortsatt sedan dess. T.ex. har momsen differentierats, arvs- och gåvoskatten sänkts, skattereduktion för fackföreningsavgifter slopats, skatten på aktievinster, värdepappersfonder och kapitalförsäkringar sänkts, avkastningsskatten på privata pensionsförsäkringar sänkts, den allmänna löneavgiften slopats samt, en i tiden framskjuten sänkning av skatt på kapitalinkomster och reduktion av rätt till underskottsavdrag; förlust från

rörelse skall under vissa förhållanden kunna kvittas mot inkomst av arbete.

De förändringar som genomfördes under den borgerliga regeringsperioden tillfredsställde i huvudsak en borgerlig opinion. Marginalskattereduk- tionen låg fast. Den kom på något sätt att symbolisera reformen och att höja marginalskatten skulle nog av många betraktats som det definitiva brottet mot en av skattereformens huvudprinciper. Men opinionen är i stort sett delad på mitten i denna fråga och små förskjutningar av värderingsförändringarna åt ena eller andra hållet kan förskjuta balans- punkten. De marginalskattefientligas position stärks av en högerorienterad väljaropinion och av att frågor om tillväxt och effektivitet dominerar i den offentliga debatten. Så sker som regel under lågkonjunkturer då även arbetslösheten och oron för framtiden tenderar att göra människor ängsliga och rädda att förlora det de har. Argument för låga marginal- skatter kan i ett sådant klimat lätt framstå som argument i allmännyttans tjänst och inte som ett egennyttigt krav. Rösterna däremot är få och svaga. Emellertid förlorar resonemanget om skattereformens dynamiska effekter i trovärdighet ju längre tiden går utan att landets ekonomi och statsfinanser förbättras. De marginalskattevänligas position stärks även av att frågor som solidaritet och jämlikhet ges utrymme i debatten. I det perspektivet framstår krav på inkomstutjämnande skatter som moraliskt berättigade och inte enbart egennyttiga. En fortsatt ökning av ojämlik- heten i ekonomiska resurser, oavsett om de kan tillskrivas skattereformen eller ej, ger näring åt dessa krav.

När så socialdemokraterna återkom till makten efter 1994 års val och både vänsterpartiet och miljöpartiet stärkt sina positioner inträffade en maktförskjutning till den mer jämlikhetssträvande opinionens fördel. En femprocentig "värnskatt" på inkomster över en viss brytpunkt infördes, låt vara att man lovat slopa den då statsfinanserna kommit i balans. Detta stod, liksom många av de tidigare förändringarna, i strid med reformens intentioner men var helt i linje med den socialdemokratiska väljarbasens vilja.

Det är naturligt i en demokrati att skattemissnöje inom ett block eller parti omsätts i politisk handling när detta block eller parti kommer till makten. Ett stabilt skattesystem skulle ha krävt en över partigränser och inkomstgrupper bred uppslutning så att de politiska växlingarna inte nämnvärt påverkat viljan att ändra i systemet. Men de egenskaperna hade inte "århundradets skattereform". Den genomfördes av en socialdemokra- tisk regering men hade svag förankring inom den egna väljarkåren. Inte heller inom det borgerliga blocket gillade man alla delar av reformen och ändrade därför i den när man hade makten. En lärdom är att det stabila skattesystemet inte bara är en fråga om att hitta den effektiva konstruk- tionen utifrån skatteekonomisk teoribildning utan till stor del en fråga om legitimitet och opinionsstöd. Kanske är det inte alls möjligt att konstruera ett system som åtnjuter så brett stöd att politiska maktskiften inte

nämnvärt påverkar viljan att ändra i systemet. Skattepolitiken befinner sig trots allt mitt i den politiska höger-vänster dimensionens konfliktfält. Det robusta skattesystemet verkar fortfarande vara en utopi.

Referenser

Andersson, M, (1992), "Kvinnor och politik - en studie i åsiktsskillnader mellan kvinnor och män". CD-uppsats vid Sociologiska institutionen, Umeå universitet.

Elvander, N, (1972), Svensk skattepolitik 1945 - 1970. Rabén & Sjögren, Stockholm.

Elvander, N, (1989), Från Wigforss till Feldt. Tiden, nr 3. Etzioni, A, (1988), The Moral Dimension. Free Press, New York. Feldt, K—O, (1991), Alla dessa dagar. Norstedts Förlag AB, Stockholm.

Finndahl, 0, (1986), "Skatterna och svenska folket". PM l.12.1986. Publik— och programforskningsavd., Sveriges Radio.

Gröndahl, A, (1986), "Svåra ord i demokratiskt tankeutbyte". PM 12.2.1986. Publik- och programforskningsavd., Sveriges Radio.

Hadenius, A, (1986), A Crisis of the Welfare State? Opinions About Taxes and Public Expenditure in Sweden. Almqvist & Wiksell In- ternational, Stockholm.

Halleröd, B, (1992), " Skattereformens dynamiska effekter". Rapport 6 i projekt "Opinioner kring 1991 års skattereform". Sociologiska in- stitutionen, Umeå universitet.

Halleröd, B, (1993), "Dynamiska effekter" har 1991 års skattereform påverkat arbetskraftsutbudet? Ekonomisk debatt, årg 21, nr 4.

Halleröd, B, Marklund, S, Nordlund, A, & Stattin, M, (1993), Konsen- suellfattigdom - en studie av konsumtion och attityder till konsumtion. Umeå studies in sociology, No 104, Sociologiska institutionen, Umeå univeritet.

Hansson, 1, & Larsson, K—L, (1993), "Konjunkturen huvudorsak". Dagens Nyheter, 7 juli 1993.

Heider, F, (1958), The psychology of personal relations. Wiley, New York.

Jansson, K, (1993), Inkomstfördelningen iSverige 1980 —I99I. Rapport 1993zl, Statistiska Centralbyrån.

Korpi, W, (1993), "Politik och väljare bakom valutgången 1991". Sociologisk forskning, nr 1.

Laurin, U, (1986), På heder och samvete. Norstedts, Stockholm.

Lindencrona, G, Mattson, N, Ståhl, I, & Bröms, J, (1986), Enhetlig inkomstskatt. SACO/SR, Västervik.

Lewin, L, (1988), Det gemensamma bästa. Carlssons, Borås.

Lewis, A, (1982), The Psychology of Taxation. Martin Robertson, Oxford.

LO, (1989), LO:s fördelningssludie av skatteförslagets effekter. Stock- holm.

Musgrave, AR, (1990), "Comments to Whalley". l Slemrod, J, Do Taxes Matter? The MIT Press, Cambridge Mass,

Riksskatteverket, (1993), Inställningen till skatteförvaltningen och kronofogdemyndighetema 1992. Rapport l993:5.

Scholz, J.T, McGraW, K.M & Steenbergen, MR, (1992), "Will taxpayers ever like taxes? Responses to the U.S. Tax Reform Act 1986". Journal of Economic Psychology, vol. 13.

SOU 1951 :51, Den statliga direkta beskattningen. SOU 1964:25, Nytt skattesystem.

SOU 1989:33, Reformerad inkomstbeskattning. Del 4 Bilagor, ex- pertrapporter.

Svallfors, S, (1989), Vem älskar välfärdsstaten? Arkiv, Lund.

Svallfors, S, (l992a), "Uppskattad reform? Social position, egenintresse och allmänintresse i stödet för skattereformen 1991". Sociologisk forskning, nr 2, s 13-29.

Svallfors, S, (1992b), "Den stabila välfärdsopinionen: attityder till svensk välfärdspolitik 1986 - 92". Rapport 4 i projekt "Opinioner kring 1991 års skattereform". Sociologiska institutionen, Umeå universitet.

Vogel, J, (1970), Aspirationer, möjligheter och skattemoral. SOU 1970:25.

Vogel, J, (1974), "Taxation and public Opinion in'Sweden". National Tax Journal, Vol, XXVll, No. 4.

Whalley, J, (1990), "Foreign Responses to U.S. Tax Reform". l Slemrod, J, Do Taxes Matter? The MIT Press, Cambridge Mass.

Witte, J.f, (1991), "The Tax Reform Act of 1986 — A New Era in Tax Politics?" American Political Quarterly, vol. 19, s 438-457.

Åberg, R och Edlund, J, (1993), " Skattesystemet och rättvisan". Rapport 7 i projekt "Opinioner kring 1991 års skattereform". Sociologiska institutionen, Umeå Universitetet.

Åberg, R, (1991), "Politik för jämlikhet - det goda samhällets huvudsak eller bisak?" l Olsen, J.P. red. Svensk demokrati iföra'ndring, Carlssons, Helsningborg.

Åberg, R, Selén, J, Tham, H, (1984), "Ekonomiska resurser". I Erikson, R och Åberg, R, Välfärd iförändring, Prisma, Arlöv.

Asard, E och Bennett, W_L, (1992), Regulating the Marketplace ofldeas: Tax Reform and Election Rhetoric in Sweden and the United States. Uppsala North American Studies Reports, Nr 8, Uppsala.

Tidigare utgivna rapporter och artiklar från projektet OPINIONER KRING 1991 ÅRS SKATTEREFORM

Halleröd, B., Svallfors, S. & Åberg, R. (1991) Svenskarna och skattere- formen. Rapport nr 1. Sociologiska institutionen, Umeå universitet (Stencil).

Halleröd, B., Svallfors, S. & Åberg, R. (1991) Opinionsfo'rändringar kring det nya skattesystemet. Rapport nr 2. Sociologiska institutionen, Umeå universitet (Stencil).

Svallfors, S. (1992) "Uppskattad reform? Social position, egenintresse och allmänintresse i stödet för skattereformen 1991". Sociologisk forskning,

nr 2, s 13-29.

Åberg, R. (1992) Svenskarnas inställning till skattereformen ett år efter det att den genomförts. Rapport nr 3. Sociologiska institutionen, Umeå universitet (Stencil).

Svallfors, S. (1992) Den stabila välfärdsopinionen: attityder till svensk välfärdspolitik 1986 - 92. Rapport 4. Sociologiska institutionen, Umeå universitet (Stencil).

Halleröd, B. (1992) Värderingsmönsler, partisympatier och 1991 års skattereform. Rapport 5. Sociologiska institutionen, Umeå universitet (Stencil).

Halleröd, B. (1992) Skattereformens dynamiska effekter. Rapport 6. Sociologiska institutionen, Umeå universitet (Stencil).

Andersson, M. (1992) Kvinnor och politik - en studie i äsiktsskillnader mellan kvinnor och män. CD-uppsats vid Sociologiska institutionen, Umeå universitet.

Halleröd, B. (1993) "Dynamiska effekter" - har 1991 års skattereform påverkat arbetskraftsutbudet? Ekonomisk debatt, årg 21, nr 4.

Åberg, R. och Edlund, J. (1993) Skattesystemet och rättvisanRapport 7. Sociologiska institutionen, Umeå Universitetet (Stencil).

Åberg, R. Ä rhundradets skattereform ? Politik och opinion kring 1991 års skattereform. Fritzes förlag 1993.

Bilaga 4

Basuppgifter om hushållens inkomstutveckling 1989-1992

O InnehaH 1 Bakgrund 195 2 Allmänt om statistikkällor, definitioner mm. 199 3 Översiktligt om utvecklingen för olika gmpper 202 4 Hushåll i aktiv ålder 205 4.1 Antal personer och familjer 205 4.2 HINK-makrotal för aktiva hushåll 206 4.3 Inkomstutvecklingen för olika deciler (hushåll 18-64 år) 214

5 Inkomster och skatter ur ett individperspektiv. Individeri aktiv ålder. 222 5.1 Beskrivning av populationen 222 5.2 Utvecklingen av arbets- och pensionsinkomster 223 5.3 Utvecklingen av kapitalinkomster, skuldräntor m.m. 232 5.4 Utvecklingen av skatterna 237 6 Pensionärema 244 6.1 Antal pensionärer m.m. 244 6.2 Specifika regelförändringar för pensionärerna 244 6.3 HINK—makrotal för pensionärshushållen 245 6.4 lnkomstspridningen inom pensionärshushållen 247 6.5 Pensionärerna som grupp och som individer 249 6.5.1 Inkomsteffekten av omsättningen inom pensionärsgruppen 249 6.5.2 Utvecklingen sett ur ett individperspektiv — några typfall 250

Appendix: Grundtabeller för åren 1989-1992. Löpande priser. 257

1 Bakgrund

Skattereform en 1990-1991

En stor skattereform genomfördes i Sverige åren 1990 och 1991. Reformen innebar för fysiska personer bl.a. kraftigt sänkta marginalskat— ter, breddning av skattebasema för inkomst av tjänst och kapital samt en kraftig reducering av rånteavdragens värde. Barnbidrag, pensionstillskott och bostadsbidrag höjdes. Sänkningen av marginalskattema beräknades motsvara 6 procent av BNP. Sänkningen finansierades bl.a. genom breddade skattebaser i inkomstbeskattningen (förmåner och kapital) och för mervärdesskatten samt genom en växling till "gröna skatter" bl.a. genom höjda skatter på energi.

Beräkningarna av budgeteffektema av skattereformens regelförändringar innebar för skatten på individinkomster en sänkning av skatteuttaget med inemot 29 mdkr. Ökade pensionstillskott, bostads- och barnbidrag om beräknat drygt 8 mdkr ingick också som en del i reformen. Sänkt skatt på individinkomster och ökade bidrag skulle därmed tillföra hushållen ca 37 mdkr vilket motsvarar 4.300 kr per invånare. Andra åtgärder som ingick i reformen medförde samtidigt att hushållens kostnader ökade för bl.a. boende och energi samt för att full moms infördes på vissa tidigare momsbefriade eller lågt beskattade tjänster (t.ex. hotell, restaurangbesök, frisörer).

Skattereformens budgeteffekter, mdkr

]: Skatt och avgifter på individinkomster samt bidrag till hushållen

Ändrade skattesatser m.m. -89,1 Basbreddningar anställningsinkomster +12,7 Basbreddningar i kapital m.m. +38,6 Nänngsverksamhet +3,8 Särskild löneskatt +5,4 Pensionstillskott, bostadsbidrag, barnbidrag m.m. -8,2 Summa —36,8

11: Övrig finansiering av reformen

Moms och punktskatter +28,4 Juridiska personers beskattning +l,2 Dynamiska effekter +5,0 Summa +34,6

Sänkningen av skatten på individernas inkomster och höjda bidrag till hushållen finansierades genom bl.a. höjda indirekta skatter. l finan— sieringsbilden ingick också 5 mdkr i form av dynamiska effekter av reformen.

Beräkningarna av budgeteffekterna baserades på framskrivningar av skattebasema för det vid denna tidpunkt senast kända inkomståret (inkomståren 1987 och 1988). Ex post beräkningar baserade på skatteba- semas faktiska utveckling visar att reformen på kort sikt (åren 1991 och 1992) var underfinansierad med ca 25 mdkr per årl. 1 runda tal hälften av underfinansieringen är hänförbar till omläggningen av inkomstskatten på förvärvs- och kapitalinkomster för fysiska personer. Orsaken till denna del av underfinansieringen är bl.a. höga löneökningar som gjorde att in- komsttagarna vid tiden för skattereformen förts upp i högre marginal- skatteskikt än vad propositionens kalkyler baserades på. Kostnaderna för marginalskattesänkningen blev därmed högre än i den ursprungliga kalkylen. För kapitalbeskattningen sammanhänger underfinansieringen med att tillgångspriserna och därmed skattebasema för kapitalbeskatt- ningen i praktiken utvecklades långsammare än i de framskrivningar som gjordes i samband med reformpropositionen. Den andra hälften av under- finansieringen är hänförbar till utvecklingen av skattebasema för moms, den särskilda löneskatten och företagsskatten samt att de dynamiska effekter som ingick som ett led i finansieringen inte torde ha materialise- rats i det försämrade konjunkturläge som rådde under inledningen av 1990-talet.

Skattereformen förväntades att i väsentliga avseenden påverka hushållens och företagens ekonomiska situation. En särskild kommitté (KUSK) tillsattes med uppgift att följa upp och utvärdera reformen.

Läsanvisning

I denna rapport dokumenteras statistik om den faktiska ekonomiska utvecklingen för hushållen mellan 1989 (året före reformen) och 1992 (ett år efter reformen). Rapporten inleds med en allmän bakgrundsbe— skrivning. Därefter tas i aVSnitt 2 upp allmänt om statistikkällor, definitio- ner m.m. I avsnitt 3 ges en översiktlig beskrlvning av utvecklingen för olika grupper. Därefter behandlas i två separata avsnitt mer i detalj utvecklingen för de aktiva åldrarna. I det första (avsnitt 4) beskrivs utvecklingen utifrån ett hushållsperspektiv och i det andra (avsnitt 5) tas inkomster och skatter upp med en individansats. Slutligen beskrivs ut- vecklingen för pensionärerna (avsnitt 6).

Det är uteslutande de ekonomiska aspekterna för hushållen som kommer att behandlas. För bredare aspekter på hushållens levnadsförhål- landen säsom t.ex, hälsotillstånd, social förankring, fritidsaktiviteter, politiska resurser, otrygghet m.m. hänvisas till de kartläggningar som med olika tidsintervall görs inom ramen för SCB:s undersökningar av levnadsförhållandena (de s.k. ULF—undersökningarna) och de levnadsnivå- undersökningar (LNU) som genomförs av Institutet för Social Forskning.

lSe detta betänkande sid 77.

Bilaga 4 Bakgrund 197 Skattereformen och annan påverkan

Utvecklingen av hushållens ekonomiska standard mellan 1989 och 1992 påverkas av en rad olika faktorer utöver skattereformen. Syftet med denna rapport är att ge en översiktlig belysning av det samlade skeendet. Effekterna av skattereformen kan endast till del renodlas gentemot effekter av annan inverkan.

Löneutveckling Skattereformens lönebildning regeländringar X / Andra XA /regeländringar Arbetslöshet Å/

Faktiska utvecklingen Beteendeanpassnin gar & som hänger samman med / & skattereformen

Andra beteendeanpassningar

Rånteläge

Trendbrott under perioden

Perioden 1989-1992 innebar för hushållens del ett brott i utvecklingen mot senare delen av 1980-talet. Arbetslösheten ökade och alltfler fick sin sysselsättning via arbetsmarknadspolitiska åtgärder. 1992 var i snitt 474.000 personer berörda mot 210.000 år 1989. I denna inledande fas av lågkonjunkturen drabbades särskilt de yngre hårt.

1.Tabell: Antal arbetslösa och antal i arbetsmariomdsåtgänler, tusental Källa: SCB Arbetskransundersöklungama (AKU).

1989 ' 1990 1991 1992

Arbetslösa 67 75 133 233 Arbetsmarknadspolitiska åtgärder 143 139 173 241 Summa 210 214 306 474

2.Tabcll: Relativ arbetslöshet (%) för olika åldersgrupper Källa: SCB ArbetskraRsundersökningarna (AKU).

Ålder 1989 1990 1991 1992 16-19 3,5 5,1 7,5 11,6 20-24 3,1 3,2 6,1 11,5 25-44 1,3 1,4 2,8 5,4 45-54 0,8 0,9 1,4 2,6 55-64 1,3 1,5 2,2 3,2 Samtiiga 1,5 1,7 2,9 5,3

Låneräntorna ökade. I februari 1989 var räntenivån för ett nytt femårigt villalån 11,2 procent och i februari 1992 12,5 procent. Räntan för

medlemslån (TCO) ökade från 13 till 17,6 procent. Med hänsyn till att prisutvecklingen samtidigt sjönk var det fråga om en högst betydande ökning av realräntorna även bortsett från effekterna av begränsningen av ränteavdragen. Från december 1989 till december 1992 föll generalindex på Stockholmsbörsen med 28 procent. Under 1992 började även mark— nadsvärdet på egna hem att falla.

Uppgifter över hushållssektom i nationalräkenskapema visar att hus- hållens beteende ändrats kraftigt. Normalt konsumerar hushållen inte hela den löpande disponibla inkomsten utan en del sparas. Under senare delen av 1980-talet inträffade dock en konsumtions-boom och hushållen konsumerade betydligt mer än de löpande disponibla inkomsterna. Man lånade således för konsumtionsändamål. Värdestegringama på fastigheter och en allmän optimism i rådande högkonjunktur var troligtvis motorn för detta beteende. Under 1990—talets inledning har motsatsen inträffat. Med fallande fastighetsvärden, värdeminskningar på finansiella tillgångar, höga realräntor, hög arbetslöshet och en allmän osäkerhet om framtiden samt de ändrade sparincitament som följer av skattereformen har hushållen hållit igen på konsumtionen och istället sparat och betalat tillbaka län.

3. Diagram: Hushållsseldoms disponibla inkomst och konsumtion. Fasta priser (1991 års nivå).

Källa: SCB Nationalmkmkapemn (NR)

Mdkr 850

300 Privat konsumtion

750

700

Disponibel inkomst

650

600 ———| 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993

2 Allmänt om statistikkällor, definitioner m.m.

Som underlag för denna rapport används i första hand SCB:s inkomstför- delningsundersökning, HINK, samt vissa uppgifter från den totalräknade inkomststatistiken. Redovisningen grundas dels på sammanställningar av material som SCB publicerat i form av statistiska meddelanden och särskilda rapporter kring inkomstfördelningen i Sverigez, dels på särskilda bearbetningar som SCB gjort på uppdrag av Kommittén för utvärdering av skattereformen (KUSK). Specialbearbetningarna har fogats som appendix till denna bilaga.

Allmänt om HINK jämfört med andra källor

Uppgifterna i HINK baseras på en årlig urvalsundersökning som omfattar ca 10.000 hushåll. HINK-populationen är inte helt överensstämmande med totalbefolkningen. Populationen i HINK är snävare i och med att institutionshushåll (personer boende på ålderdomshem, sjukhem,fängelser mm.) och hushåll där hushållsföreståndaren levt i Sverige mindre än ett halvt år har exkluderats i HINK. HINK-uppgifterna är hämtade från en intervju samt från deklarationer och administrativa register.

HINK är en urvalsundersökning Vilket innebär att skattningama vid uppräkningen till riksnivå kan var osäker för vissa variabler. Det gäller i första hand sällan förekommande variabler. Exempel på sådana är reavinster och förmögenhetsskatt. Osäkerheten blir också stor om redovis- ningen skulle göras uppdelat på mycket små grupper. I synnerhet om det gäller studier av extremvärden såsom t.ex. utvecklingen för ett litet skikt av personer med extremt höga inkomster.

Populationsavgränsning och inkomstdefinitioner i HINK skiljer sig åt mellan HINK och den aggregerade ekonomiska bild för hushållssektom som erhålls i nationalräkenskapema (NR). Populationsavgränsningen är snävare i HINK. lnkomstdefinitionen avviker också genom bl.a. hur reavinster, inkomst av egna hem och ränteutgifter hanteras i inkomst- definitionema. HINK betraktar realisationsvinster som inkomst medan NR betraktar dessa som förändring i hushållens kapitalstock. l NR tilldelas hushållen en teoretiskt beräknad inkomst av eget hem vilket inte görs i HINK. I den definition av disponibel inkomst som normalt används i den officiella statistiken över HINK betraktas ränteutgifter som utgifter för konsumtion och de påverkar därför inte disponibel inkomst.

ZKjell Jansson: lnkomstfördelningen i Sverige 1980-1991 (SCB Rapport 199311) Inkomstfördelningen I Sverige 1975-1992 (SCB Rapport 1994:1)

För att få en överblick över storleksordningen på de förändringar som inträffat över åren kommer HINK—undersökningarnas resultat i denna rapport bl.a. att redovisas i form av aggregerade belopp —— "makrotal " — för hela HINK-populationen. Vid jämförelse med andra källor kan dessa makrotal avvika. Orsakerna kan dels vara HINK-populationens av- gränsning jämfört med andra källor dels att HINK som är en urvals- undersökning för vissa variabler är behäftad med osäkerhet. HINK- makrotalen bör dock kunna bidra till att förklara och förstå riktningen och storleksordningen på de variabler som bestämt utvecklingen av hushållens ekonomiska levnadsstandard såsom de mäts i HINK.

Disponibel inkomstbegreppet

1 den officiella löpande statistik som publiceras i anslutning till HINK brukar disponibel inkomst starkt förenklat definieras som inkomst efter skatt med tillägg för olika typer av bidrag. 1 inkomsterna ingår därvid utöver arbets- och pensionsinkomster även ränteinkomster och reavinster. I denna rapport kommer att göras en beräkning som i huvudsak ansluter till den officiella statistikens definition. Därutöver görs en beräkning där reavinstemas/reafärlustemas inverkan på den disponibla inkomsten rensas bort. Reavinstema varierar kraftigt mellan åren och kan därför "skymma" den underliggande utvecklingen när man ser till förändringarna mellan enskilda år. Reavinstemas fördelningsprofil bör kanske snarare — med hänsyn till att det är fråga om kapitaliserade värdestegringar som blir likvida vid specifika transaktioner ses samlat över längre tidsperioder.

Ekvivalensskala m.m. förjämförbarhet mellan olika hushållstyper

Inkomster för olika hushåll görs jämförbara och uttrycks per "konsum- tionsenhet" med hjälp av en ekvivalensskala som används i den officiella statistiken över hushållens inkomster. Anledningen till detta är att möjlig— heterna till direkt jämförelse mellan olika värden ökar när skillnader beroende på olika hushållsstorlek elimineras. Den ekvivalensskala som använts är densamma som meddelats av socialstyrelsen för beräkningar av inkomstnormer i samband med bedömning om utbetalning av social— bidrag.

Ekvivalensskala - konsumtionsenhetsskala (Ice.-skala) 1989-1990 1991-1992

ny-k.e. 1 vuxen 1,15 1,16 Ytterligare en vuxen 0,75 0,76 Bam 0-3 år 0,55 0,56 Barn 4-10 år 0,65 0,66 Bam 11-17 år 0,75 0,76

Anm. Skalan harjusterats för 1991-92 för att följa de marginella förändringar som socialstyrelsen meddelat för 1991.

Vilken ekvivalensskala som skall tillämpas kan naturligtvis diskuteras. Den skala som redovisas ovan innebär egentligen inga skalfördelar för flerbarnsfamiljer relativt familjer med få barn — skalan går enbart efter barnens ålder. I andra studier av inkomstfördelningen används ibland en ekvivalensskala som innebär större stordriftsfördelar än den ovan ju fler personer som ingår i hushållet]. Valet av ekvivalensskala har stor betydelse för jämförelserna i nivåerna mellan olika grupper. Denna rapport fokuserar dock i första hand på utvecklingen mellan åren snarare än det relativa förhållandet mellan olika familjetyper.

Resultaten redovisas uppdelat på hushåll i aktiv ålder (upp till 64 år) och pensionärshushåll (65 år eller mer). Åldersklassificeringen sker därvid efter hushållsföreståndarens ålder. Denne är den person i hushållet som har störst förvärvsinkomst”,

Skattereform ens basbreddningar

Skattereformens basbreddningar medförde att inkomster som tidigare betraktades som skattefria behandlas som skattepliktiga fr.o.m. 1991. Dessa förmåner har hushållen disponerat även före reformen men de har endast till mycket liten del kunnat fångas i HINK-statistiken för tidigare år. SCB har sökt uppskatta effekterna av basbreddningama och har i görligaste mån gjort åren 1989 och 1990 jämförbara med senare år. Basbreddningarna innebar för 1989 att 18 mdkr tidigare "dolda in- komster" lades till inkomst av tjänst för 1989 (en förhöjning av det beskattningsbara löneunderlaget med i snitt 3,5 procent) för att uppnå jämförbarhet med förhållandena efter skattereformen. Vidare lades ca 21 mdkr till inkomst av kapital —— tyngdpunkten låg därvid på reavinstbe- skattningen (+12 mdkr).

3T.ex. har ekvivalensskalan definierats som kvadratroten ur antalet personer som ingår i hushållet.

4Denna definition innebär att det bland de aktiva hushållen kan ingå pensionärer nämligen i de fall den som definieras som hushållstöreståndare sammanbor med en pensionär. Vice versa kan det bland pensionärshushållen ingå personeri aktiv ålder nämligen om hushållstöreståndaren är pensionär och maken/makan år i aktiv ålder.

3 Översiktligt om utvecklingen för olika grupper

Den disponibla inkomsten (exkl. reavinst) har i fasta priser ökat med 63 mdkr eller 9 procent mellan 1989 och 1992. Som framgår av samman- ställningen nedan har lön, företagsinkomst och sjukpenning därvid minskat med hela 55 mdkr. Genom att arbetsmarknadsstödet och pensionerna ökat och hushållen dragit ned på betalningarna av privata pensionspremier stannar minskningen av de sammanlagda arbets- och pensionsinkornsterna på 2 mdkr. Barn-, bostadsbidrag och övriga (icke- skattepliktiga) transfereringar till hushållen har ökat med 13 mdkr och skatten har (rensat för skatt på reavinst) minskat med 52 mdkr.

Inklusive reavinst blir utvecklingen av den disponibla inkomsten något lägre (7 procent) beroende på att reavinsterna kraftigt minskar mellan 1991 och 1992.

4. Tabell: Hushållens inkomstsanmmnsättning 1989-1992. Fasta priser

Aggregelade HINK-belopp ("HlNK—makmtal') för samtliga hushåll Källa: Specialbearbetning av HINK

mdkr (1992 års priser) Förändring 1989-1992

1989 1990 1991 1992 mdkr (' %

Lön 661 676 637 634 -28 -4% Företagsinkomst 23 20 16 14 -9 -39% Sjukpenning mm. 62 65 58 43 -19 -30% Delsumma ovan 746 761 712 691 —55 -7% Arbetsmarknadsstöd l l 1 1 18 39 +28 +245% Övriga inkomster m.m. 2 3 6 6 +4 +176% Pensionspremie 15 12 10 8 -7 -46% Simuna arbetsinkomst 744 763 726 728 -17 -2% Pension 187 179 191 202 +15 +8% Totalt arbete+ pension 931 942 917 929 —2 —0% Ränteinkomster/utdelningar 49 5 1 43 48 -0 - l % Ränteutgiher 87 94 84 92 +4 +5% Reavinst brutto ' 39 38 36 17 _22 -56% Bam- och bostadsbidrag 23 24 30 30 +7 +32% Övriga transfereringar, netto 14 14 16 20 +6 +40% Slutlig skatt . 328 » ' 326 269 264 -64 -20% Slutlig skatt exkl skatt på reavinst ' 312 312 259 260 -52 -17% Disponibel inkomst inkl. reavinst 728 743 773 781 +53 +7% Disponibel inkomst exkl. reavinst 704 719 747 768 +63 +9%

Utvecklingen enligt "makrotalen" tar inte hänsyn till hur försörjnings- bördan utvecklats under perioden. Mätt i konsumtionsenheter har försörj- ningsbördan ökat med 4 procent mellan 1989 och 1992. Ökningen beror

dels på befolkningsökning, dels på att andelen ensamhushåll ökat. Mätt per konsumtionsenhet har den disponibla inkomsten inkl. reavinst ökat med 3,2 procent (dito exkl. reavinst 4,8 procent). Ökningen för pensionärshushållen har varit klart bättre än för hushållen i aktiv ålder (se tabell 5). Bästa året för pensionärerna har därvid varit 1992.

5. Tabell: Förändring av disponibel inkomst totalt och per konsumtionsenhet. Fasta priser.

Förändring (%) av disponibel inkomst totalt per konsum tionsenhet

"m akratal "

lnkomstbegrepp hushåll i pensionärs-

Tidsperiod aktiv ålder hushåll

Dispanibel inkomst inkl reavinst:

1989-1990 +2,0 +1,6 +2,0 -0,7 1990-1991 +4,0 +1,2 +1,0 +2,5 1991-1992 +1,1 +0,4 -0,4 +4,4 Hela perioden +7,3 +3,2 +2,6 +6.2 Disponibel inkomst exkl reavinst:

1989-1990 +2,1 +1,7 +1,6 +1,6 1990-1991 +3,9 +1,1 +0,8 +2,8 1991-1992 +2,7 +2,0 +1,5 +4,7 Hela perioden +9,0 +4,8 +3,9 +9,4

Förändringen av den disponibla inkomsten varierar mellan olika grupper. Det är främst medelålders 55-64 år samt yngre pensionärshushåll som har fått de största procentuella ökningarna. Den åldersgrupp som har de högsta inkomsterna har därmed förskjutits från gruppen 45-54 år till gruppen 55-64 år. Det innebär att under de senaste åren är det personer födda på 1930-talet som ökat sina inkomster mest och som också har de högsta inkomsterna.

De grupper som har fått det sämre är de unga. Framförallt har de kvarboende5 och unga ensamstående utan barn fått sänkta inkomster. Det är i dessa grupper som svårigheterna på arbetsmarknaden märkts först.

sKvarboende betecknar de personer mellan 18 och 29 år som har angett att man har bott över halva året hos någon eller båda föräldrarna.

6. Diagram: Pmcentuell förändring 1989-1992 av medianviirdet för disponibel inkomst (inkl. reavinst).6 Fasta priser.

Per åldersgrupp oberoende av familjesanunansättning

Efter familjesammansättning

Hushåll utan barn Hushåll m. bam Pensionärshushåll

$ å"

% exman; gäss east” ”* ås 28 ;iåf Säeå 151360” ' _ En. 3” ",. .5-55;åå giga. ååå ge. Små av 0) M v: 9

5 &

_lo ..

ensamst. 18-29

Nedan behandlas utvecklingen för hushåll i aktiv ålder och pensionärs- hushåll var för sig.

6Källa: SCB Rapport 199411. Uppgifterna i diagrammet avser disponibel inkomst inkl. reavinst enligt den definition som används i den officiella inkomststatistiken. Denna definition överensstämmer i stort med den definition av disponibel inkomst inkl. reavinst som används i denna rapport. Undantaget är i första hand hanteringen av betalningar av privata pensionspremier. Dessa har dragits av vid beräkningen av disponibel inkomst i denna rapport vilket däremot inte har gjorts med den officiella statistikens definition.

För att undanröja oönskad inverkan på resultatet av extremt låga eller höga inkomster an- vänds i diagrammen medianvärden i stället för medelvärden. På detta sätt undviks att resultatet påverkas av om någon eller några inom en redovisningsgrupp har kraftigt avvikande värden från övriga i gruppen.

4 Hushåll i aktiv ålder

Antalet personer under 65 år ökade mellan 1989 och 1992 med drygt 2 procent. Antalet små barn ökade liksom personeri "gyllene medelåldern" (åldersgruppen 45-54 år dvs. personer födda under eller kring krigsåren).

7. Tabell: Folkmängd lmder 65 år. Kalla: SCst befolkningsstatistik. Genomsnitlstzl mellan befolkning i början och slutet av resp. år

Ålder

-4

5- 9 10-17 18-24 25-44 45-54 55-64

Simuna varav

-17

18-64

1989

tusental

528 482 844 842 2 423 1 006 856

6 982

1 854 5 128

1992

tusental

595 504 808 814 2 432 1 147 835

7 135

1 907 5 228

tusental

+67

+153

+S3 +100

Förändring 1989—1992

i % +12,7 +4,5 _4,3 -3,2 +0,3 +14,o -2,5

+2,2

+28 ,

+2,0

För familjestrukturen innebar dessa år att ensamståendehushållen ökade i antal — både de utan och de med barn. I ensamståendehushållen ingår därvid som separata hushåll även gruppen kvarboende, dvs personer mellan 18-29 år som har angett att man har bott över halva året hos någon eller båda föräldrarna. Sambohushållen var oförändrade i antal med en viss förskjutning mot familjer med 3 eller flera barn.

8. Tabell: Familjesanmransiittning med hushållsföreståndare 18-64 år. Kalla- HINK 1989 och 1992.

Antal hushåll, tusental

1989 1992

Sammanboende utan barn 759 759 Ensamstående utan barn 1 615 1 687 Sammanboende med barn 845 846 1 barn 339 332

2 barn 354 346

3 el. fler barn 151 168 Ensamstående med barn 199 233 Summa 3 418 3 525

En bild av inkomstutvecklingen mellan 1989 och 1992 i form av aggregerade inkomstsummor "HINK-makrotal" för hushåll i aktiv ålder ges nedan. Redovisningen sker uppdelat på:

a) arbets- och pensionsinkomster

b) kapitalinkomster

c) icke skattepliktiga transfereringar

d) slutlig skatt

e) disponibel inkomst

För att underlätta jämförelse över tiden uttrycks alla belopp i fasta priser (1992 års nivå omräknat med KPI).

a) Arbets- och pensionsinkomster —— aggregerade belopp

Till arbets- och pensionsinkomster har förts de inkomster som brukar sorteras in i det taxeringsmässiga begreppet "inkomst av tjänst och näring". Avdrag har gjorts för premier för pensionsförsäkring som här ses som en omperiodisering av arbetsinkomstema till en senare tidpunkt.

9. Tabell: Arbets— och pensionsinkomster för hushåll 18-64 år. HINK-makrotal. Beloppen för 1989 och 1990 inkluderar utlagda basbreddningar.

mdkr (1992 än priser) 1989 1990 1991

Förändring 1989-1992 mdkr % -28,8 -4,4% -7,9% -7,8 -38,2% -40,4% -18,5 -30,3% -32,8% -55,0 -7,5% -10,9% +27,5 +250,7% +237,9% +3,8 +168,l% +158,3% -6,4 -45,0% -47,1% -17,3 -2,4% -5,9% +3 6 +7,6% +3,7% -1,8% -5,3%

1992 % per k.e.

Lön Företagsinkomst 20,4 17,8 14,6 12,6 Sjukpenning m.m. 61,0 63,6 57,2 42,5 Delsumma ovan 734,0 745,8 698,2 678,9 Arbetsmarknadsstöd ] 1,0 1 1,2 18,3 38,4 Övriga inkomster m.m. 2,3 2,9 5,8 6,1 Pensionspremie 14,1 1 1,0 9,3 7,8 511an arbetsinkomst 733,0 749,0 713,0 715,7 Pension 47,7 47,9 51,4 51,3 Totalt arbete-+ pension

Från 1992 betalar arbetsgivaren de första 14 dagarna i en sjukperiod med sjuklön i stället för sjukpenning från försäkringskassan. Dessutom sänktes nivån i sjukförsäkringen under de inledande tre dagarna av en sjukperiod. Detta medför att vad som innefattas i lön resp. sjukpenning inte är detsamma över åren. Totalt har ersättningar i form av lön, företagarin- komst och sjukpenning i fasta priser minskat med 55 mdkr eller 7,5 procent mellan 1989 och 1992. Tas hänsyn till försörjningsbördan genom att räkna per konsumtionsenhet uppgår minskningen till inemot 11 pro- cent. Minskningen uppvägs delvis av att arbetsmarknadsstödet ökat med drygt 27 mdkr. Hushållen har också dragit ned på betalningarna av privata pensionsförsäkringspremier i förhållande till 1989 vilket är av betydelse för utvecklingen av hushållens disponibla inkomst. Vad som är en "normal" nivå på premiebetalningarna mera långsiktigt är dock svårt att avgöra. Med det gamla skattesystemet marknadsförde försäkrings- bolagen pensionsförsäkringama bl.a. med skatteplaneringsargument. Det kan antas att premiebetalningarna i högre inkomstlägen var tillfälligt förhöjda 1989 som var det sista året med det gamla skattesystemets höga marginalskatter. Skatteplaneringsmotivet har kraftigt minskat med det nya skatte systemet. Utformningen av det framtida kollektiva pensionssystemet kommer däremot att påverka hushållens egna pensionssparande. Än är det dock för tidigt att bedöma vilken långsiktig nivå det privata pensionsspa- randet kommer att hamna på när förhållandena stabiliserats och hushållen överblickar och fått erfarenhet av inkomsteffekterna av det nya systemet.

Totalt har arbets- och pensionsersättningama minskat med ca 14 mdkr eller strax under två procent. Tas hänsyn till försörjningsbördan uppgår minskningen i arbets- och pensionsinkomster för hushållen i aktiv ålder till drygt 5 procent. Ser man till tidsprofilen på förändringen var 1990 fortfarande ett "bra" år för hushållen. Omslaget kom under 1991. Arbets- och pensionsinkomstema ligger 1992 i stort sett kvar på samma nivå som 1991.

b) Kapitalinkomster — aggregerade belopp

Tabellen nedan visar vissa variabler med anknytning till de aktiva hushållens kapitalinkomster och kapitaltillgångar. När man studerar siffrorna bör man vara medveten om att de är behäftade med osäkerhet. Viss reservation kring de slutsatser som dras kan därför vara på sin plats.

10. Tabell: Kapital. Hushåll 18—64 år. HINK-makrotal för åren 1989—1992. Beloppen för 1989 och 1990 inkluderar utlagda basbreddningar. mdkr (1992 års priser) Förändr, mdkr 1989 1990 1991 1989—1992

32,6 33,7 27,2

1992 31,1 Ränteinkomster/utdelningar m.m. , +4,0

Ränteutgiher 82,3 89,1 79,1 86,3

Ränlenetta -49,6 c5,4 -5l,9 -55,2 -5,5 Reavinst 29,4 33,1 32,2 14,1 -15,3 Reaförlust 0,2 0,2 2,3 3,7 +3,5 Reavinst netto 29,2 32,9 29,8 10,4 48,8 Skatt på reavinst/reaförlust 11,4 12,3 9,3 2,9 —8,5 Reavinst netto efter skatt 17,8 20,6 20,5 7,5 —10,3

Tillgångan'slmlder.

Bankmedel (privat) 252 243 Andra finansiella tillgångar 389 341 207 204 -185 Eget hem/fritidshus marknadsvärde 1015 1058 1087 957 -58 Privatskuld 755 752 641 638 -1 17

Anm. ante 1 utgihsrantor brutto.

Hushållens banktillgodohavanden har minskat i fasta priser mellan 1989 och 1992. Finansiella tillgångar i övrigt har minskat kraftigt i värde nästan en halvering i fasta priser. Men osäkerheten i siffrorna bör understrykas. Slumpfelen i det statistiska underlaget är stora för denna post. Minskningen förklaras bl.a. av ett kraftigt kursfall på värdepapper under denna period. Detta illustreras av att generalindex för aktier sjönk med nästan 28 procent från slutet av 1989 till slutet av 1992. Beaktas att inflationen samtidigt ökade med drygt 23 procent rör det sig således om en halvering av aktiekurserna i fasta priser. Ränteinkomstcr/utdelningar har i fasta priser minskat mellan 1989 och 1992 — minskningen är dock liten.

Hushållens privata låneskuld7 minskade med 117 mdkr i fasta priser mellan 1989 och 1992. Minskningen inträffade i första hand mellan 1990 och 1991. Mellan 1990 och 1991 minskade också ränteutgiftema med ca 10 mdkr. Ett höjt ränteläge medförde dock att ränteutgiftema åter ökade

"Skulder i näringsverksamhet år inte medräknade.

under 1992. Sett över hela perioden 1989-1992 har ränteutgiftema, trots den minskade låneskulden, ökat med 4 mdkr. Beaktar man begränsningen av ränteavdragen har hushållens nettokostnader för lånen ökat ännu mera. Under 1992 sjönk marknadsvärdet på eget hem/fritidshus vilket är av betydelse för hur hushållen ser på sin skuldsättning.

Reavinstema, som åren 1989 till 1991 låg på en hög nivå, minskar mycket kraftigt 1992. Reavinstema är 1992 endast en tredjedel av vad de var åren dessförrinnan. Minskade reavinster innebär att staten 1992 tappar skatteinkomster i storleksordningen 6 a 7 mdkr jämfört med högkon- junkturåret 1991. Som tidigare nämnts bör dock reavinsternas utfall ses samlat över längre perioder och bedömas utifrån ett sådant mera lång- siktigt perspektiv.

Före skattereformen var det mycket förmånligt att överföra del av sparandet på barnen. Detta berodde dels på att det fanns ett sparavdrag (ränteinkomst under 1.600 kr var skattebefriad) dels på att barnen kunde utnyttja grundavdraget på 10.000 kr fullt ut mot kapitalinkomstema. I praktiken kunde ett barn 1989 ha en ränteinkomst på 11.600 kr eller ett kapital på över 100.000 kr utan att betala skatt (förutsatt att barnet inte hade andra inkomster). En specialbearbetning visar att de samlade finansiella tillgångarna hos barnen är ca 24 mdkr och räntor och utdelningar på detta kapital uppgår till 1,7 mdkr om året. I samband med skattereformen har skatten på barns räntor/utdelningar ökat med ca 400 mkr från ca 130 mkr till ca 520 mkr 1992 (tabell 11).

11. Tabell: Räntor, utdelningar och beräknad skatt för bam (under 18 år) år1989 och 1992

1989 1992 Total! m edel- andel Totalt m edel— andel värde med värde med värde värde mkr kr % mkr kr % Bankmedel 18 041 9 808 61 20 437 10 624 59 Aktier och andra finansiella 6 440 3 501 16 3 788 1 969 22 tillgångar Faktiska räntor och utdelning 1 734 943 62 1 737 903 61 Beräknad skatt 132 71 3 521 271 61

mara—mum beskattningsbara inkomster. 1 övrigt har 1989 års skatteregler tillämpats. Skatten för 1992 är beräknad med 30 procent av räntor och utdelningar för samtliga. Siffrorna i tabellen bygger på bearbetningar av kontrolluppgifter vilket innebär att räntor som understiger 100 kr från en och samma bank inte ingår i beloppen eftersom någon kontrolluppgift inte lämnas i dessa fall. Barn med mycket små innehav av bankmedel kommer således inte med i beloppen och i det beräknade andelsmlet (ca 60 procent) för bankmedelinnehav.

En intressant iakttagelse år att kapitalet ännu så länge ligger kvar på barnen trots att det numera från skattesynpunkt är egalt om det läggs på

barnen eller föräldrarna. Det finns säkert Viss tröghet i att "ta tillbaka" sparandet från barnen och de ändrade skattereglerna kan i så fall förmodas främst få betydelse för fördelningen av nysparandet. Men det kan också vara så att hushållen i första hand ser, och även tidigare har sett, sparandets fördelning mellan familjemedlemmarna som en långsiktig inkomstplaneringsfråga mellan generationerna snarare än en skatteplane- ringsfråga. Sparandets fördelning mellan barn och föräldrar skulle i så fall vara relativt okänsligt för skattereglerna. Eftersom det med de nya skattesystemet är egalt för det totala skatteuttaget om ränteinkomsterna ligger på föräldrarna eller barnen försvinner skatteplaneringsmomentet ur bilden och sparandet styrs av andra överväganden.

c) Icke skattepliktiga transfereringar m.m. — aggregerade belopp

I samband med skattereformen förstärktes barn- och bostadsbidrag. Barnbidragen höjdes från 5820 kr per barn (löpande pris) år 1989 till 9000 kr per barn är 1991. Ensamstående med barn fick för åren 1991 och 1992 efter ansökan ett särskilt stöd om 1800 kr via försäkringskassan som kompensation för att skattereduktionen på 1800 kr för ensamstående med barn slopades i samband med skattereformen. Beloppet för 1991 ut- betalades i många fall först under 1992. Bostadsbidragen höjdes.

12. Tabell: Översikt bambidmg m.m.

1989 1990 1991 1992 Barnbidrag, löpande priser 5 820 kr 6 720 kr 9 000 kr 9 000 kr Barnbidrag, 1992 års priser 7 188 kr 7 520 kr 9 202 kr 9 000 kr Skattereduktion för ensamst. m. barn 1 800 kr 1 800 kr slopad slopad Kompensationsstöd för ensamstm. barn 1 800 kr 1 800 kr Avdrag för underhållsbidrag 3 000 kr 3 000 kr slopat slopat

_Transfereringarna till hushållen har ökat kraftigt mellan 1989 och 1992 (se tabell 13) vilket till del beror på de förändringar i bidragssystemen som gjordes i samband med skattereformen. 1 fasta priser uppgår ökningen till ca 12 mdkr eller drygt 30 procent. Barn- och bostadsbidrag svarar för mer än hälften av denna ökning (+6,5 mdkr). Mellan i första hand 1991 och 1992 ökar också socialbidrag och studiemedel vilket bl.a. torde sammanhänga med det ändrade arbetsmarknadsläget.

13. Tabell: Bidrag m.m. Hushåll 18—64 år. HINK—makrotal.

mdkr (1992 års priser) 1989 1990 1991 1992

13,4 13,8 17,3

Förändring 1989- 1 992 mdkr i %

Barnbidrag Underhållsbidrag 5,6 5,3 5,7 5,5 -0,1 -l,6 Bostadsbidrag 4,8 4,9 6,3 7,5 +2,8 +58,3 Socialbidrag 4,1 4,4 4,8 6,5 +2,4 +57,7 Studiemedel 9,0 9,0 9,9 1 1,7 +2,8 +30,7 Övriga positiva transfereringar 0,7 0,6 0,5 1,1 +0,3 +47,9

Summa erhållna skattefria transf. 37,5 37,9 44,5 49,4 +11,9 +31,6

Betalda negativa transfereringar 5,4 5,0 4,9 Anm. Betalda negativa uansfereingar avseri reta hand återbetalning av rtudiemedel.

Antalet hushåll som fick bostadsbidrag ökade mellan 1989 och 1991 med 86.000 och till 1992 med ytterligare 39.000. Andelen hushåll med bostadsbidrag ökade från 7,1 procent 1989 till 10,4 procent 1992. Höjda hyror och ökad arbetslöshet är viktiga förklaringar.

14. Tabell: Utvecklingen av antalet bostadsbidraghushåll åren 1989-1992. Tusental (i maj månad respektive år).

Barnfamiljer Hushåll utan barn Samboende Ensamstående 18-28 år 29 år el. äldre Totalt

1989 98 133 12 - 242 1990 uppgift saknas

1991 132 153 29 14 328 1992 136 170 40 21 367 Förändring 1989-1992 +38 +37 +28 +21 +125

Källa: Boverket Rapport 199521

d) Slutlig skatt -— agregemde belopp

Den slutliga skatten inkluderar utöver skatt på förvärvs- och kapitalin- komster även fastighetsskatt och förmögenhetsskatt. Det nya skattesyste- met är mera "transparent". Skatten kan delas upp i skatt på förvärvsin- komst och kapital genom att dessa efter skattereformen beskattas separat. Före skattereformen beskattades arbets- och kapitalinkomster i samma förvärvskälla.

Den slutliga skatten för aktiva hushåll har i fasta priser minskat från 275 mdkr till 217 mdkr mellan 1989 och 1992 — en minskning med 57 mdkr. Rensas för reavinsternas inverkan på skatteutfallet blir minskningen 49 mdkr.

15. Tabell: Slutlig skatt. Hushåll 18-64 år. HINK-malnutal.

] 989

Skott på inkomst av gånst+nåring:

Dito skatt i % av arbets- och pensionsinkomst

Skatt på kapital m.m; Nettoskatt på råntor/utdelningar/låneräntor

Nettoskatt på reavinst/reaforlust 1 1,4 Fastighetsskatt 2,6 Förmögenhetsskatt 2,8 Övrigt 0,0 Slutlig skatt inkl. skatt på reavinst 274,5 Dito skatt i % av arbets- och pensionsinkomst 35,2% Slutlig skatt exkl skatt på reavinst 263,1

Dito skatt i % av arbets- och pensionsinkomst 33,7%

1990

12,3 3,4 1,9

0,0

277,7 34,8% 265,4 33,3%

mdkr (1992 års priser)

199]

225,4 29,5%

1,8 -15,6 9,3 6,8 1,4

-1,7

2255 29,5% 216,2 28,3%

1992

2228 29,1%

-5,2 -16,2 2,9 7,1 1,1

-0,3

217; 28,3%

214,4 28,0%

materialet jämfört med hur den redovisas på skattsedeln. Egenavgihema ingår inte i slutliga skatten i HINK.

Förändring, mdkr

] 989- 1992

-8 5 +4,5 -l,7

-57,2

—48,7

Aunli-"ör att uppnå jämförbarhet med löntagarna har egenlbretagamu/näringsidkamas slutliga skatt justerat.: i HINK-

Uttryckt i procent av arbets- och pensionsinkomsterna för de aktiva hushållen har skatteuttaget (rensat för reavinst) minskat från 33,7 till 28

procent.

e) Disponibel inkomst - aggregerade belopp

I tabell 16 sammanförs HlNK-makrotalen för arbets- och pensionsin- komster, kapitalinkomster, transfereringar och skatt och den disponibla inkomsten beräknas.

Rensat för reavinst har den disponibla inkomsten för hushåll i aktiv ålder ökat med 46 mdkr i fasta priser mellan 1989 och 1992 —— en ökning med 7,8 procent. Ökningen fördelar sig relativtjämnt över åren; 1990 +16 mdkr, 1991 +17 mdkr och 1992 +13 mdkr. Men drivkrafterna

var olika.

1991- 1992

_7,0 -0,6 -6,4 +0,3 _o,3

16. Tabell: Disponibel inkomst. Hushåll 18—64 år. HINK-makrotal.

mdkr (1992 års priser) 1989 1990 1991 1992 780,7 796,9 764,4 767,0

Förändring 1989-1992 mdkr i % -13,7 -1,8%

i % per k.e.

a) Arbets- och pensionsinkomst

bl) Ränteinkomster/utdelningar 32,6 33,7 27,2 31,1 b2) Reavinst, brutto 29,4 33,1 32,2 14,1

-l,5 -4,7% —8,1% -15,3 -52,0% -53,8%

cl) Erhållna skattefria transfer. 37,5 37,9 44,5 49,4 02) Betalda negativa transfer. 5,4 5,0 4,9 5,1

+1 1,9 +3l,6% +26,8% -0,3 -5,1% -8,6%

dl) Slutlig skatt inkl. skatt på reavinst 274,5 277,7 225,5 217,3 d2) Slutlig skatt exkl. skatt på reavinst 263,1 265,4 216,2 214,4

—57,2 -20,8% -23,7% -48,7 -18,5%

Disponibel inkomst inkl. reavinst 600,4 618,9 638,0 639,2 (=a+bl+b2+cl-c2-d1) Disponibel inkomst exkl. reavinst 582,4 598,1 615,1 628,1 (=a+bl+cl-02-d2)

+38,8 +6,5% +2,6%

+45,6 +7,8% +3,9%

1990 sammanhängde ökningen med ökade löner. I övrigt var föränd— ringarna relativt små.

1991 minskade lön och företagarinkomster (inkl. sjukpenning) i fasta priser med 48 mdkr. Ökat arbetsmarknadsstöd och ökade pensionsersätt- ningar och en viss neddragning av de egna pensionspremiebetalningar be- gränsade nedgången till 32,5 mdkr. Barnbidrag, bostadsbidrag, social- bidrag och studiemedel ökade med inemot 7 mdkr. Skattebetalningarna (rensat för skatt på reavinst) minskade i fasta priser med 49 mdkr. Huvudförklaringen till minskningen av skatten detta år är naturligtvis genomförandet av skattereformens andra etapp. Men även de i fasta priser minskade arbets- och pensionsinkomsterna spelar roll. Dessa torde förklara i storleksordningen 10 a 15 mdkr av den i fasta priser beräknade minskningen av skattebetalningarna. Att skattereformen detta år får så stort genomslag beror bl.a. på att man till följd av de kraftiga löneök- ningarna 1990 och tidigare år förts upp i marginalskatteskikten. Detta medför att sänkningen av skatten 1991 till skattereformens 30/50- procentssatser blir desto kraftigare. Den inkluderar så att säga även den skatteskärpning som uppstod 1990 (och tidigare år) till följd av de höga löneökningarna. De framskrivningar som gjordes i samband med skattere— formen baserades på förutsättningen om en lugnare löneutveckling.

Löner/företagarinkomster/sjukpenning minskar 1992 med ytterligare 20 mdkr. Till del förklaras minskningen av de besparingar som gjordes genom ändringar i sjukförsäkringen. Minskningen uppvägs av att arbets— marknadsstödet ökade med 20 mdkr. Ränteinkomsterna ökade med 4 mdkr. Bostadsbidrag, socialbidrag och studiemedel ökade med nästan 5 mdkr. Skattebetalningama (exkl. skatt på reavinst) minskade men mycket lite. Skatten (exkl. reavinst) minskade från 28,3 procent av förvärvsin- komstema till 28,0 procent.

Övergång från HINK—makrotal till inkomst per konsum tionsenhet

Ovan har beskrivits utvecklingen aggregerat för hushåll i aktiv ålder. Ingen hänsyn har tagits till försörjningsbördan. Men antalet personer har ökat och antalet ensamståendehushåll har blivit fler. Mätt i volym (antal konsumtionsenheter) har försörjningsbördan för hushåll i aktiv ålder ökat med 3,8 procent mellan 1989 och 1992.

Rensat för reavinst har den disponibla inkomsten för hushåll i aktiv ålder ökat med 3,9 procent per k.e. Beroende på att reavinsterna minskat under perioden blir ökningen inklusive reavinst något lägre (2,6 procent).

Förändring 1989-1992, %

Inkomslbegrepp: HINK—m akroial Dita per k.e. Disponibel inkomst inkl. reavinst +6,5 +2,6 Disponibel inkomst exkl. reavinst +7,8 +3,9

Vilka hushåll ärföretrådda i de olika decilerna?

Nedan kommer utvecklingen att beskrivas för hushåll med olika dis- ponibel inkomst. Den metod som därvid används är den som är gängse i denna typ av studier. Hushållen sorteras efter storleken på sin disponibla inkomst per konsumtionsenhet (ke). Sorteringen har gjorts efter disponibel inkomst inklusive reavinst (SCB:s ordinarie disponibelin- komstbegrepp). Efter denna sortering indelas hushållen i 10 intervall s.k. deciler som vardera innehåller 10 procent av hushållen. Eftersom antalet hushåll i aktiv ålder uppgår till ca 3,5 miljoner innebär detta att varje decil omfattar ca 350.000 hushåll. Tabellerna 17 a-d visar för 1992 vilka hushållstyper som återfinns i de olika decilerna.

Hushåll utan barn utgör antalsmässigt 70 procent av hushållen, samboen- de med barn 24 procent och ensamstående med barn 7 procent.

I första decilen återfinns i första hand unga ensamstående och inkluderar bl.a. gruppen kvarboende utan större egna inkomster. Ensamstående med barn har sin tyngdpunkt i decilerna 2 till 4 vilket även gäller för familjer med 3 eller flera barn. Samboende enbarnsfamiljer ligger däremot med tyngdpunkten högre upp i decilerna. De tre översta decilerna domineras av hushåll utan barn där man kommit en bit upp i åren.

Arbetarfamiljerna är koncentrerade till decilerna 4 till 8 medan tjänst- mannafamiljema ligger med sin kärna i decilerna 7 till 10. Den socioeko- nomiska grupperingen visar också med tydlighet att decil 1 socioekono- miskt sett är en heterogen samling.

En allmän reservation bör framföras kring resultaten för decil 1. Sammansättningen av decil ] är så blandad att man inte bör dra några egentliga slutsatser om de ekonomiska levnadsförhållandena enbart baserat på de utvecklingstal för decilen som visas i denna rapport.

17. Tabell:"Vilka hushållstyper återfums i de olika decilema?" Hushåll 18—64 år. 1992.

a) Hushållssanmiansättning. Fördelning (%) inom resp. decil.

Hushållstyp Decil efter disponibel inkomst per k.e Samtliga

1 2 3 4 5 6 7 8 9 10 hushåll Ensamstående utan barn 81 51 39 43 49 51 50 42 41 32 48 18-24 65 27 15 17 16 13 8 3 3 0 17 25—44 10 14 14 17 21 24 27 22 20 15 18 45-64 6 10 10 9 12 14 16 16 19 17 13 GiftaÅram boende utan barn 4 7 8 8 11 15 23 40 45 55 22 18-24 1 1 1 1 2 3 3 3 2 O 2 25-44 0 2 2 1 2 3 7 9 l 1 10 5 45-54 1 1 1 1 2 3 5 13 16 24 7 55-64 1 3 4 4 5 6 9 15 16 20 8 Ensamstående med barn 3 15 18 13 7 4 2 3 ] 1 7 Samboende med barn 12 27 36 37 33 31 25 16 13 11 24 1 barn 3 5 7 9 14 16 15 10 9 7 9 2 barn 4 8 17 22 16 13 7 5 4 3 10 2+ barn 5 14 12 7 3 2 2 1 0 1 5 Summa 100 100 100 100 100 100 100 100 100 100 100

b) Hushållssanunansätlning. Fördelning (%) på olika deciler:

Decil efter disponibel inkomst per ke

Hushållstyp ] 2 3 4 5 6 7 8 9 10 Sum m (: Ensamstående utan barn 17 11 8 9 10 11 10 9 9 7 100 18-24 39 16 9 10 10 7 5 2 2 0 100 25-44 5 8 7 9 12 13 15 12 11 8 100 45-64 4 8 8 9 11 12 13 14 13 100 Gifta samboende utan barn 2 3 4 4 5 7 11 19 21 26 100 18—24 4 8 4 9 13 16 18 17 10 1 100 25-44 1 5 4 3 4 6 14 19 23 22 100 45-54 2 2 2 2 3 7 19 24 36 100 55-64 2 3 4 4 6 8 11 18 20 24 100 Ensamstående med barn 4 22 27 19 11 6 3 4 2 1 100 Samboende med barn 5 11 15 15 14 13 10 6 5 5 100 1 barn 4 5 7 9 15 17 16 11 9 8 100 2 barn 4 8 17 22 16 13 8 5 4 3 100 2+ barn 10 30 26 15 7 4 4 2 1 1 100 Samtliga hushåll 10 10 10 10 10 10 10 10 10 10 100

___—___—

ci Socioekonomisk gruppering. Fördelning (%) inom resp. decil.

Socioekonomisk Decil efter disponibel inkomst per k.e. Samtliga grupp 1 2 3 4 5 6 7 8 9 10 hushåll Ejförvårvsarbetande: 67 37 29 1 7 12 9 6 5 4 2 19 - studerande 47 11 8 2 2 1 0 0 0 0 7 - pens. 18-64 år 2 10 14 9 6 4 3 4 3 2 6 - övr ej törvarb 18 16 7 6 4 4 2 1 0 0 6 A nstå'llda: 21 54 66 79 86 88 92 92 95 95 77 Arbetarfamiljer: 10 25 32 38 43 41 40 36 30 11 31 - ej facklårda 8 16 20 24 25 24 22 21 13 6 18 - facklärda 2 9 12 15 18 17 18 15 17 5 13 Tjänstemannafamiljer 3 1 1 21 27 28 34 38 40 49 75 33 - lägre 1 4 5 10 9 10 12 11 10 10 8 — mellan 2 5 12 12 14 18 17 18 24 31 15 - högre 0 1 3 5 5 6 9 10 15 34 9 Övriga anställda 7 19 13 13 15 14 14 17 16 9 14 Lantbrukare 4 3 1 1 I 1 0 0 0 0 Egenföretagare 8 6 3 3 2 2 2 2 3 3 Summa 100 100 100 100 100 100 100 100 100 100 100 d) Socioekonomisk gruppering. Fördelning (%) på olika deciler. Socioekonomisk Decil efter disponibel inkomst per k.e. grupp 1 2 3 4 5 6 7 8 9 10 Summa Ejfa'rvärvsarbetande: 36 20 16 9 6 5 3 3 2 1 100 - studerande 65 15 12 3 3 1 0 0 0 0 100 - pens. 18-64 år 3 18 24 16 10 7 5 7 6 4 100 - övr ej förvarb 31 27 12 10 7 8 4 2 O 0 100 Anställda: 3 7 9 10 11 11 12 12 12 12 100 Arbetarfamiljer: 3 8 10 13 14 13 13 12 10 4 100 - ej facklärda 5 9 11 13 14 13 12 12 8 3 100 - facklärda 1 7 10 12 14 13 14 12 13 4 100 Tj änstemannafamilj er 1 3 6 8 9 10 12 12 15 23 100 - lägre 2 5 6 12 11 12 14 14 12 12 100 - mellan 1 3 8 8 9 12 11 12 15 20 100 - högre 0 2 4 5 6 6 10 11 17 38 100 Övriga anställda 5 14 10 10 11 10 10 12 11 7 100 Lantbrukare 35 23 12 8 5 5 4 3 2 2 100 Egenföretagare 25 19 9 10 5 5 7 6 5 8 100 Samtliga hushåll 10 10 10 10 10 10 10 10 10 10 100

Utvecklingen av disponibel inkomst per k.e.

Utvecklingen av disponibel inkomst per k.e. för de olika decilerna framgår av sammanställningen nedan. Disponibel inkomst visas dels inklusive dels exklusive reavinst.

18. Tabell: Förändring av disponibel inkomst per k.e. lör olika deciler 1989-1992. Hmhåll i aktiv ålder. Fasta priser.

Inkomst- Decil efter disponibel inkomst per k.e. begrepp 10 exkl

Tidsperiod 1 2 3 4 5 6 7 8 9 10 toppskikt Samtliga Disponibel inkomst inkl reavinst:

1989-1990 -4,3 +0,1 +0,9 +1,1 +2,4 +3,0 +3,2 +2,9 +2,4 +4,6 +0,5 +2,0 1990-1991 -15,4 -1,2 -l,0 -1,4 -1,3 -0,6 +0,7 +1,8 +2,8 +5,0 +6,8 +1,0 1991-1992 -1,9 -0,1 +0,4 +0,7 +1,0 +0,7 -0,1 -0,3 +0,2 -4,1 +0,8 -0,4 Helaperioden -20,6 -1,2 +0,2 +0,3 +2,1 +3,2 +3,8 +4,5 +5,4 +5,3 +8,2 +2,6 Disponibel inkomst exkl. reavinst: 1989-1990 -2,9 +0,1 +0,8 +1,4 +1,9 +2,9 +3,2 +2,7 +2,4 +2,6 +1,8 +1,6 1990-1991 -15,5 - 1,2 -0,9 -l,5 -l,2 -O,6 +0,9 +1,5 +2,5 +5,0 +5,3 +0,8 1991-1992 -2,0 -0,0 +0,5 +0,7 +1,4 +1,3 -0,0 +0,3 +1,2 +4,2 +3,3 +1,5 Helaperioden —19,6 —1,2 +0,4 +0,6 +2,1 +3,5 +4,1 +4,5 +6,2 +12,3 +10, 7 +3.9

Det mest iögonfallande är utvecklingen för de 10 procent av hushållen som har lägst inkomster. Även decilgrupp 2 har haft en negativ ut- veckling om än obetydlig. Övriga decilgrupper har haft en positiv utveck- ling med de högsta procentuella förändringarna för decilgrupperna 6-10. Rensat för reavinst ligger ökningen av den disponibla inkomsten i decilerna 6-8 kring 3,5 å 4,5 procent, för decil 9 på 6 procent och för översta decilen på 12 procent. Reavinstema minskade kraftigt mellan 1991 och 1992 vilket har stor betydelse för översta decilen. Inkluderas reavinsterna i den disponibla inkomsten begränsas ökningen i decil 10 till 5 procent medan effekterna för övriga deciler av att inkludera reavinster- na har relativt liten inverkan på utvecklingstalen.

Att hushållen dragit ned på betalningarna av privata pensionspremier bidrar till ökningen av hushållens disponibla inkomster. Som framgår av tabell 19 svarar neddragningen av pensionspremierna för 1,2 procenten- heter av ökningen av den disponibla inkomsten för de aktiva hushållen.

19. Tabell: Utvecklingen a'v disponibel inkomst etter och före frånräkning av privata pensionspremier: Hushåll i aktiv ålder-.

lnkomstbegrepp Decil efter disponibel inkomst per k.e

10 exkl Sam t— 1 2 3 4 5 6 7 8 9 10 toppskikt liga

Disponibel inkomst inkl reavinst: p-premie avdragen —20,6 -l,2 +0,2 +0 3 +2,1 +3,2 +3,8 +4,5 +5,4 +5,3 +8,2 p-premie ej avdragen -20,8 -1,6 +0,0 +0,1 +1,5 +2,5 +2,9 +3,8 +3,6 +2,3 +4,9

Disponibel inkomst exkl. reavinst: p-premie avdragen -l9,6 -l,2 +0,4 +0,6 +2,1 +3,5 +4,1 +4,5 +6,2 +12,3 +10,7 p-premie ej avdragen -l9,8 -l,6_ +0,2 +0,4 +1,5 +2,8 +3,1 +3,8 +4,3 +8,4 +7,2

Särskilt för decil 10 är neddragning av premiebetalningama en viktig orsak till att man har fått mer att disponera 1992 än 1989. Med stabila regelsystem för skatter och pensioner bör avsättningarna var någorlunda jämnt fördelade över åren och de har därför ingen större betydelse för utvecklingen av den disponibla inkomsten. Just de år som studeras i denna rapport har emellertid ändringarna av skattereglerna haft betydelse för storleken på hushållens premiebetalningar och därmed även för hur de disponibla inkomsterna utvecklats.

Vad har då hänt med inkomsterna mellan 1989 och 1992 i de olika hushållsdecilerna?

Arbets- och pensionsinkomstema är av grundläggande betydelse för hushållens inkomstutveckling. Tabellen nedan visar hur dessa förändrats i olika deciler mellan 1989 och 1992.

20. Tabell: Arbets- och pensionsinkomstemas utveckling 1989-1992 lör olika deciler. Hushåll 18—64 år. Per k.e. Fasta priser.

Förändring per k.e. i % mellan 1989 och 1992. Fasta priser.

Län+ Föne betalning av piivatapenspremierArbets- och

företagsinkomst+ pensionsink. Decil efter d'l—VP- sjukpenning m.m. arbetsinkomst arbets+pensionsink. efter betalda

ink. per k. e. privata pens.prem ier

1 -51 -40 -38 -38

2 -26 -16 -16 -16

3 -19 -12 -12 -12

4 -15 -9 -9 -8

5 -13 -7 -8 -8

6 -11 -6 -6 -6

7 -8 -5 -6 -6

8 -11 -8 -6 »6

9 -9 -7 -5 -4

10 0 +2 +4 +6

decil 10 exkl. -3 -3 -1 +2

toppskikt Samtliga -1 1 -7 -6 -5

+2,6 +1,4

+3,9 +2,7

I första decilen har ersättningarna i form av lön, företagsinkomst och sjukpenning halverats i fasta priser. Stor roll spelar därvid ökade förluster i egenföretagen. [ arbetsinkomst har utöver de nämnda ersätt- ningarna även inkluderats arbetsmarknadsstöd och "övriga skattepliktiga inkomster”. Helt klart är att arbetsmarknadsläget haft inverkan på de låga decilerna. Summa arbets- och pensionsinkomst har i decil l minskat med 38 procent, i decil 2 med 16 procent och i decil 3 med 12 procent.

I decil 10 har arbets- och pensionsinkomstema (före avdrag för betalning av pensionsförsäkringspremier) ökat med 4 procent. Utveck- lingen för decil 10 är dock inte representativ för merparten av de 350.000 hushållen i decilen. Undantar man översta topprocenten och ser till decilens övriga 315.000 hushåll har arbets- och pensionsinkomstema före premiebetalningar minskat med 1 procent. Efter hänsyn till att man dragit ned premiebetalningarna ökar arbets- och pensionsinkomstema för denna nedre del av decil 10 med 2 procent att jämföra med 6 procent för decilen som helhet. Detta pekar på att överst i decil 10 finns ett toppskikt av hushåll som haft en relativt sett bättre inkomstutveckling än hushåll i övriga delar av inkomstfördelningen. Decil 10 har också dragit ned på betalningarna av pensionsförsäkringspremier i större utsträckning än övriga deciler vilket närmast får ses som en indikation på att pensionsför- säkringar utnyttjades för skatteplanering under de sista åren med det gamla skattesystemet. HINKrs uppgifter om arbetsinkomsternas ut- veckling för toppskiktet bland hushållen är dock osäkra, 1 avsnitt 5 där inkomster och skatter redovisas utifrån ett individperspektiv kommer arbetsinkomsternas utveckling för toppskiktet att belysas utifrån en specialbearbetning av den totalräknade inkomststatistiken. Samman- fattningsvis kan här sägas att uppgifterna styrker att höginkomsttagama haft en bättre utveckling av arbetsinkomsterna än vad som gäller i genomsnitt för de helårs- och heltidsarbetande. Det visar sig också att omsättningen av personer är ganska stor i toppskiktet. Det är således inte exakt samma personer som återkommer i toppskiktet år efter är.

Inkomsternas sammansättning i olika deciler

Tabellen nedan visar olika inkomstposters andel av den disponibla in- komsten åren 1989 och 1992. lnkomstposterna har därvid relaterats till disponibel inkomst rensat för reavinst.

askattepliktiga ersättningar som ej är pensionsgrundande (t.ex. utbetalningar från vinstan- delsstittelse), skattepliktigt periodiskt understöd samt reglering av vissa mellanhavanden mellan fåmansföretag och den egna "privata" ekonomin. Dessa "övriga inkomster" är av mindre betydelse utom i de högsta inkomstlägena.

Bilaga 4 Hushåll i aktiv ålder 221 21. Tabell: Disponibla inkomstens sammansättning för hushåll (18-64 år) i olika deciler 1989 och 1992. Andel % av disponibel inkomst (exkl reavinst) A rbets- varav ränte- skattefria skattefria skatt Disponibel Decil efter och arbetsmark- inkomster/ positiva negativa exkl. skatt inkomst disponibel pensionsink. nadsstöd utdelningar transfer. transfer. reavinst exkl. inkomst per k.e. "bidrag" reavinst 1 1989 93,9 2,6 7,2 25,8 1,6 25,3 100 1992 72,5 13,1 8,0 42,4 1,2 21,7 100 2 1989 1079 4,4 3,5 20,0 0,9 30,6 100 1992 91,7 12,8 3,1 28,0 0,7 22,1 100 3 1989 118,2 3,2 3,3 14,4 0,8 35,2 100 1992 103,8 9,3 2,9 19,0 0,7 25,0 100 4 1989 125,24 3,0 3,2 10,3 1,0 38,4 100 1992 1 14,5 9,7 3,2 12,0 0,8 28,9 100 5 1989 133,5 2,7 3,7 6,5 0,8 42,8 100 1992 l20,6 9,0 3,2 8,0 0,8 31,0 100 6 1989 135,6 1,9 4,1 4,8 0,8 43,7 100 1992 123,3 7,9 3,6 6,1 1,0 32,0 100 7 1989 l41,1 1,7 4,6 3,0 1,0 47,7 100 1992 l27,9 5,3 4,2 3,3 1,0 34,4 100 8 1989 l43,6 1,1 4,5 2,2 1,2 49,1 100 1992 129,7 4,4 4,4 2,4 0,8 35,7 100 9 1989 l45,5 0,7 5,7 1,4 0,8 51,8 100 1992 132,l 2,8 5,1 1,3 0,7 37,8 100 10 1989 l44,1 0,5 12,2 1,1 0,9 56,6 100 1992 136,5 1,0 9,5 0,8 0,7 46,1 100 decil 10 exkl. 1989 149,0 0,5 7,9 1,1 0,9 57,1 100 toppskikt 1992 136,6 1,1 7,5 0,8 0,7 44,2 100 Samtliga 1989 134,1 1,9 5,6 6,4 0,9 45,2 100 1992 122,1 6,1 5,0 7,9 0,8 34,1 100

Aibetsmarknadsstöd svarar för en ökande andel av den disponibla in(omsten. Detta gäller samtliga deciler men särskilt markant i decilerna 1-7. Bidragsinslaget har ökat i decilerna 1-6, är i stort oförändrat i decilerna 7-9 och har minskat i översta decilen.

5. Inkomster och skatter ur ett individperspektiv Individer i aktiv ålder

5.1. Beskrivning av populationen

I detta avsnitt står individernas skattepliktiga inkomster och skattebe- talningar i blickpunkten. Redovisningen omfattar personer i åldern 18—64 år med undantag av studerande med arbetsinkomst understigande ett basbelopp.

Totalt omfattas 4,9 miljoner personer. Individerna har sorterats med hänsyn till storleken av inkomsten från arbete och pensiong. Materialet redovisas fördelat på deciler. Varje decil omfattar således ca 490.000 individer. Hur de olika decilerna är sammansatta — ålders- och syssel- sättningsmässigt — framgår av sammanställningen nedan. Inte förvånande finns en korrelation mellan ålder och arbetsinkomst. Andelen heltids— arbetande ökar också successivt med stigande deciler.

22. Tabell: Inkonrsttagamas fördelning på ålder/arbetstid inom resp decil. 1992.

Deciler efter arbetsinkomst+pensionsinkomst

] 2 3 4 5 6 7 8 9 10 Summa

Genomsnittlig arbets- och pensionsinkomst, tkr: 23,8 78,9106,1 125,6 141,8 156,6 172,5 192,5 222,5 337,4 155,8 Fördelning på ålder i %:

18-24 år 24 20 19 17 13 10 7 3 3 0 12 25-44 år 42 41 47 50 51 51 51 53 47 44 48 45-54 år 16 17 17 19 20 23 25 26 30 39 23 55-64år 18 22 16 14 16 16 17 17 20 17 17 _ Summa 100 100 100 100 100 100 100 100 100 100 100 Medelålder 37,9 39,8 38,2 38,4 39,6 40,4 41,2 42,3 44,0 45,4 40,7 Fördelning på arbetstid i %: Heltid 13 12 21 34 64 75 81 84 88 92 56 Lång deltid 9 34 49 44 20 14 11 11 8 5 21 Kort deltid 26 22 13 9 7 4 5 3 2 l 9 Övriga 53 33 17 13 9 7 3 2 2 1 14 Summa 100 100 100 100 100 100 100 100 100 100 100

Antalet personer i den studerade populationen är i stort sett oförändrat mellan åren. Men en ökande andel tillhör gruppen "övriga" vilket torde återspegla att ett ökande antal personer har svårt att få en stadig inkomst eller får arbetsmarknadsstöd. Andelen som arbetar kort deltid eller tillhör

. 9Definierad som 1ön+företagarinkomst+sjukpenning m.m.+arbetsmarknadsersättning+öv- riga skattepliktiga ersättningar-avdrag för pensionsförsäkring och periodiskt understöd.

gruppen "övriga" ökar från 19,8 till 23,2 procent mellan 1989 och 1992. Förändringen inträffar mellan 1991 och 1992 (tabell 23).

23. Tabell: Fördelning på arbetstid i procent 1989 1990 1991 1992 Heltid 59,2 57,5 58,9 56,2 Lång deltid 21,1 24,2 21,3 20,6 Kort deltid 8,7 8,2 8,4 9,1 övriga 11,1 10,1 11,4 14,1 Summa 100 100 100 100

Ökningen av övriggruppen hamnar i första hand på decilerna 1-6 (tabell 24). Detta skall inte tolkas som att arbetslösheten i första hand drabbade de personer som tidigare tillhörde dessa deciler. Det är också en följd av att inkomsttagarna i samband med arbetslöshet byter plats i inkomstför- delningen.

24. Tabell: Övriggruppens (ej i arbete) andel i olika deciler 1989-1992

Deciler efter arbetsinkomst+pensionsinkomst I 2 3 4 5 6 7 8 9 10 Summa 1989 45,7 26,7 11,4 9,9 6,6 4,4 2,5 2,1 0,8 0,5 11,1 1990 43,4 23,8 12,8 7,9 5,6 3,2 1,5 1,2 1,0 0,8 10,1 1991 45,9 28,0 13,2 9,9 5,5 4,7 1,9 2,2 1,0 1,4 11,4 1992 52,6 32,6 17,2 13,2 9,5 6,6 3,2 2,3 2,4 1,4 14,1

5.2. Utvecklingen av arbets- och pensionsinkomstema

Arbetsinkomsterna har ändrat sammansättning mellan 1989 och 1992. Inkomsterna av lön, företagsinkomst och sjukpenning har i fasta priser minskat med i genomsnitt 11 tkr per inkomsttagare"). Ökat arbetsmark- nadsstöd, ökade pensioner samt en viss neddragning av de privata pensionspremiebetalningarna gör att nedgången totalt för arbets- och pensionsinkomstema stannar vid ett minus på 2.700 kr.

l”Dessa inkomstposter bör ses samlat beroende på att arbetsgivarinträde (sjuklön) infördes i sjukförsäkringen fr.o.m. 1992. Del av den tidigare sjukpenningen ingår därför fr.o.m. 1992 i lönevariabeln.

25. Tabell: De arbetsrelaterade inkomsterna sanmiansättning (inkl. pension) Genomsnitt per inkomsttagare. 1992 års priser. Individer 18—64 år exkl. studerande.

Andel av inkomst av

Genomsnitt per inkomsttagare, tkr

arbete +pension; %

1989 1992

Förändring Inkomstpost 1989 1990 1991 1992 1989-1992

Lön 132,8 134,6 128,1 127,2 -5,6 83,8 81,7 Företagsinkomst 4,2 3,6 3,0 2,6 - 1,6 2,6 1,7 Sjukpenning m.m. 12,5 13,0 11,8 8,7 -3,8 7,9 5,6 Delsumma ovan 149,5 151,2 [42,9 138,6 -ll,0 94,3 88,9 Arbetsmarknadsstöd 2,2 2,2 3,6 7,5 +5,3 1,4 4,8 Övriga inkomster m.m. 0,4 0,5 1,1 1,1 +0,8 0,2 0,7 Pensionspremie 2,9 2,2 1,9 1,6 -1,3 1,8 1,0 Sunmia arbetsinkomst 149,2 151,7 145,7 145,6 -3,6 94,1 93,5 Pension 9,3 9,2 9,8 10,2 +0,9 5,9 6,5

Totalt arbete+pension

Uttryckt i procent innebär detta att arbets- och pensionsinkomstema för inkomsttagarna samlat sett minskat med 2 procent i fasta priser (se tabell 26).

26. Tabell: Arbets- och pensionsinkomst (inkl arbetsmarlmadsstöd m.m.). 1992 års priser. Genomsnitt samt procentuella förändringar. hidivider 18—64 år exkl. studerande.

Snitt per inkomsttagare, tkr Förändring i % 1989- 1990— 1991— Hela

1990 1991 1992 perioden

Decil efter arbets+ pensionsinkomst 1989 1990 1991 1992

1 30,1 28,0 29,1 23,8 2 77,7 79,7 79,2 78,9 +2 3 106,2 109,0 105,1 106,1 -0 4 127,3 129,3 124,3 125,6 -1 5 145,4 146,8 140,5 141,8 -3 6 161,0 162,6 155,5 156,6 -3 7 177,6 179,9 172,8 172,5 -3 8 198,4 202,7 193,4 192,5 -3 9 229,4 233,6 221,5 222,5 —3 10 331,8 336,9 333,6 337,4 +2 -1 +1 +2 decil 10 exkl 308,0 309,8 302,6 305,7 +] -2 +] -1

toppskiktet

Samtliga 158,5 160,9

Den största minskningen visar decil 1 med en real minskning på 21 procent. Närmare 2/3 av minskningen är hänförbar till försämrade företagsinkomster. I denna decil hamnar nämligen företagare som gått med underskott och som har små andra inkomster. Totalt för decilen är företagarinkomstema negativa. Utslaget på alla inkomsttagare i decilen uppgick dessa negativa företagarinkomster 1989 till strax under 400 kr

och underskottet ökar till 4.100 kr år 1992. Nedgången kan därför sägas återspegla att egenföretagama haft problem i samband med konjunktur- nedgången. De negativa företagarinkomstema har kommit att öka dominansen idecilen.

Minskningen uppgår för decilerna i mellanskiktet (decilerna 5-9) till 3 procent.

Decil 10 uppvisar den bästa inkomstutvecklingen med en ökning på 2 procent. Den avvikande utvecklingen för denna decil är dock inte representativ för merparten av individerna i decilen. Ökningen är kon- centrerad till toppskiktet i decilen. Undantar man ett översta toppskikt om 50.000 personer har decilens inkomster minskat med 1 procent. En förklaring till att det ändå finns en differens ligger i att inslaget av arbets- marknadsstöd är litet. De arbetslösa hamnar i andra deciler och i decil 10 finns kvar personer i arbete. En förklaring till den mera positiva ut- vecklingen för decilen är också att man efter skattereformen dragit ned på betalningarna av privata pensionspremier.

Arbetsinkomstemas utveckling för det översta toppskiktet är i en urvalsundersökning som HINK behäftad med osäkerhet. Inkomstutveck- lingen för toppskiktet kommer därför att belysas i ett separat avsnitt baserat på uppgifter ur den totalräknade inkomststatistiken.

Inkomstsammansättningen i de olika decilerna 1989 och 1992 framgår av tabellen nedan. Framträdande är det ökade inslaget av arbetsmarknadsstöd i framför allt decilerna 1-6. Betalningarna av privata pensionspremier har dragits ned i samtliga deciler men särskilt kraftigt i decil 10. I denna decil kan också noteras ett ökat inslag av inkomster från pensioner (i första hand arbetsmarknads- och övriga enskilda pensioner; se appendix) och från "övriga skattepliktiga inkomster". En hypotes är att det bakom ökningen av "övriga skattepliktiga inkomster" bl.a. skulle kunna ligga utbetalningar från vinstandelsstiftelser. Dessa blev populära under denna period.

27. Tabell: Arbets- och pensionsinkomstemas sanmiansättning i olika deciler 1989 och 1992. Individer 18—64 år exkl. studerande.

Andel (%) av summa arbets- och pensionsinkomst Arbets- och

Decil efter arbets- och pensionsinkomst Lån+ Arbets- Övr. Pensioner Privata Summa pensionsink. i företagsink+ marknads— skattepl. pensions- genomsnitt Sjukp. m.m. stöd ink. premier per ink.tagare 1992 års pri— ser, tkr

decil 10

1992 96,0 0,4 1,2 4,1 -l,7 100 337, varav för: decil 10 exkl 1989 100,7 0,1 0,0 1,8 -2,6 100 308, toppskiktet 1992 97,1 0,4 0,4 3,8 -l,7 100 305,

Samtliga

Förändringarna medför att decilerna 2-4 och decil 10 har fått en ökad andel av de samlade arbets- och pensionsinkomstema (tabell 28). Medan

decilerna 5-9 fått en minskad andel liksom den av egenföretagamas förluster drabbade decil 1.

28. Tabell: Decilemas andel av de totala arbets- och pensionsinkomstema 1989—1992 Individer 18—64 år exkl. studerande

Decil efter arbets+ Andel i % av totala arbets- och pensionsinkomstema

pensionsinkomst 1989 1990 1991 1992

2 4,9 5,0 5,1 5,1

3 6,7 6,8 6,8 6,8

4 8,0 8,0 8,0 8,1

5 9,2 9,1 9,0 9,1

6 10,2 10,1 10,0 10,0

7 11,2 11,2 11,1 11,1

8 12,5 12,6 12,4 12,4 9 14,5 14,5 14,3 14,3

10 20,9 21,0 21,5 21,7

Decil 10 exkl 17,5 17,3 17,5 17,7 toppskiktet

Samtliga 100 100 100 100

Särskilt om inkomstutvecklingen för toppskiktet

Inkomsttagarna i toppskiktet har som framgått ovan haft en bättre utveck- ling av arbets- och pensionsinkomstema än övriga inkomsttagare. En separatredovisning av det översta toppskiktet i decil 10 med utgångspunkt i HINK är dock vansklig beroende på få observationer och osäkerheten om träffsäkerheten i urvalet i denna övre del av inkomstfördelningen. För att belysa utvecklingen för de med de allra högsta inkomsterna har SCB därför som komplement till tidigare redovisade data för decil 10 gjort en specialbearbetning av inkomstutvecklingen för toppskiktet utifrån den totalräknade inkomststatistiken. '

I HINK har effekterna av basbreddningama lagts ut på åren 1989 och 1990. Vissa typer av basbreddningar har kunnat läggas ut exakt medan andra har lagts ut efter vissa kriterier. I den totalräknade inkomststatisti- ken har de basbreddningar som gjordes 1990 och 1991 inte kunnat beaktas, Basbreddningarna kommer således i denna statistik att falla ut som en ökning av inkomsterna trots att det således är fråga om belopp som inkomsttagarna disponerade redan tidigare — men de var "osynliga". För att få en uppfattning om vad det rör sig om för nivåer kan nämnas att basbreddningama under inkomst av tjänst enligt HINK höjde nivån på arbetsinkomstema med i genomsnitt 3.600 kr eller ca 3 procent. Enligt de kriterier som basbreddningama under inkomst av tjänst lades ut i HINK uppgick de i decil 10 till i genomsnitt 10.600 kr och för de 100.000 individerna i toppen av fördelningen till i genomsnitt ca 13.000

kr. Även om således basbreddningama utgör ett betydligt större belopp i kronor för höginkomsttagama så rör det sig i procent om ett ungefär lika stort påslag för höginkomsttagama som för genomsnittet nämligen i storleksordningen 3 a 4 procent.

Tabellen nedan visar arbetsinkomstenu för de 5000, 25.000, 50.000 respektive 100.000 inkomsttagare (åldersgruppen 18-64 år) med högst arbetsinkomst åren 1989 till 1992. Utvecklingen anges både i löpande och i fasta priser (1992 års). För att få en uppfattning om vad det rör sig om för inkomstlägen för inkomsttagarna i denna del av inkomstför- delningen kan nämnas att 1992 hade de översta 100.000 individerna inkomster över 380.000 kr., de översta 50.000 hade inkomster över 455.000 och de översta 25.000 hade arbetsinkomst över 541.000 kr. Toppskiktet på 5.000 individer hade arbetsinkomst överstigande 805.000 kr.

"Arbetsinkomst har definierats som kontant lön, arvode och skattepliktiga förmåner. Vidare ingår sjuklön, ersättningar från försäkringskassa, arbetslöshetskassa, vuxenutbild- ningsnämnd, delpension och livränta från arbetsskadeförsäkring. Traktamentsersättningar m.m. utöver schablon behandlas också som lön. Däremot ingår inga privata pensioner, Betalningar av privata pensionspremier har inte dragits av.

29'. Tabell: Arbetsinkomstemas utveckling 1989-1992 lör inkomsttagare i toppskiktet Inkomstiagale 18-64 år. Källa: SCB. Bearbetningar av den totalräknade inkomststatistiken.

Genomsnitt per inkomsttagare, tkr Förändring i % 1989- ]990— 1991— 1989- Kategori Är1989 År1990 År 1991 År 1992 1990 1991 1992 1992 Löpande priser. 5 000 gränsvärde 602,8 665,9 797,5 804,8 +10,5 +19,8 +0,9 +33,5 medelvärde 826,4 909,4 1 180,2 1 [90,3 + 10,0 +29,8 +0,9 +44,0 25 000 gränsvärde 417,3 469,4 530 540,7 +12,5 +12,9 +2,0 +29,6 medelvärde 550,5 611,1 731,5 740,8 +11,0 +19,7 +l,3 +34,6 50 000 gränsvärde 353,8 400,0 445,2 455,2 +13,1 +11,3 +2,2 +28,7 medelvärde 466,0 520,6 606,7 616,3 +11,7 +16,5 +1,6 +32,3 100 000 gränsvärde 297,3 338,2 372,5 380,2 +13,8 +10,1 +2,1 +27,9 medelvärde 393,9 442,8 505,4 514,5 +12,4 +14,1 +1,8 +30,6 Fasta priser. 5 000 gränsvärde 744,4 745,1 815,4 804,8 +0,1 +9,4 -1,3 +8,1 medelvärde 1020,6 1017,6 1206,7 ] 190,3 -0,3 +18,6 -1,4 +16,6 25 000 gränsvärde 515,4 525,2 541,9 540,7 +1,9 +3,2 -0,2 +4,9 medelvärde 679,9 683,8 747,9 740,8 +0,6 +9,4 -1,0 +9,0 50 000 gränsvärde 436,9 447,6 455,2 455,2 +2,4 +1,7 +0,0 +4,2 medelvärde 575,5 582,5 620,3 616,3 +1,2 +6,5 -0,6 +7,l 100 000 gränsvärde 367,2 378,4 380,9 380,2 +3,1 +0,6 -0,2 +3,6 medelvärde 486,5 495,5 516,7 514,5 +1,9 +4,3 -0,4 +5,8

De 5.000 inkomsttagarna i toppskiktet har i fasta priser ökat sina arbetsinkomster med i genomsnitt inemot 17 procent mellan 1989 och 1992. Utökar man gruppen till 25.000 år ökningen av arbetsinkomsterna i fasta priser 9 procent. För de 100.000 i toppen är ökningen strax under 6 procent varav — att döma av HINK — ca 3 procent skulle kunna vara att tillskriva tidigare osynliga inkomster. Om man beaktar basbredd- ningama rör det sig således för dessa 100.000 om en faktisk ökning av arbetsinkomsterna på 2 å 3 procent. Detta kan jämföras med att motsva- rande inkomster för hela gruppen helårs- och heltidsanställda i genomsnitt minskade med 3,6 procent under samma period enligt HINK”.

Även om man tar hänsyn till att basbreddningama bidragit till de höga utvecklingstal som redovisas i tabell 29 finns således belägg för att

uSCB Rapport 1994:1 sid 19.

höginkomsttagama har haft en bättre löneutveckling än vad som gällt i genomsnitt för de helårs— och heltidsanställda.

Är det då samma personer som finns med i toppskiktet år efter år? Det visar sig att det i översta toppskiktet på 5.000 finns en ganska stor omsättning. Men även om man lämnar de 5.000 så stannar man oftast kvar bland de 100.000. Av de 5.000 som låg i topp 1989 fanns 42 procent kvar bland de 5.000 år 1992. 20 procent återfanns inte längre bland de 100.000 och 5 procent hade passerat 65-årsdagen, avlidit eller

flyttat från landet.

30. Tabell: (Insättningen i toppskiktet. Kategoritillhörighet efter 1, 2 resp. 3 år. Inkomsttagare 18-64 år.

Andel (%) tillhörande resp. kategori

Kategoritillhörighet de piföljande åren Etter 1 år Efter 2 år Efter 3 år 1989 påföljande åren 1990 1991 1992 topp 5.000 topp 5.000 65 47 42 topp 25.000 86 76 68 topp 50.000 89 80 72 topp 100.000 91 83 75 Övriga 7 14 20 död/uttlyttad/äldre än 65år 2 4 5 topp 25.000 topp 5.000 18 16 15 topp 25.000 73 61 55 topp 50000 87 79 71 topp 100.000 91 85 78 Övriga 8 13 19 död/utflyttad/äldre än 65 år 1 2 3 topp 50.000 topp 5.000 9 9 & topp 25.000 45 39 37 topp 50.000 76 66 60 topp 100.000 89 83 76 Övriga 10 16 22 död/utflyttad/äldre än 65 år 1 2 3 topp 100.000 topp 5.000 5 5 4 topp 25.000 24 22 21 topp 50.000 46 41 39 topp 100.000 77 69 64 Övriga 22 30 34

död/utflyttad/äldre än 65 år 1 l 2

Ser man till de 5.000 som ligger i topp 1992 finner man att 42 procent av dem fanns bland de 5.000 i topp även 1989 och 86 procent återfanns bland de 100.000.

31. Tabell: Rekryteringsbasen lör toppskiktet 1992. Inkomsttagare 18-64 år.

Andel (%) tillhörande resp. kategori åren

Kategoritillho'righet före

3 år tidigare 2 år tidigare I år tidigare 1992 åren före 1989 1990 1991 topp 5.000 topp 5.000 42 51 59 topp 25.000 73 78 87 topp 50.000 80 84 92 topp 100.000 86 89 95 Övriga 10 9 5 ej folkbokförd i Sv./under 18 år 4 3 ] topp 25.000 topp 5.000 14 15 16 topp 25.000 55 62 70 topp 50.000 73 78 87 topp 100.000 84 87 93 Övriga 14 12 6 ej folkbokförd i Sv./under 18 år 2 1 0 topp 50.000 topp 5.000 7 8 9 topp 25.000 36 39 42 topp 50.000 60 66 74 topp 100.000 78 83 91

Övriga 20 16

ej folkbokförd i Sv./under 18 år 2 l topp 100.000 topp 5.000 4 4 4 topp 25.000 19 21 22 topp 50.000 38 41 43 topp 100.000 64 70 77 övriga 35 30 22 ej folkbokförd i Sv./under 18 år 1 1 0

Sammanfattningsvis kan sägas att allt tyder på att toppskiktet har haft en bättre utveckling av sina arbetsinkomster mellan 1989 och 1992 än vad som gäller för de helårs- och heltidsarbetande. Denna slutsats gäller även om man tar hänsyn till att basbreddningama gjort att tidigare "osynliga" inkomster kommit med i statistiken. Trenden mot ökad lönespridning som funnits under 1980—talet har således fortsatt. I samband med skatterefor- mens genomförande uttalades att höginkomsttagama skulle hålla igen sina lönekrav bl.a. manifesterat i s.k. Rehnbergavtal. I detta perspektiv kan inkomstökningarna för höginkomsttagama sägas ha blivit höga. Statisti- ken visar att omsättningen av inkomsttagare är relativt stor i toppskiktet.

5.3. Utvecklingen av kapitalinkomster, skuldräntor m.m.

Översikt samtliga individer i åldern 18-64 år (exkl. studerande)

Inkomsttagarna har i genomsnitt minskat sin låneskuld med 25.000 kr i fasta priser mellan 1989—1992. Men det höjda ränteläget har medfört att ränteutgiftema trots detta ökat med i genomsnitt 700 kr (före skatt). Ränteinkomster/utdelningar har minskat något litet. Räntenettot är därför i fasta priser ca 1000 kr sämre per inkomsttagare 1992 jämfört med 1989.

Uppgifterna i HINK pekar på att värdet på andra finansiella tillgångar har i fasta priser nästan halverats mellan 1989 och 1992. Men det bör understrykas att osäkerheten är stor i det statistiska underlaget för denna post. Bidragande till minskningen är en kraftig nedgång av priset på värdepapper. Generalindex för aktier på Stockholms fondbörs sjönk sålunda med 28 procent mellan december 1989 och december 1992. Det bör dock påpekas att värdet på övriga finansiella tillgångar är känsliga och snabbt förändras. Sålunda steg generalindex under 1993 med hela 54 procent vilket innebär att värdet återställts till samma nivå som 1989 även inräknat kompensation för prisutvecklingen.

Under 1992 började även marknadsvärdet på egna hem/fritidshus att falla. Mellan 1991 och 1992 mer än halverades reavinsterna vilket bidrar till att skattebetalningarna för detta år minskar.

32. Tabell: Översikt kapital. Genomsnitt per inkomsttagare. 1992 års priser. Individer 18-64 år exkl. studerande.

Genomsnitt per inkomsttagare, tkr

Förändring, tkr 1989- 1990- 1991-

Inkamstpost 1989 1990 1991 1992 1990 1991 1992 Ränteinkomster/utdelningar 6,2 6,3 5,1 5,9 +0,1 -1,2 +0,8 Ränteutgiher 16,8 18,1 16,2 17,5 +1,3 -1,9 +1,4 Räntenetto -10,6 -11,8 -11,0 -1 1,6 -1,2 +0,7 -0,6 Reavinst 5,8 6,4 6,5 2,8 +0,6 +0,1 -3,7 Reaförlust 0,0 0,0 0,5 0,8 0,0 +0,4 +0,3 Reavinst, netto 5,7 6,4 6,1 2,1 Skatt på reavinst/reatörlust

+0,6 -0,3 -4,0

Tillgångarislmlder. Bankmedel (privat) 49 47 45 44 -2 -2 0 Andra finansiella tillgångar 76 67 41 .40 -9 -26 -2 Eget hem/fritidshus 207 214 220 194 +7 +7 26 (marknadsvärderat)

Privatskuld 170 168 147 145

Hela perioden -0,3 +0,7 - 1,0

-2,9 +0 7 -3,7

Bankmedel, övrigafinansiella tillgångar, fastighetsvärden och låneskuld i olika deciler

De förändringar i värdet och innehavet av tillgångar som inträffat mellan 1989 och 1992 har i kombination med andra förändringar i inkomstför- delningen inneburit att decilerna 1-4 och 8-9 ökat sina andelar av de samlade tillgångarna i form av bankmedel, andra finansiella tillgångar samt eget hem/fritidshus. Förändringarna torde bl.a. sammanhänga med att lågkonjunkturen medfört att etablerade hushåll har hamnat lägre ned i decilerna.

Mönstret skiljer sig åt mellan de olika typerna av tillgångar (se tabell 33).

Decilerna 1-4 har 1992 en lägre andel av totala bankmedel än vad de hade 1989 medan andelen av det samlade marknadsvärdet för eget hem/fritidshus ökat.

Decilema 7-9 har fått en ökad andel av bankmedel och andra finansiella tillgångar men en minskad andel av värdet för eget hem/— fritidshus. Decil 10 har ökat andelen av samlade bankmedel men fått en kraftig minskad andel av andra finansiella tillgångar och en minskad andel av värdet för eget hem/fritidshus.

Det bör understrykas att redovisningen avser just vad som inträffat mellan 1989 och 1992 och att det under denna period inträffat en kraftig nedgång på börsen. Som påpekats ovan har aktiekurserna åter ökat kraftigt under år 1993 vilket torde ha påverkat fördelningen av övriga finansiella tillgångar.

33. Tabell: Decilemas andel av banlmredel, andra finansiella tillgångaroch egethus/fritids- hus till marknadsvärde 1989 och 1992. Individer 18-64 år exkl. studerande.

Deeilens andel (%) av tillgång av resp. slag

Bankm edel A ndra finansiella Eget hem/fritidshus Decil efter arbets+ tillgångar marknadsvärde pensionsinkomst 1989 1992 1989 1992 1989 1992 1 9,5 7,5 11,0 12,1 4,4 5,6 2 9,6 7,6 3,6 5,4 5,0 5,3 3 8,5 8,3 7,2 5,6 6,2 6,8 4 7,8 7,6 3,4 5,4 7,0 7,2 5 8,0 9,1 8,6 4,6 6,3 6,7 6 9,8 8,6 5,1 5,2 8,5 8,4 7 8,5 9,2 6,0 6,4 10,6 9,7 8 10,3 1 1,0 7,3 10,1 12,4 12,3 9 11,3 12,4 11,2 14,6 15,8 15,6 10 16,6 18,7 36,7 30,7 23,9 22,4 Decil 10 exkl. 12,6 15,4 22,7 23,2 20,4 19,1

toppskiktet

Samtliga 100 100 100 100 100 100

Andelen av låneskulden har minskat i decilerna 1-3 och ökat i decilerna 4-9 (se tabell 34). Decil 10 har minskat sin andel förhållandevis mycket. Denna förändring beror i första hand på det översta toppskiktet i denna decil.

Sammantaget har "förmögenheten" i form av bankmedel, andra tillgångar, värdet av eget hem/fritidshus netto för låneskuld kommit att öka andelsmässigt i decilerna 1—4 samt 8-9 medan decilerna 5-7 och 10 minskat sin andel. Särskilt kraftigt har andelen av nettoförmögenheten minskat för toppskiktet i decil 10 där innehavet av andra finansiella tillgångar är stort och därmed också känsligheten för priset på värdepap- per. Det kan därför röra sig om en temporär andelsminskning eftersom aktiekurserna stigit kraftigt efter 1992.

34. Tabell: Decilemas andel av summa tillgångar (bakmedel, andra finansiella tillgångar samt marknadsvärde för eget hem/fritidshus) och lånest samt "nettofömrö— genlret" 1989 och 1992. Individer 18-64 år exkl. studerande.

Decilens andel (%) av tillgång, låneskuld resp. "nenofönnögenhet"

Decil efter arbets+ Summa tillgångar Privatlåneskuld 'Wettafönnågenhet"

pensionsinkomst 1989 1992 1989 1992 1989 1992

1 6,6 6,9 5,6 5,1 7,7 8,8 2 5,4 5,7 4,3 4,0 6,5 7,4 3 6,8 6,9 6,2 5,1 7,4 8,8

4 6,3 7,0 6,2 6,4 6,4 7,6 5 7,1 6,8 6,3 7,0 8,0 6,5

6 7,9 7,9 7,7 8,7 8,1 7,1 7 9,2 9,2 9,8 10,6 8,6 7,6

8 10,9 11,8 11,3 12,4 10,5 11,0

9 14,1 15,0 14,3 15,9 13,8 14,0

10 25,7 23,0 28,4 24,7 23,0 21,1

Decil 10 exkl 19,8 19,1 21,5 20,7 17,9 17,4 toppskiktet

Samtliga 100 100 100 100 100 100

1 tabell 35 återges mer i detalj hur värdet på tillgångar och låneskuld för- ändrats i de olika decilerna. Beloppen är uttryckta i fasta priser (1992 års priser enligt KPI). Det kan dock diskuteras hur pass relevant det år att göra denna typ av fastprisjämförelser. T.ex. kan man köpa ett exakt likadant hus som det man äger trots att priserna gått ned. På så sätt har man kanske inte förlorat något. Om man däremot köpte eller högt be- lånade sin fastighet under åren med högt värde kan värdeförändringen vara högst påtaglig. Tabellen bör tolkas med försiktighet.

35. Tabell: Översikt tillgångan'slmlder: 1992 års priser. Individer 18-64 år exkl. studerande.

Decil efter arbets+

pensio nsinkomst Tillgång/skuld

10

10 exkl

topp

Samt— Hga

Bankmedel Andra fin. tillgångar Eget hem/fritidshus Privatskuld

Bankmedel Andra fin. tillgångar Eget hem/fritidshus Privaukuld

Bankmedel Andra fin. tillgångar Eget hem/fritidshus Privatskuld

Bankmedel Andra fin. tillgångar Eget hem/fritidshus Privatskuld

Bankmedel Andra fin. tillgångar Eget hem/fritidshus Privatskuld

Bankmedel Andra fin. tillgångar Eget hem/fritidshus Privatskuld

Bankmedel Andra fin. tillgångar Eget hem/fritidshus Privatskuld

Bankmedel Andra fin. tillgångar Eget hem/fritidshus Privatskuld

Bankmedel Andra fin. tillgångar Eget hem/fritidshus Privatskuld

Bankmedel Andra fin. tillgångar Eget hem/fritidshus Privatskuld

Bankmedel Andra fin. tillgångar Eget hem/fritidshus Privatskuld

Bankmedel Andra fin. tillgångar Eget hem/fritidshus Privatskuld

Genomsnitt per inkomsttagare, tkr

1989 1990 1991 1992

46 84 90 96

47 27 104 73

41 55 128 105

38 26 144 105

39 66 131 107

48 39 175 131

41 45 218 166

50 55 257 193

55 85 326 243

80 280 493 483

68 192 468 408

49 76 207

170

41 168 110 134

43 20 117 66

38 27 139 90

37 22 135 112

41 21 155 118

43 23 180 128

46 37 203 161

45 37 256 187

53 56 333 233

79 260 509 451

73 125 485 371

47 67

214 168

36 44 124 71

37 21 125 68

35 20 135 71

34 19 152 79

35 19 144 100

41 22 168 127

47 30 225 160

46 42 252 183

56 46 345 235

80 151 534 373

71 119 490 343

45 41 220

147

33 48 110 74

34 21 103 59

37 22 132 74

34 21 139 93

40 18 129 101

38 21 162 126

41 25 189 154

49 40 239 181

55 58 304 231

83 121 435 358

76 102 412 334

44 40 194

145

] 989- 1 990

+17

Förändring, tkr

1990— 199]

+3 -10 +12 +2

+1 -110 +25 -78

1991- Hela

1992 perioden -2 —1 3 +4 -36 -14 +20 +3 -21 -4 -13 -o -6 -22 -1 -9 -14 +2 -4 +2 -33 -3 +4 +3 -32 _1 -4 +3 -S -13 -4 +14 —1 3 +5 +1 -o .47 -14 -2 H -6 -3 —1 0 -1 -18 -6 -13 _1 _s —7 -O -5 -20 -36 -30 —6 -12 +3 -1 -2 -16 -13 -18 —2 »12 -1 +0 +12 -28 -42 -23 -5 -13 +3 +2 -29 -1 58 -100 -58 -15 425 +4 +8 -17 -90 -77 -56 -10 -74 0 -4 —2 -37 —26 -13 -2 -25

Räntenettot i olika deciler

Ränteutgifterna har ökat i samtliga deciler utom decilerna 9 och 10. I kombination med de förändringar som inträffat vad gäller ränteinkom- sterna har räntenettot (före skatt) försämrats i decilerna 1—7 och förbättrats i decilerna 8-10.

36. Tabell: Ränteinkomsteriutdelningar samt ränteutgitleri olika deciler. 1992 års priser. , Individer 18-64 år exkl. studerande. :

Decil efter arbets+

pensionsinkomst

Räntor/utdelningar

1989 1990 1991 1992 Genomsnitt per inkomsttagare, tkr Förändring, tkr 1989- 1990- 199]- Hela perioden ll

l :l

Rånteutgifter 4,3 4,5 4,9 6,1 Räntenetto 2,6 2,8 1,6 -0,6 2 Räntor/utdelning ar 5,3 4,7 4,1 3,6 Ränteutgifter 3,6 4,2 5,4 5,2 Råntenetta 1,6 0,6 4,3 4,6 3 Räntor/utdelningar 4,6 4,4 3,3 4,0 Ränteutgifter 5,4 5,5 6,1 7,0 +0,1 +0,6 +0,8 : Räntznetto -0,9 4,1 -2,8 -2,9 -0,2 4,8 -0,1 -2,1: 4 Räntor/utdelningar 3,9 4,0 3,1 3,5 +o,1 .o,9 +o,3 .04 Ränbeutgifter 6,8 8,2 7,7 9,5 +1,4 -0,5 +] ,8 +2,7 Räntenetta —3,0 -4,3 -4,6 -6,1 4,3 -0,4 4,4 J,), 5 Räntor/utdelningar 4,8 4,4 3,1 4,2 -0,4 »1 ,3 H,] —0,V Ränteutgifter 8,7 10,2 9,8 11,5 +1,5 -0,4 +1,7 +2, Räntenetto -3,9 -5,8 -6, 7 -7,3 4,9 -0,9 -0,6 -3, _ 6 Räntor/utdelningar 5,0 4,9 3,6 4,2 -0,1 -1,3 +0,6 -0, Ränteutgifter 12,4 14,5 14,4 15,7 +2,0 -0,1 +1,3 +3,1 Räntenetta -7,4 —9,6 40,8 41,5 -2,l 4,2 -0,7 -4, 7 Räntor/utdelning ar 4,9 5,4 4,4 4,8 +0,4 -1,0 +0,4 -0, Ränteutgiftor 17 ,8 18,2 18,1 19,6 +0,3 -0,1 + 1 ,5 +], Räntenetto 42,9 42,8 43,7 44,8 +0,l 4,0 4,1 4, 8 Räntor/utdelningar 5,5 5,1 4,7 6,6 -0,5 -0,4 +1,9 +1 , Ränteutgifter 23,1 24,4 21 ,8 23.3 +1,3 -2,5 +] ,5 +0, Räntenetta 47,6 49,3 47,1 46,7 4,7 +2,2 +0,4 +0,9 9 Räntor/utdelning ar 7 ,6 6,7 5,7 7 ,9 -O,9 -1,0 +2,1 +0,5 Rånteutgifter 30,6 31,2 27,4 29,7 +0,6 —3,8 +2,3 0,1 Råntenetto -22,9 -24,4 -21,6 -21,8 4,5 +2,8 —0,2 +],[ 10 Räntor/utdelningar 13,5 16,1 12,9 15,0 +2,7 —3,2 +2,1 +1,4 Ränteutgifter' 55,0 59,9 46,0 47,6 +4,9 —1 3,9 +1,7 -7 _l Räntenetto 41,5 -43,8 -33,0 -32,6 -2,3 +10,7 +0,4 +8,5 10 Räntor/utdelningar 11,0 10,6 10,9 13,8 -0,4 +0,3 +2,9 +2,8 exkl Ränteutgifter . 50,3 50,5 42,7 44,0 +0,2 —7,8 + i ,3 45,3 topp Råntenetto -39,3 39,9 -31,8 -30,2 —0,6 +8, 1 +1,6 +9,1 Samt- . Räntor/utdelningar 6,2 6,3 5,1 _ 4 5,9 +0,1 -1,2 +0,8 -0,.i liga Rår'neutgifter 16,8 18,1 , , 16,2 ' 17,5 ' ?

Rantenetta

Bilaga 4 Individperspektiv Reavinst (netto) i olika deciler

En allmän reservation bör framföras om osäkerheten kring uppgifterna om reavinsternas storlek. Det beror på att uppgifterna är relativt sällan förekommande men då de förekommer kan de vara stora till beloppet vilket medför stor osäkerhet vid medelvärdesberäkningar.13

Reavinstema (netto för reaförlust) har mer än halverats 1992 jämfört med åren 1989-1991. Andelen individerH som redovisar reavinst minskar från 6,5 procent 1991 till 3,8 procent 1992. En tredjedel av reavinsterna återfinns i högsta decilen med stark koncentration till decilens toppskikt. Iögonfallande är också att den första decilen beloppsmässigt har en hög andel av reavinsterna. Detta återspeglar denna decils heterogena samman- sättning,

37. Tabell: Reavinst (netto) i olika deciler 1989—1992. 1992 års prisen Individer 18-64 år exkl. studerande.

Genomsnitt per inkomsttagare, tkr Snitt per år Decilens

Decil efter arbets + pensionsinkomst 1989 1990 1991 1992 1989-1992 total reavinst

förperioden andel av

1 13,1 26% 2 2,6 5% 3 2,0 4% 4 2,2 4% 5 2,3 5% 6 2,5 S% 7 3,0 6% 8 2,5 S% 9 3,8 S% 10 20,5 17,6 17,2 11,4 16,7 33% Decil 10 exkl 11,9 12,1 9,0 6,1 9,7 17%

toppskiktet

Samtliga

5.4. Utvecklingen av skatterna

Det kan inledningsvis vara på sin plats att påpeka att det är mycket svårt att ge en klar bild av hur skatterna slutligen belastar olika individer och olika delar av inkomstfördelningen. De skatter som redovisas i detta avsnitt är de som betalas direkt av den skattskyldige via skattsedeln. Men

13En helt annan typ av osäkerhet — en dold osäkerhet —- är att det förefaller finnas ett ganska utbrett fusk när det gäller att redovisa reavinster på värdepapper. En undersökning som skatteförvaltningen gjort inkomståret 1993 visar att hela 20 procent av aktietor- säljningama utelämnats eller tagits upp till för lågt värde i deklarationen.

"1 åldrarna 20-64 år enligt den totalräknade inkomststatistiken (Taxopak).

vissa skatter kan också indirekt bäras av individerna utan att framgå av den egna skattsedeln. T.ex. betalar den som bor i hyreslägenhet fas— tighetsskatt och får del av vissa bostadssubventioner via hyresavin. För .de som bor i eget hem hamnar fastighetsskatten och del av bostadsubven— tionerna på skattsedeln.

Beskrivningen nedan tar sikte på förändringarna av skatte uttaget under perioden 1989-1992 såsom det framgår av den vanliga inkomstskattese- deln.

Översikt samtliga individer i åldern 18-64 år exkl. studerande

1 fasta priser betalar inkomsttagarna i snitt 11.800 kr mindre i skatt 1992 än 1989. Minskade reavinster svarar för 1.700 kr av skatteminskningen. (Skatten på reavinster har därvid i det gamla skattesystemet simulerats på toppen av övriga inkomst/avdragsförhållanden). Rensat för reavinsternas inverkan på skattebetalningarna är det således fråga om en nedgång med 10.100 kr. Del av förklaringen ligger i att arbets- och pensionsinkom- sterna under samma period i fasta priser gått ned med 2.700 kr i snitt. Skatten (exkl. skatt på reavinst) har som andel av arbets- och pensionsin— komsten minskat från 33,9 till 28,0 procent — en minskning med nästan 6 procentenheter.

38. Tabell: Inkomstskatt m.m. åren 1989-1992. 1992 års prisen Individer 18-64 år exkl. studerande.

Genomsnitt per inkomsttagare, tkr Förändring, tkr 1 989- 1991 - 1992 1992 1989 1990 1991

Slutlig skatt inkl. skatt på reavinst 56,0 56,2 45,9 Dito i % av arbets+pensionsinkomst 35,3% 34,9% 29,5% 28,4%

Slutlig skatt exkl. skatt på reavinst 53,7 53,8 44,0 43,6 33,9% 33,4% 28,3%

-1o,1 -o,4

Dito i % av arbets+pensionsinkomst

varav skatt på

A rbets+pensionsinkomst (inkomstskatt): .. .. 46,1 45,4 -0,6

Dito skatt i % av arbets+pensionsinkomst .. .. 29,6% 29,2%

Kapital: 0,2 -1,2 4,4

Nettoskatt på räntor/utdelaingar/utgiilsräntor .. .. —3,3 -3,4 .. -O,l

Nettoskatt på reavinst/reaförlust 2,3 2,4 1,9 0,6 -1,7 -1,3 Fastighetsskatt 0,5 0,7 1,4 1,4 +0,9 0,1 -0,3 -0,1 Förmögenhetsskatt 0,6 0,4 0,3 0,2

Övrigt -0,4

Skattereformens första etappår 1990 minskar skattetrycket mycket litet — från 33,9 till 33,4 procent (exkl. skatt på reavinst). Förklaringen till att minskningen blir förhållandevis begränsad ligger i att inkomsttagarna till följd av höga lönelyft fördes upp i marginalskatteskikten vilket generera- de ökad skattebelastning. Detta är också en bidragande orsak till att skatteminskningen det andra etappåret blev så mycket större. Skattere- formen hade dessutom sin tyngdpunkt på andra etappåret.

Det nya skattesystemet är mera transparent vilket gör att det är enklare att se vad som hänt med skatterna mellan åren. Mellan 1991 och 1992 kan därvid konstateras att mycket små förändringar inträffat bortsett från att skatten på reavinster minskat.

Olika decilers andel av de totala skattebetalningama 1989 och 1992.

Ändringarna i inkomster och skattesystem mellan 1989 och 1992 har medfört att inkomsttagarna som 1992 befinner sig i decilerna 4-9 betalar en lägre andel av totala skatten än vad motsvarande deciler gjorde 1989 (tabell 39). Decilema 1-3 betalar en något högre andel. Decil 10 har ökat sin andel mest.

39. Tabell: Olika decilers bidrag till totala inkomstskatten 1989—1992. [Individer 18-64 år exkl. studerande.

Resp. decils andel av skatteuttaget, %

Decil efter arbets+ pensionsinkomst 1989 1990 1991 1992

skatt inkl. skatt på reavinst 1989 1990 1991 1992

skatt exkl. skatt på reavinst

1 1,4 1,7 2,0 1,7 1,9 3,2 3,1 1,7 2 3,8 3,9 4,2 4,2 3,9 3,8 4,2 4,2

3 5,8 5,9 5,8 6,0 5,7 5,7 5,8 6,0 4 7,3 7,2 ' 7,1 7,2 7,2 7,0 6,9 7,1

5 8,8 8,4 8,1 8,3 8,7 8,2 7,9 8,3

6 9,8 9,3 9,0 9,2 9,5 9,2 8,8 9,1 7 10,7 10,5 10,3 10,2 10,5 10,3 10,2 10,2

8 12,3 12,2 11,7 11,7 12,0 11,8 11,5 11,7 9 14,9 15,0 14,6 14,4 14,7 14,5 14,4 14,4

10 25,3 26,0 27,1 27,0 26,0 26,2 27,2 27,3

Decil 10 exkl 20,1 20,5 21,1 21,1 20,2 20,4 20,8 21,1

toppskiktet

Samtliga

Skatterna för inkomsttagare i olika deciler

Skatten (exkl. skatt på reavinst) för inkomsttagare i olika deciler framgår av tabell 40. Skatten anges dels i genomsnitt per inkomsttagare dels i procent av inkomsttagamas arbets- och pensionsinkomst. Skatten i fasta

priser har minskat i samtliga deciler. Del av minskningen förklaras av att arbets- och pensionsinkomstema minskat i fasta priser. Uttrycker man skatten —— skattetrycket — i procent av arbets- och pensionsinkomsten har skattetrycket i decilerna 4-10 minskat ungefär lika mycket. Minsk- ningen ligger i storleksordningen 6 a 7 procentenheter.

En viktig förklaring till det ökade skattetrycket i första decilen torde vara att söka i att decilindelningen gjorts efter arbets- och pensionsin- komst och i denna decil återfinns bl.a. företagare som gått med under- skott. Företagarinkomstema är sålunda totalt sett negativa i denna decil. Av de minskade arbetsinkomsterna på i genomsnitt 6.200 kr för decilen svarar sålunda en minskning av de redan negativa näringsinkomstema för nästan 4.000 kr. Skattereformen innebar att underskott inte längre fick kvittas mot inkomst av tjänst vilket torde vara en bidragande faktor till att skattetrycket ökat i decilen. En annan faktor är kapitalbeskattningen och borttagandet av fribeloppet vid låga kapitalinkomster.

40. Tabell: Skatt exkl. skatt på reavinst i olika deciler 1989-1992. 1992 års priser. Genomsnitt per inkomsttagare samt i procent av arbets+pensionsinkomst

Decil efter arbets+

pens ions inkom st

10

10 exkl topp

Sam t- liga

Skatt i tkr Arbets+pensionsink, tkr Skatt i %

Skatt i tkr Arbets+pensionsir1k, tkr Skalti %

Skatt i tkr Arbets+pensionsink, tkr Skatt i %

Skatt i tkr

Arbets+pensionsink, tkr Skatt i %

Skatt i tkr Arbets+pensionsink, tkr Skatt i %

Skatt i tkr Arbets+pensionsink, tkr Skatt i %

Skatt i tkr Arbets+pensionsink, tkr Skatt i %

Skatt i tkr Arbets+pensionsink, tkr Skatt 1 %

Skatt i tkr Arbets+pensionsink, tkr Skatti %

Skatt i tkr Arbets+pensionsink, tkr Skattl %

Skatt i tkr

Arbet5+pensionsink, tkr Skatt i %

Skatt i tkr Arbets+pensionsink, tkr Skatt i %

1989

7,7 30,1 25,7

20,3 77,7 26,2

30,9 106,2 29,1

39,0 127,3 30,7

47,3 145,4 32,5

52,5 161,0 32,6

57,5 177,6 32,4

65,9 198,4 33,2

79,9 229,4 34,8

135,11 331,8 40,9

120,1 308,0 39,0

53,7 158,5 33,9

1990

9,2 28,0 32,9

20,8 79,7 26,1

31,7 109,0 29,1

38,5 129,3 29,8

44,9 146,13 30,6

49,9 1 62,6 30,7

56,7 179,9 31,5

65,8 202,7 32,4

80,7 233,6 34,5

139,7 336,9 41,5

1 22,4 309,8 39,5

53,8 160,9 33,4

1991

8,7 29,1 29,9

18,5 79,2 23,4

25,6 105,1 24,4

31,1 124,3 25,0

35,9 140,5 25,5

39,8 155,5 25,6

45,3 1728 26,2

51,7 193,4 26,7

64,4 221,5 29,1

119,3 333,6 35,8

1 03,4 302,6 34,2

44,0 155,5 28,3

I 992

7,4 23,8 31,2

18,4 78,9 23,3

26,2 106,1 24,7

31,3 125,6 24,9

36,3 141,8 25,6

40,2 156,6 25,7

44,7 172,5 25,9

51,1 192,5 26,5

62,8 222,5 28,2

117,8 337,4 34,9

102,1 305,7 33,4

43,6 155,8 28,0

Förändring I 989-1992

procent- tkr enheter

-0,3 -6,2 +S,5

-1,9

+1,3 -2,8

_4,8 -0,1 4,5

-7,8 -1,7 -5,8

-11,0

-3,7 45,9

-12,3

-4,4 -6,9

-12,8

-5,1 —6,5

-14,8

—6,0 -6,7

-1 7,1

-6,9 -6,6

-18,0 +5,6 -6,0

-18,0

-2,3 -5,6

—1 0,1

-2,7 -5,9

En beskrivning av skatteuttagets fördelningsprofil kräver att man också ser på fördelningen av reavinstskatten. Reavinstema varierar kraftigt mellan åren. I tabell 41 återges reavinstskatten i snitt för perioden 1989- 1992. Tidigare har konstaterats att reavinsterna har en koncentration till de övre decilerna vilket också skatten har. Åren 1989-1992 har skatten på reavinst uppgått till i snitt 1.800 kr per inkomsttagare och år. Decil 1 (1) och decil 10 svarar för 60 procent av hela reavinstskatten. Det finns inkomsttagare som under ett år kan ha mycket låga inkomster från arbete och pension men som har gjort stora reavinster. Kanske har man just sålt sitt företag (=>reavinst).

41. Tabell: Skatt på reavinsti olika decilen Genomsnitt för åren 1989-1992. Individer 18-64 år exkl. studerande.

Decilens andel [snitt per ] % av arbets+

Decil efter arbets+ av hela reavinst- inkomsttagare pensionsinkomst

pensionsinkomst skatten, % tkr

1 24,5 4,4 15,7

2 4,5 0,8 1,0

3 3,5 0,6 0,6 4 4,0 0,7 0,6

5 4,7 0,8 0,6

6 4,9 0,9 0,6

7 5,6 1,0 0,6 8 4,7 0,8 0,4

9 8,0 ' 1,4 0,6

10 35,5 6,3 1,9

Decil 10 exkl 18,8 3,7 1,2

toppskiktet 4

Samtliga 100 1,8 1,1

Andel av inkomsttagarna över brytpunkten

Vid skattereformen infördes att statlig skatt på 20 procent skulle betalas av inkomsttagare över en viss inkomstnivå, den s.k. brytpunkten. Tillsammans med den genomsnittliga kommunalskattesatsen innebar detta att marginalskatten på inkomster över brytpunkten blev 50 procent. I utredningsskedet föreslogs att brytpunkten skulle gå vid 200.000 kr och man räknade då med att 10 procent av de skattskyldiga skulle hamna över brytpunkten. Vid riksdagsbehandlingen och beslutet om skatterefor- men sänktes brytpunkten. Syftet var att en högre andel än utredningen föreslog skulle få en marginalskatt på 50 procent.

1991 var brytpunkten vid en beskattningsbar förvärvsinkomst på 170.000 kr. vilket motsvarade en årslön på ca 184.000 kr. 1992 var brytpunkten vid 186.700 kr. vilket motsvarade en årslön på strax ovanför 200.000 kr.

Bland helårs- och heltidsanställda hade 1992 33 procent (770.000 personer) inkomster över brytpunkten. Bland heltidsanställda män var det 43 procent och bland kvinnorna 16 procent.

Ser man till samtliga inkomsttagare över 20 år (inkl. pensionärer) låg 17 procent eller 1,1 miljoner personer över brytpunkten.

42. Tabell: Pmcentandelen inkomsttagare över brytpunkten 1991 och 1992 Källa" SCB. Rapport 1994:l

1991 1992

Heltidsanställda 20—64 år 42 33 Mån 53 43 Kvinnor 24 16 Samtliga över 20 år (inkl. pensionärer) 2] ' 17 Mån 34 28

Kvinnor 9 6

6. Pensionärema

6.1. Antal pensionärer m.m.

Av HlNK:s uppgifter om hushållssammansättning framgår att pensionärs— hushållen15 1992 bestod av 712.000 ensamhushåll och 429.000 hushåll med sammanboende. Ensamståendehushållen har ökat något mellan 1989 och 1992.

43. Tabell: Antal pensionärshushåll Kalla. HINK

Tusental

Typ av pensionärshushåll

Ensamstående

Sammanboende

En viss förskjutning skedde under perioden mot de högre åldrarna. Av totala antalet personer över 65 år (enligt den totalräknade statistiken) var 1992 648.000 män och 877.000 kvinnor.

44. Tabell: Pensionärshushållens ålderssanmiansätming

Antal personer, tusental

1989 1992 Förändring

Å lderssam m ansättn ing

-64 93 93 0 65-74 864 837 -27 75- 566 643 +77 Summa inkl. sambo under 65 år 1 523 1 573 +49

Anm. Uppgihema i tabellen baseras på HINK. Pensmnårer boende på institution ingår inte i materialet.

6.2. Specilika regelförändringar för pensionärerna

Utöver de regelförändringar som skattereformen generellt innebar fanns vissa inslag som var specifika för pensionärerna.

Den extraordinära prisökning som orsakades av skattereformens finansiering 1990 och 1991 i form av höjda indirekta skatter, höjd fastighetsskatt och reducerade räntebidrag frånräknades vid fastställandet av basbeloppet fr.o.m. 1991. Basbeloppet sänktes därför med 2,4 procent för 1991 och 5,3 procent för år 1992. Basbeloppet fastställs med utgångs- punkt i prisförändringen året före (okt år —2 till oktober är -1) det aktuella pensionsåret. Om man befinner sig i faser med varierande prisutveckling över åren innebär detta att pensionerna sett för enskilda år inte håller takt med den aktuella prisutvecklingen. Som framgår av tabellen nedan har

1SDefmierat som hushåll där hushållsforeståndaren är 65 år eller äldre.

den faktiska prisutvecklingen mätt med KPI under perioden 1989—1992 varit drygt 2,5 procentenheter högre än basbeloppets uppräkning.

45. Tabell: .Eimförelse mellan basbelopp och prisutveckling

___._______————_———_

1989 1992 Förändring 1 %

___—___—

Basbelopp för beräkning av allmän pension 27 900 33 700 +20,8% KPI (index 1980=100), årsgenomsnitt 188,1 232,3 +23,5%

Åtgärder vidtogs för att kompensera de sämst ställda pensionärerna via systemen för pensionstillskott och kommunala bostadstillägg. Pensionstill- skottet höjdes 1990 från 48 till 50 procent av basbeloppet och 1991 från 50 till 54 procent. Hyresgränserna höjdes för pensionäremas bostads- bidrag (KBT) och 1991 infördes ett särskilt KBT som skulle garantera att pensionärer inte hamnade under gränsen för vad som anses vara skälig levnadsnivå. Ingen extra kompensation gavs till pensionärer med högre inkomster med hänvisning till att de fick del av marginalskattesänk- ningarna.

Det tidigare extra avdraget för pensionärer ersattes av ett särskilt grundavdrag som sattes så att pensionär med enbart folkpension och pensionstillskott skulle slippa betala skatt. De kraftiga marginaleffekter på arbetsinkomst som tidigare drabbat pensionärer som befann sig i extra avdragets avtrappningsskikt mildrades genom att löneinkomster inte längre skulle avtrappa det särskilda grundavdraget. Av statsfinansiella skäl behölls dock avtrappningen av det särskilda grundavdraget mot kapitalinkomster fram t.o.m. 1992. För pensionärerna i avtrappnings- skiktet var därför skatten på kapitalinkomst högre än 30 procent åren 1991 och 1992. Avtrappningen upphörde 1993 som ett led i fullföljandet av skattereformen.

6.3. HINK-makrotal för pensionärshushållen

Översiktligt om inkomstutvecklingen aggregerade belopp

Pensionärshushållens pensionsinkomster har i fasta priser ökat med drygt 11 mdkr mellan 1989 och 1992. Av ökningen faller 8 mdkr på ATP- pensioner medan arbetsmarknads- och övriga enskilda pensioner gav ett tillskott på 2 mdkr. Bostadsbidragen har ökat med 0,8 mdkr. Skatten är 7 mdkr lägre 1992. Hälften av skatteminskningen är att tillskriva att reavinsterna minskat.

46. Tabell: Pensionärshushållens inkomstsanmransättning. HINK—makrotal för åren 1989-1992.

mdkr (1992 års priser) Förändring 1989-1992 dito

mdkr i % per k.e. +1,2 +2,4%

+8,2 +12,5%

1989 1990 199] 1992 48,7 46,5 48,9 49,9 65,7 62,6 66,1 73,9

Folkpension+pensionstillskott ATP

Övriga pensioner 24,5 22,0 24,6 26,5 +2,0 +8,2% Delsummapensioner 138,9 131,0 139,7 [50,3 +)],4 +8,2% Arbetsinkomst 11,2 14,2 13,3 1 1,9 +0,6 +5,7% Ränteinkomster/utdelningar 15,9 17,5 15,4 17,1 + 1,2 +7,5% Rånteutgitter 5,2 4,9 4,5 5,4 +0,2 +3,3% Reavinst brutto 10,0 4,5 3,9 3,3 »6,8 -67,6% Bostadsbidrag 4,7 4,9 6,2 5,5 +0,8 +16,7%

0,3 0,2 0,1 0,4 53,2 48,3 43,5 46,3 49,0 46,6 42,4 45,4 127,8 124,2 135,0 142,1 122,0 1213 132,3 139,7

+0,l +32,6% -7,0 -13,1% -3,6 -7,3% +14,3 +11,2% +17,7 +14,5%

Övriga transfereringar, netto Slutlig skatt

Slutlig skatt exkl skatt på reavinst Disp.inkomst, inkl. reavinst Dispjnkomst exkl. reavinst

För pensionärshushållen innebär detta att den disponibla inkomsten (inkl. reavinst) i fasta priser ökat med 14 mdkr eller 11 procent mellan 1989 och 1992. Rensar man bort inverkan av reavinst/förlust på disponibel inkomst blir ökningen något högre —— inemot 18 mdkr eller 14 a 15 procent.

Försörjningsbördan uttryckt som volym i form av antal konsumtions- enheter — har mellan 1989 och 1992 ökat med inemot 5 procent. Ökningen sammanhänger med att pensionärshushållen i HINK 1992 omfattar något fler individer samt att andelen ensamstående ökat. Uttryckt per konsumtionsenhet blir ökningen av den disponibla inkomsten därför ca 5 procentenheter lägre än för makrotalen men ändå betydande drygt 6 procent inkl. reavinst och över 9 procent exkl. reavinst.

Pensionärernas kapitalinkomster — aggregerade belopp

Tabellen nedan visar vissa variabler med anknytning till pensionärs- hushållens kapitalinkomster och kapitaltillgångar.

47. Tabell: Kapital. Pensionärshushåll. HINK—makrotal för åren 1989-1992 Beloppen för 1989 och 1990 inkluderar utlagda basbreddningar.

F ärändring, m dkr

1989-1992

mdkr (1992 års priser) 1991 1992

Ränteinkomster/utdelningar m.m.

Rånteutgilter 5,2 4,9 4,5 5,4 +0,2 Räntenetto 10,7 12,6 10,9 11,8 +1,0 Reavinst 10,0 4,5 3,9 3,3 -6,8 Reaförlust 0,1 0,0 0,5 0,3 +0,2 Reavinst netto 9,9 4,5 3,4 3,0 -7,0

Skatt på reavinst/reaförlust Reavinst netto efter skatt Tillgångar/sladden Bankmedel (privat) 165 155 163 176 +11 Andra finansiella tillgångar 64 64 72 70 +6 Eget hem/fritidshus marknadsvärde 222 189 207 207 -15 Privatskuld 41 37 36 38 -3,7

Anm. Minskningen i marknadrvardet mellan 1989 och 1990 torde vara ett uttryck för osäkerheten i HINKzs matningar snarare än för vad som faktiskt inträffat.

Pensionärshushållens ränteinkomster/utdelningar har i fasta priser ökat något mellan 1989 och 1992. Bankmedel och andra finansiella tillgångar har räknat i snitt per individ i pensionärshushållen ökat från 150.500 till 156.100. Pensionärshushållens skulder är små i förhållande till till— gångarna. Räknat i snitt per individ i pensionärshushållen har skulden minskat från 27.200 till 24.000 kr.

Reavinstema har minskat markant i fasta priser. Netto efter skatt motsvarade de under 1989 realiserade reavinsterna (netto för förluster) 2.800 kr per individ i pensionärshushållen. 1992 är motsvarande genomsnitt halverat till 1.400kr. Osäkerheten i HlNKzs mätningar är emellertid som tidigare nämnts större för sådana mer sällan förekom- mande variabler som reavinster/reaförluster. Därför bör viss försiktighet iakttas när man värderar förändringen mellan åren av reavinsterna såsom de uppmäts i HINK.

Marknadsvärdet för egna hem/fritidshus har minskat i fasta priser. Räknat i snitt per individ uppgick värdet 1989 till 145.600 och 1992 till 131.800 kr.

6.4 lnkomstspridningen inom pensionärshushållen

Beaktar man förändringarna i hushållssammansättning m.m. genom att uttrycka inkomsterna per konsumtionsenhet uppgår ökningen i disponibel

inkomst inklusive reavinst till drygt 6 procent och rensat för reavinst till över 9 procent mellan 1989 och 1992. Bästa året för pensionärerna var därvid 1992.

48. Tabell: Utveckling av disponibel inkomst per k.e.. Pensionärshushåll. Fasta priser. Förändring i %

]989- 1990— 1991- Hela 1990 1991 1992 perioden Disponibel inkomst inkl. reavinst -0,7 +2,5 +4,4 +6,2 Disponibel inkomst exkl. reavinst +1,6 +2,8 +4,7 +9,4

Som framgått tidigare har pensionärerna under perioden 1989-1992 haft en snabbare utveckling av de disponibla inkomsterna än de aktiva hushållen (dito för aktiva hushåll är 2,6 resp. 3,9 procent per k.e.).

Skillnaderna i disponibel inkomst är stor inorn pensionärsgruppen. Som framgår av tabell 49 har det under perioden 1989—1992 skett en för- skjutning uppåt i inkomstlägena. Andelen pensionärer med en disponibel inkomst över 75.000 kr per k.e. (1992 års priser) har ökat från 45 till 53 procent. Antalet pensionärer med en disponibel inkomst över 125.000 kr per k.e. har ökat från 6 procent till 9 procent.

49. Tabell: Andel pensionärer med disponibel inkomsti olika intervall.

Disponibel inkomst per k.e., tkr. 1992 års priser.

År —50 50-75 75-100 100-125 125- Summa Andelstal %:

1989 4 51 30 9 6 100

l992 5 42 31 I 13 9 100

Medianpensionärens disponibla inkomst per k.e. ökade i fasta priser med drygt 8.000 kr.

50. Tabell: Förskjutning av median— och kvartilvärden för'disponibel inkomst mellan 1989 och 1992

Disponibel inkomst per k.e., tkr. 1992 åm priser

Genom— nedre gräns median- nedre gräns

snitt första värdet tredje

kvartilen kvartilen

1989 81,6 63,0 76,2 96,2 1992 86,5 67,2 84,6 107,3 Förändring, tkr +4,8 +4,2 +8,4 +] 1,1

___—__

6.5. Pensionärema som grupp och som individer

Det finns en tendens att få en motsägelsefull diskussion kring utveck- lingen av pensionäremas ekonomi genom att man blandar ihop utveck- lingen för de äldre som grupp med de äldre ur ett individperspektiv. Betraktad som grupp har de gamla kontinuerligt fått det ekonomiskt bättre. De äldsta med låg ATP avlider medan yngre tillkommande pensionärer ofta har hög ATP. Om man däremot följer en enskild pensionär över tiden är slutsatserna mera oklara. Nedan beskrivs dessa förhållanden i två olika avsnitt. Först behandlas inkomsteffekten av att nya pensionärer kommer till och gamla pensionärer försvinner. Därefter följs utvecklingen för en enskild pensionär mellan 1989 och 1992 via ett antal typfall.

6.5.1. Inkomsteffekten av omsättningen inom pensionärsgruppen

Ökningen av pensionärshushållens inkomster beror i första hand på att gruppens sammansättning förändras över tiden — äldre pensionärer med ingen eller låg ATP avlider och yngre med högre ATP tillkommer. Under perioden 1989 till 1992 har sålunda antalet pensionärer över 65 år med enbart folkpension minskat med 52.000 varav 7.000 män och 45.000 kvinnor. År 1992 uppgår antalet med enbart folkpension till 192.000 eller strax under 13 procent av pensionärerna. Av de 192.000 år 169.000 kvinnor och 23.000 män. Det högre antalet för kvinnor beror inte bara på skillnader i inkomstförhållanden under den aktiva tiden utan också på att att kvinnorna genomsnittligt sett lever längre.

51. Tabell: Andel pensionärer nred enbart folkpension 1989 och 1992

Andel med enbart folkpension, procent

1989 1 992 1989 1992 1 989 1992

65—69 10,1 7,4 70-74 13,7 10,6 75-79 16,9 13,5 80—89 22,6 17,2 90— 52,1 36,6 Samtliga 16,2 12,6

Antal personer, tusental

Kalla: Bearbetningar av SCB:: totalräknade inkomststatistik

1992 har 87 procent av ålderspensionärema ATP — en ökning med 3 procentenheter sedan 1989 (tabell 52). Andelen kvinnor med ATP har ökat från 75 till 80 procent medan andelen för männen ligger på 96

procent. Uttryckt i basbelopp har den genomsnittliga ATP-pensionen ökat från 1,56 till 1,69 dvs. en tillväxt med ca 8 procent.

52. Tabell: Andel ålderspensionärer med ålderspension från ATP och genomsnittlig pension för dem som har ATP.

Pensionens storlek A ndel,procent basbelopp

[(ön 1989 1992 1989 1992

65-69

70-74 2,56 2,52 75-79 2,00 2,26 80-84 1,10 1,78 85- 0,60 0,79 Samtliga

Kvinnor 65-69 1,23 1,39 70-74 1,24 1,41 75-79 0,91 1,14 80-84 0,52 0,62 85- 0,21 0,34

Samtliga

Samtliga Kalla: Bearbetningar av HINK

6.5.2. Utvecklingen sett ur ett individperspektiv — några typfall

En metod att studera utvecklingen ur ett individperspektiv vore att följa de pensionärer som fanns 1989 och studera hur inkomstutvecklingen varit för dessa fram till 1992 (förutsatt att de fortfarande var i livet). SCB har vid ett par tillfällen genomfört studier där man just följt samma pensionä— rer över tiden”. Dessa studier visar i första hand på omställningseffekter i samband med att vissa fortfarande är yrkesverksamma ett par år efter normala pensionsåldern. Därefter trappas arbetsinsatsen ned. Därvid går man miste om den arbetsinkomst man haft under inledningen av pensio— närslivet. Studierna har också visat att kapitalinkomsterna ökar ju äldre man blir. Detta torde bl.a. bero på att pensionärshushållen med högre ålder realiserar kapital bundet i eget hem och istället får ränteinkomster.

Här åskådliggörs utvecklingen istället via ett antal olika typfall av pensionärer”. I typfallen följs pensionärer som har exakt samma inkomst- förhållanden över åren. Som framgått ovan finns det en rad skäl till att inkomstförhållanden inte är så stabila i praktiken som i stiliserade typfall.

lSSCB Välfärdsbulletinen Nr 4 1993

17Beräkningama har gjorts av SCB med hjälp av SCB:s modellprogram STATUS. Grundbe- räkningama återfinns i appendix.

Typfallen kan därför närmast säga ge en illustration av hur regelsystemen verkar. Följande typfall har valts:

Typfall 1: Pensionär med enbart folkpension Typfall 2: Kvinnlig pensionär med genomsnittlig pension 1989 Typfall 3: Manlig pensionär med genomsnittlig pension 1989 Typfall 4: Pensionär med maximal ATP

För vart och ett av typfallen visas också "variationer" med avseende på förekomst av kapital- och arbetsinkomst.

Pensionärernas kapitalinkomster (inkl. reavinst) 1992 framgår av tabell 53. Det vanliga är att pensionärerna har ett visst överskott i kapital.

53. Tabell: Kapitalinkomst (inkl. reavinst) för pensionärer (65- år) 1992.

Antal. tusental Genomsnitt i tkr

Underskott i kapital 228 -14,3 Vare sig över eller underskott 86 Överskott i kapital 1302 14,5 Kal/a' SCB. Taxopak.

För vart och ett av typfallen finns utöver fallet att kapitalinkomst inte föreligger med en variant med kapitalinkomst. Kapitalinkomsten har därvid valts att återspegla vad som bedömts vara en vanlig nivå på ränteinkomster/utdelningar. För pensionär med enbart folkpension har kapitalinkomsten 1989 satts till 5000 kr, för genomsnittspensionären till 6000 kr och för pensionären med maximal ATP till 8000 kr. Kapitalin— komsterna skrivs i typfallen beräkningsmässigt fram med KPI-utveck- lingen. För typfallen 2-4 finns också med en variant där man utöver pensions- och kapitalinkomst även har viss arbetsinkomst. Nivån på arbetsinkomsten är vald att illustrera utbytet före och efter skattereformen för den pensionär som står inför övervägandet att under ett eller ett par år göra en arbetsinsats motsvarande 2 a 3 arbetsdagar i veckan. För genomsnittspensionären har arbetsinkomsten för 1989 satts till 50.000 kr och för pensionären med maximal ATP till 100.000 kr. Arbetsinkomster- na skrivs i typfallen beräkningsmåssigt fram med KPI—utvecklingen.

Samtliga typhushåll antas bo i hyresrätt med genomsnittlig hyra för en tvårumslägenhet vilket för 1989 innebär en hyra på 1900 kr i månaden. Hyran har räknats upp med KPI för hyreslägenheter vilket medför att motsvarande hyra 1992 satts till 2980 kr i månaden. För typfall 1 (pensionär med enbart folkpension) finns också med ett alternativ med hög hyra (3000 kr/månad 1989) för att illustrera effekterna av att KBT- reglerna ändrats en del för just hushåll med hög boendekostnad. KBT har beräknats enligt de regler som är vanligast förekommande i kommu- nerna och som ger maximalt statligt bidrag till kommunen.

I tabellerna 54-57 redovisas utfallet för vart och ett av typfallen. Mer detaljerade uppgifter om olika delposter (såsom skatt, KBT m.m.) återfinns i appendix.

Typfall I: Pensionär med enbart folkpension

Pensionären med enbart folkpension har tack vare de höjda pensionstill- skotten haft en positiv utveckling av pensionsinkomsten realt sett. Pensionsinkomsten har ökat med 933 kr eller strax under 2 procent (eftersom den som enbart har folkpension inte betalar skatt har också inkomsten efter skatt ökat lika mycket). För pensionär med normal hyra har ökningen ätits upp av ökad hyra (netto för KBT). Vid hög hyra har dock det särskilda KBT som skall garantera en skälig levnadsnivå inneburit en förbättring.

Med den rånteinkomst som lagts in i detta typfall (5.000 kr i 1989 års penningvärde) har de samlade effekterna av ändringarna i kapitalbe- skattningen inneburit en mindre —— om än liten skärpning för pensionären vid jämförelse mellan 1989 och 1992 vilket bl.a. samman- hänger med sparavdragets betydelse för pensionärer med liten räntein- komst. En lättnad i beskattningen av kapital uppstår i detta typfall 1993 när extra avdragets avtrappning mot kapitalinkomst upphör.

54. Tabell: Typfall 1. Pensionär med enbart folkpension

Förändring 1989-1992

Pension, löp. pris

Pension, fast pris 49 617 48 522 49 363 50 550 +933 ENBART FOLKPENSION

Inkomst efter skatt, fast pris 49 617 48 522 49 363 50 550 +933 Disponibelt eller normal hyra, fast pris 40 818 38 886 37 369 39 092 —1 726 Disponibelt eller hög hyra, fast pris 25 588 22 930 30 406 32 312 +6 724 VARIANT 1:VISS RÄNTEINKOMST DÄRUTÖVER

Ränteinkomst löp. pris 5 000 5 520 6 040 6 175 Ränteinkomst, fast pris 6 175 6 175 6 175 6 175 i 0 Tillkommande skatt på ränteinkomst, fast pris 2 618 2 585 2 873 2 852 +234 Inkomst eher skatt, fast pris 53 174 52 114 52 663 53 874 +700 Disponibelt etter normal hyra, fast pris 43 565 41 666 39 801 41 023 —2 542 Disponibelt etter hög hyra, fast pris 28 334 25 710 30 406 32 313 +3 979

Anm.Fasta priser avser 1992 års ruva. ! omst e er 5 att ar ärvr ata upp me KPI. Dispom at a er yra ar räknats om med KPI exkl. bostadsposteni KPI

Typfall 2: Kvinnlig pensionär med genomsnittlig pension 1989

En kvinnlig pensionär hade 1989 en genomsnittlig pensionsinkomst på 57.600 kr vilket uppräknat till 1992 års nivå motsvarar 69.560 kr”. Trots att pensionen realt urholkats (beroende på att basbeloppet inte höjts i takt med KPI) så har inkomst efter skatt utvecklats positivt. Denna ökning slukas dock av ökade boendekostnader.

Beskattningen av ränteinkomst är i stort sett oförändrad. Även detta typfall befinner sig i extra avdragets avtrappningsskikt vilket innebär att skatten på ränteinkomsten lättas fr.o.m. 1993.

Beskattningen av arbetsinkomster vid sidan av pensionen har påtagligt lättats för denna pensionär genom att arbetsinkomst inte längre avtrappar det särskilda grundavdraget. En ännu större lättnad uppstår i de fall arbetsinkomsten härrör från aktiv näringsverksamhet genom att arbetsin- komster från näringsverksamhet inte längre reducerar KBT. Detta gällde redan tidigare för arbetsinkomst från anställning.

55. Tabell: Typfall 2. Kvinnlig pensionär med genomsnittlig pension 1989

Förändring

1989 1990 1991 1992 1989—1992 Pension, löp. pris 57 600 61 320 66 470 69 560 Pension, fast pris 71 136 68 617 67 932 69 560 -1 576 ENDAST PENSIONSINKOMST Inkomst efter skatt, fast pris 58 076 57 091 58 357 59 757 +] 681 Disponibelt efter normal hyra, fast pris 42 403 41 010 40 070 41 334 -1 069 VARIANT 1:VISS RÄNTEINKOMST DÄRUTÖVER Ränteinkomst löp. pris 6 000 6 620 7 250 7 410 Ränteinkomst, fast pris 7 410 7 410 7 410 7 410 i 0 Tillkommande skatt på ränteinkomst, fast pris 3 285 3 158 3 395 3 401 +1 16 Inkomst efter skatt, fast pris 62 201 61 341 62 372 63 766 +1 565 Disponibelt efter normal hyra, fast pris 45 103 43 866 42 730 44 045 -1 058

VARIANT 2:VISS ARBETSINKOMST UTÖVER PENSION- OCH KAPITALINKOMST

Arbetsinkomst, löp. pris 50 000 55 180 60 390 61 750 Arbetsinkomst, fast pris 61 750 61 750 61 750 61 750 i 0 Inkomst efter skatt, fast pris 92 909 101 633 107 354 108 404 +15 495 Disponibelt eller normal hyra, fast pris 73 793 82 015 86 764 88 683 +14 890 (arbetsinkomst från anställning)

Disponibelt eller normal hyra, fast pris 60 496 68 577 86 764 88 683 +28 187 (arb.inkomst från aktiv näringsverks.) Amn.Fasta priser avser 1991 års nivå. lhkomst eller skatt har därvid man: upp med KPI. Drspombelt eEer hyra har

räknats om med KPI exkl. bostadsposten i KPI

”Den tidigare nämnda effekten av att pensionärerna byts ut medför att en kvinnlig pensionär 1992 har en genomsnittspension på 75.900 kr vilket således realt är 6.300 kr mer än genomsnittspensionären från 1989.

Typfall 3: Manlig pensionär med genomsnittlig pension 1989

En manlig pensionär hade 1989 en genomsnittlig pensionsinkomst på 96.200 kr vilket uppräknat till 1992 års nivå motsvarar 1 16.180 kr”). Vid pensioner på denna nivå har pensionärerna klarat sig bra. Inkomst efter skatt har ökat med över 6 tkr och även efter betald boendekostnad har han fått ett klart positivt nettoutfall. Vid denna inkomstnivå har den ändrade kapitalbeskattningen inneburit en lättnad i beskattningen av ränteinkomsten.

56. Tabell: Typfall 3. Manlig pensionär med genomsnittlig pension 1989

Förändring

1989 1990 1991 1992 1989-1992 Pension, löp. pris 96 200 102 400 111 010 116 180 Pension, fast pris 118 807 114 586 113 452 116 180 -2 627 ENDAST PENSIONSINKOMST Inkomst eher skatt, fast pris 78 934 79 149 83 632 85 669 +6 735 Disponibelt efter normal hyra, fast pris 47 439 47 387 49 216 50 929 +3 490 VARIANT 1:VISS RÄNTEINKOMST DÄRUTÖVER Ränteinkomst löp. pris 6 000 6 620 7 250 7 410 Ränteinkomst, fast pris 7 410 7 410 7 410 7 410 i 0 Tillkommande skatt på ränteinkomst, fast pris 2 848 3 028 2 223 2 223 - 625 Inkomst efter skatt, fast pris 83 496 83 528 88 819 90 856 +7 360 Disponibelt efter nomral hyra, fast pris 51 702 51 434 54 052 55 096 +3 394 VARIANT 2:VISS ARBETSINKOMST UTÖVER PENSION- OCH KAPITALINKOMST Arbetsinkomst, löp. pris 50 000 55 180 60 390 61 750 Arbetsinkomst, fast pris 61 750 61 750 61 750 61 750 i 0 Inkomst efter skatt, fast pris 1 17 693 119 687 131 203 132 921 +15 228 Disponibelt efter normal hyra, fast pris 83 652 85 671 95 543 97 161 + 13 509

Anm. Fasta priser avser 1992 års nivå. Inkomst efter skatt har därvid räknats upp med KPI. Disponibelt efter hyra har räknats om med KPI exkl. bostadsposten i KPI

”Den tidigare nämnda effekten av att pensionärerna byts ut medför att en manlig pensionär 1992 har en genomsnittspension på 126.700 kr vilket således realt är 10.500kr mer än genomsnittspensionären från 1989.

Typfall 4: Pensionär med maximal A TP

Pensionären med maximal ATP har också haft en positiv utveckling av inkomst efter skatt och efter betald hyra. Även kapitalbeskattningen har inneburit en viss lättnad jämfört med 1989.

Utbytet för en pensionär med maximal ATP som överväger att under en period fortsätta arbeta har ökat mycket påtagligt. Av en extra arbetsinkomst på 100.000 kr fick pensionären 1989 behålla 37 procent. 1992 fick pensionären behålla 55 procent av inkomsten från den extra arbetsinsatsen. Att lättnaden blir så påtaglig beror på att man då kommer upp i de inkomstnivåer där marginalskattesänkningarna är stora.

Det hör dock till saken att inkomster på en nivå motsvarande full ATP och inkomst därutöver på 100.000 kr. är mycket sällsynt bland pensionä- rerna (ca 2 procent av pensionärerna hade 1989 en sammanräknad inkomst på denna nivå). Och bland dessa torde det också vara så att inkomstförhållandena inte är så enkla som förutsatts i exemplet utan man har i många fall avdrag varför nettot då man jämför förhållandena före och efter reformen inte blir lika påtagligt positivt. Typfallet kan därför i denna del sägas ha dålig verklighetsförankring.

57. Tabell: Typfall 4. Pensionär med maximal ATP

Förändring

1989 1990 199! 1992 1989—1992 Pension, löp. pris 135 594 144 342 156 492 163 782 Pension, fast pris 167 455 161 519 159 935 163 782 -3 673 ENDAST PENSIONSINKOMST Inkomst efter skatt, fast pris 104 060 105 666 114 306 117 058 +12 998 Disponibelt efter normal hyra, fast pris 70 914 72 395 79 001 81 298 +10 384 VARIANT 1:VISS RÄNTEINKOMST DÄRUTÖVER Ränteinkomst löp. pris 8 000 8 830 9 660 9 880 Ränteinkomst, fast pris 9 880 9 880 9 880 9 880 :l: 0 Tillkommande skatt på ränteinkomst, fast pris 3 801 3 523 2 962 2 964 —837 Inkomst efter skatt, fast pris 110 139 112 024 121 216 123 974 +13 835 Disponibelt efter normal hyra, fast pris 76 593 78 415 85 766 88 214 +11 621

VARIANT 2:VISS ARBETSINKOMST UTÖVER PENSION— OCH KAPITALINKOMST

Arbetsinkomst, löp. pris 100 000 110 370 120 790 123 500

Arbetsinkomst, fast pris 123 500 123 500 123 500 123 500 i 0 Inkomst efter skatt, fast pris 156 105 162 728 188 421 192 443 +36 338 Disponibelt etter normal hyra, fast pris 119 540 126 423 151 554 156 683 +37 143

Anm. Fasta priser aveer 1992 års nivå. Inkomst efter skatt har därvid räknats upp med KPI. Disponibelt eRer hyra har räknats om med KPI exkl. bostadsposteni KPI

Why?-all .' ' ..'umhpm: lanken-MWMHW'MW WW"?

HM m.m Mamma MM &&me am.... ma...-...en. ...... .. ?" ...g... .a... ,... n...... ...... .. a.m...mmwåw W&W mamma.-. w. WPMPWM. m mm'. man!!! MMHWQW'? m .Mnmml- Mmm m.m li#lmmémä HRM!” namnsatta! mangan,, MW' v: limmq EE tum.... 53?qu init m.

ra....mwl ib animala iq ';caad aim-m; år: frid minimal mk Anm:»mmadu

,! urmumwawmmabmq. - 1'ITA lif-555335... mlmmEmenmumåtlmfmbw-dmd—

'.uruinnaq Einar” mm;.ral'llla Mihai aj. nd Niwt Engman! lbfmmnim li. ':... |.)

”T*" "" " ' _"?— .. Mwmwmmwmiw.mmmmdn ...... " . um. nara MW.. . .mmam Hin-l li 1?! ”|" manillmmmm "'

M:t-”WEM lb" emm 10115? andra: [lå nME ud .mmmåmwmq anamma am". ...-......» ...nu... ..: H....” |... M- ru- 1- min.-WWWW #*hum lehwub nu

__ _ _ * WMI—nål FMLIMLE n.'. '"ulfa Pl.-a."..l -|.- nd" .. .::-y " .'l-l- '. 1”. |

pan-nm wat, _ L"?"l um , w.. ., , , _ . 'It-l'i'I'l'illI-nråå -Fl'"1"'l"'- .WU... .- -i:. 'lu'f EWWEW' 431 mg. 1uLW'?1l-E-5".$Ff"."" m "it-'- ..:|'"" r- m -1 __| 1,,,..lå.|_.1....,""på..,aafi m, ,

" I'm-rr-l-l'dflw 'l-'-'.l"li'I' ...-uma. fit". Ill ,m '1 :.L -.-.. - Hm .. mammutar-nr

. "*"” nät.??? mat.-m lll-.H'Ml'hn u,. rr:- ..... mmm-mm.. " ' "IT..." &. HIIRIH'EHL'nFENI ""|" U' NEW "W MME WW.

Julmat rr_.l'al-l'|1rll GI".”. '.1'110 .rrr III"-"Et'v ån

' a.m.-.c. ";-||th Inn! |-|.. Mia?-www?” "' 'I m Lil'. _.III .W'I..måll"-E,_få,|. ' 11' :|: _'I'l'f'l BMIWIM mår?!» '.!. m

.||. .. .mm ...—...i... ur..aummw'*"1— tn. "W"-Maha?!" ""IIIIIZ mmMmthhn-mmmm mu..- MQLK'I mm man. en nu uh.; 'thr-uthkmidl Imi... utan ...av-.: Han? artär hinna.-Wunamn ism-law

:_'_g_.l__* -l_.=_.

WWW!!!) -mlll$'lll Toll—.! mmm &?le ammu- !

tillåtit man (REON lim-"IM ”MIM. ' I .... qulTl' 06,1 m ww unrar.” mammutar-sw ' m...... mami |z|-tm sum mratl mmmmm ' &! Til. & BCE" ut (tl & i!!! ME ?" maj thu: md hår-Inn pir-| gulmruggm ' .] m.m.-Ignaz" hum-nur.

. " , %!!quka Mill.-Im ur Haganah-av..» l-UL' mmm. iu! ruuit; varumä- w: lu- en HIT-lm pl |..lt. 'utl av ":|--: died.— m...: I... u- rim.. ...a. a.. :P.-hum mull-"nian. 'I"IIH1 JH."—

Appendix till bilaga 4

Grundtabeller för åren 1989-1992. Löpande priser.

II

III

HUSHÅLL 1 AKTIV ÅLDER (18-64 ÅR). 259 Decil efter disponibel inkomst per konsumtionsenhet (k.e.). - makrotal

- antal hushåll (familjetyp/socioekonomisk grupp)

- antal k.e.

INDIVIDER 1 ÅLDERN 18-64 ÅR EXKL. STUDERANDE. 277 Decil efter arbets+pensionsinkomst.

- makrotal.

- antal individer

PENSIONÄRER (65- ÅR). 295 - makrotal

- antal

- typfall (mer detaljerade uppgifter)

_,_,I I ""|": '"'|'"' ||||_|, II"?” "' +|".,,,'.|— ,,,. ,||I|I||, | ,,,,.,,,| ,,, I', 'I "=", .|r, |. . . ., ,,. ,,,,, || ,',,.,""""'—T " "" ""',""" IT'.'I"|1'I|III"|II""$"" ""'""'F'"'

J,'.v ,'|,', I'.... |.' 'C| ,"_|,.I , | .,....,.,. -,....,|, ',...'., ... .,,| ,_|,'|,,,, __|-. ,, .|,,' ,. .||....—|.I.|I',| :| |,” I..," ,| |,,,,|_,,,,,;—",,, "i".'I.;'.'. "' 'L'In' ','.|'_, ('."' _,'| ' ,"",,',|,',:H "'F'i.""..'.',I'-'."I "" |:,'I"'"I ,_., I, . ,.- ,,,,,,, ,.,,|.,,|,, ""..,- .||. ,.,,| ,,,II,, .,,. ,." ,,v',," I

. '" |”: .| _.'.,".'....,,..| .||." ",..:J'|..'.,1-'|'.;|,., " ' ,-"|:,

. ,,""..' ,,',. ?.,p: II.|,."," "'"- ' |,III'l-,9,,I,,|, ",'II,:','"""'..J ' ' | ,,, ,, ' . _ " '|'": "" "",""'.. |_I'I"" '" T'. ll'"'"|"'.1"""FhI"-I"$'""x ..I'"""" " '_'" ""'""; bmnfj'qchij'é'I , _ ' ,,| ,,I |, |, , ||: |-,|.' ',|_, _, ' "I; .| .'I.,.".,. ,.I..' . , . .,,,. ..., ,, ' " | ",,||,, ' ,, ,..,.,' . ., .'|- ' ;l ,If'| " ' ':'",TF ' , ,,,,_,,. . .,... ., .. ',.-,,,'_,,,. , _:|,, | |'.. ... ..'.' w, - '- -_ ' |. ',' ,, ..' , ,. . I "| Ehmm Ihan'ri) , .,, .,'.'I_I_,,""' - —,|... | , ., ||| . | ,,, || .|| , ,, .,h ,. _ . —|- .. . ,,-,|.,.- ,_,-., ,,..,..'|'|-",,, W,”, ',Pmmq'bmsan .' " . '.' . . .... ' _.",'. ... .. .F' "".. .'.. ".. . , ,,,, , |.- , .||, .. ., , .,',J '_,,,_'l .||, .'H ,II. , .'| , |||, 'Ii

',""|'|I':'I;," . ..' .||. I..-: 'I..- .»|'.,..,..

..,n. ,, . _ '|'. ,,,, . . "' J,? .. ,'- .. |... . . ' ..||.. . | . -. | I—Ip. ', ' , "..|'.,' .. ",,fw'" ,. .. " . ., _ _'I'.Il".' " ,.'.,_ ,II'. '."'" '., ||] |,,I,, ,-|I . ..,II.,L.'"."|' .. . ., . . , .. . _ . - . 'I | , . .. .....,|.|.I . —, : .. " . 'I " .. " ' ', "'I. -. . ..- 'I. , ||. - | , , ..,,I. .., .. .'I'... , T " I I I , , , . '. .'.? ., |.. ,_.,.,., _|. |||-,|,,._,|, _ ,, | _ ,,..,, l , . , ,.- , , __|,- , ,,,||,' ..| .. .I ,,'... ', -. .f', ,' ' ..l ,. ' -. "" " ' _,||I.,.,f,',"-'I.l,1| L .. ' I " -.I . _. , " "" I | ||_ | . ' ' I . |||"'|"' II ' ' | ' . |"|, ". u,... " _| , . "" ' " " ' " ' .' I . ' . " -.-..".'.'I" , . ", | , II , |, ;, , ' , ." II 'I ' I.t I" "I '|' """

' .— ,. , - ,, . ,— ,, , | I"Ill" .. :.1,-|.,"...-;",| ,.,, , ,,,| .. |. .I . | . || . ,,., .-,,. .._,.=.| » | ... |,.,||, ,||||,:,, ,,,,.,I',||' ,E'THJHT'I |,,|-|, ||, _ -' ' .'. ' ' .f' '.I',. ...nu" " ,, |; . , - , : . » .. . :. ..... ..., . . ,, ,,,-..,, . ',,_5,, , ' , ,. ',. ,..'|.|I_",|,|._." ..

, ,,,|'|I'.'|"" 'I.'|"|,, . .'. "i'u'

I:

HUSHÅLL | AKTIV ÄLDER (18-64 år)

Decil efter disponibel inkomst per konsumtionsenhet (k.e.)

-makmtal i mkr —antal hushåll (familjetyp/socioekonomisk grupp) —antal k.e.

Tabell 1A: 1989. Makmtal för hushåll där hushållsfönståndaren är 18-64 år. Löpande priser (mkr).

Decil efter disponibel inkomst per k.e

I 2 3 4 5 Lön 9 149 24 367 35 432 43 072 48 617 Företagsinkomst 741 2 419 2 003 1 108 1 266 Sjukpenning mm 950 2 650 3 510 4 180 4 161 Föräldrapenning 594 1 851 2 159 1 755 1 546 Arbetsmarknadsstöd 348 1 497 1 322 1 299 1 257 Övriga skattepliktiga inkomster 84 341 426 284 296 Pensionspremie 82 245 281 393 509 Avdrag för periodiskt understöd 26 50 70 78 77 Summa arbetsinkomst 11 758 32 830 44 501 51 226 56 555 Folkpension inkl pensionstillskott 395 2 090 2 281 I 388 1 350 ATP 268 1 185 1 542 1 893 2 276 Arbetsmarknads— och övriga enskilda pensioner 37 367 542 631 964 Summa pensioner 700 3 642 4 365 3 912 4 590 S:a arbets- och pens.ink. 12 458 36 472 48 866 55 138 61 145 Ränteinkomster/utdelning 954 1 182 1 382 1 415 1 677 Ränteutgifter 848 2 997 4 470 5 432 5 442 Reavinst taxmåssigt 182 60 124 175 99 Reaförlust 2 0 9 0 25 Kapitalinkomst 1 246 1 278 1 581 1 695 1 836 Reavinst brutto 292 96 199 280 159 Barnbidrag 998 2 291 2 096 1 527 1 189 Underhål1sbidrag 308 1 164 1 011 677 383 Bostadsbidrag 408 ] 198 1 105 521 247 Socialbidrag 607 928 480 422 211 Studiemedel 970 1 024 1 174 1 303 861 Övriga positiva transfereringar 132 167 91 56 66 Summa positiva transfereringar 3 423 6 770 5 958 4 506 2 958 Slutlig skatt 3 402 10 364 14 612 16 887 19 654 varav skatt på förvärvsinkomst O O 0 O O Skatt på kapital 0 0 0 O 0 Skattered för underskott av kap 0 O O O O Fastighetsskatt 87 115 140 144 176 Förrnögenhetsskatt 258 32 44 50 94 Övrigt 0 0 O O 0 simulerad skatt reavinst/reaförlust 42 24 54 65 46 Andra negativa transfereringar _ 211 295 323 417 381 Disp.ink.inkl. reavinst 13 514 33 861 41 470 44 035 45 904

Disp.ink. exkl. reavinst 13 264 33 789 41 325 43 820 45 791

6 7 8 9 10 Summa P91-p99

53 976 58 947 67 621 80 583 106 650 528 414 94 560 873 1 358 1 683 1 970 3 061 16 482 2 690

4 597 4 727 4 503 4 808 3 666 37 752 3 375 1 164 931 727 496 430 11 653 338 916 858 589 438 353 8 877 348 296 213 362 238 258 2 798 243 700 896 1 008 2 069 5 273 11 456 4 290 82 103 135 103 225 949 199

61 040 66 034 74 341 86 362 108 921 593 568 97 064 1 248 1 259 1 149 844 594 12 598 538 1 837 2 084 2133 1 744 1 263 16 225 1 090 932 1 433 1 128 1 574 2178 9 786 1 790

4 016 4 776 4 410 4 162 4 035 38 608 3 418 65 056 70 810 78 751 90 524 112 956 632 176 100 482 1 973 2 295 2 444 3 523 9 575 26 420 5 354 5 956 5 980 7 270 9 468 18 748 66 611 13 674 297 461 309 857 12 306 14 870 3 485 13 65 0 7 27 148 24

2 448 3 032 2 938 4 894 29 265 50 213 10 930 475 737 494 1 370 19 690 23 792 5 576 906 658 453 352 344 10 814 281 355 211 172 124 149 4 554 120 160 79 67 38 38 3 861 31 208 111 155 20 171 3313 171 665 419 345 349 161 7 271 150 18 25 19 4 4 582 4

2 311 1 502 1 210 886 867 30 391 758 21 079 24 153 27 112 32 696 52 331 222 290 40 472 0 O O O 0 0 0

0 0 0 0 O O 0

0 0 O 0 O O 0

163 186 210 330 554 2 105 398 120 138 182 250 1 075 2 243 490

0 O O O 0 O 0

130 223 168 469 8 010 9 231 1 972 399 481 632 494 704 4 337 635

48 337 50 710 55 155 63 114 90 053 486 153 71 063 47 992 50 196 54 829 62 212 78 373 471 591 67 459

Tabell IB: 1989. Makmtnl för Iillgångan'skulderi hushåll där hushållsföreståndann är 18-64 år . Lägende Ens" (mkr). Decil efter diseanibel inkomst E" k.e.

I 2 3 4 5 Bankmedel privat 8 060 11 744 14 086 13 520 16 076 Övriga finansiella tillgångar 32 158 7 432 8 977 9 854 11 572 Privatskuld exkl swdieskuld 11 512 28 562 43 783 44 474 47 066 Studieskuld 2 524 4 302 56 259 6 039 4 958 Eget. hem/fritidshus tax, värde 5 743 17 360 23 909 25 225 27 749 Eget. hem/fritidshus marknadsvärde 14 690 42 809 58 722 61 387 68 072

Nettoförmögenhel. exkl näring marknadsvärde 50 602 37 564 47 067 45 356 56 785 Nettoförmögenhet exkl näring taxeringsvärde 37 927 9 235 6 682 6 328 13 477

Tabell IC: 1989. Antal hushåll m.m. där hmhållsföreståndnren är 18-64 år.

Decil efter diseom'bel inkomst Her k.e.

! 2 3 4 5 Totalt antal k.e. 528 397 723 427 733 513 687 452 653 728 Antal hushåll 34] 168 342 159 341 434 341 910 341 715 Fördelat efter familjelyp: Ensamstående utan barn 269 960 162 340 145 117 155 209 170 118 18-24 208 391 88 423 60 450 65 589 58 610 25-44 40 960 36 031 42 828 49 675 73 371 45-64 20 610 37 886 41 840 39 945 38 138 Gifta/samboende utan barn 11 354 21 705 22 483 29 205 40 899 18-24 1 331 1 771 2 240 3 817 6 006 25—44 2 040 3 736 3 479 3 549 5 087 45-54 2 681 3 993 3 955 6 476 5 854 55—64 5 302 12 205 12 810 15 363 23 952 Ensamstående med barn 14 042 50 780 47 888 36 740 15 941 Sammanboende med barn 45 812 107 334 125 946 120 756 114 757 1 barn 7 924 17 744 23 658 37 989 47 182 2 barn 15 091 40 256 63 217 65 050 57 132 2+ barn 22 798 49 334 39 071 17 716 10 443 Fördelat efter socioekonomlsk grupp: Ej förvårvsarbetande: 176 323 80 322 71 790 42 541 28 163 - studerande 114 211 17 898 19 260 9 497 1 056 - pens. 18-64 år 9 317 47 357 48 634 29 312 24 510 — övr. ej förvzrb, 52 795 15 067 3 896 3 732 2 597 Anställda: 124 534 224 208 249 044 283 488 301 509 Arbetarfamiljer 67 626 121 478 133 422 147 377 157 418 - ej facklärda 43 934 70 354 75 943 78 810 94 133 - facklärda 23 692 51 125 57 479 68 567 63 285 Tjänstemannafamiljer 22 630 56 642 83 814 97 082 109 951 - lägre 12 961 28 109 28 218 32 528 40 920 - mellan 6 694 18 837 41 252 47 295 48 385 - högre 2 975 9 696 14 344 17 259 20 645 Övriga anställda 34 278 46 088 31 808 39 029 34 140 Lantbrukare 18 849 12 591 7 975 5 595 2 908

Egenföretagare 21 463 25 037 12 625 10 287 9 135

6 7 8 9 10 Summa P9l-p99

18 972 21 443 21 185 28 994 50 284 204 364 33 804 16 297 19 054 20 615 34 026 154 857 314 842 83 009 48 801 52 459 59 684 86 144 189 016 611 501 1.27 373 5 168 4 746 3 734 4 071 4 530 46 331 4 151 29 468 31 019 38 155 50 955 73 345 322 928 64 291 74111 76 996 96 663 131 164 197 604 822 218 172 743 69 192 79 481 92 921 137 007 293 533 909 508 203 289 21 754 27 840 30 524 45 416 138 757 337 940 81 262 6 7 8 9 10 Summa P9I—p99

630 839 603 812 594 052 603 254 602 806 6 361 280 541 373

342 132 341 658 341 692 341 787 341 877 3 417 532 307 658

163601 165308 148199 122346 113152 1615350 100338

38 087 28 723 23 421 14 842 8 650 595 186 8 386 75 376 82 357 69 936 59 498 65 327 595 359 57 028 50 139 54 229 54 841 48 007 39 176 424 811 34 924

63 429 89 308 129 693 165 481 184 949 758 506 170153

9 037 11 664 15 545 6 846 1 002 59 259 1 002 13 595 16 664 32 067 39 696 46 516 166 429 43 537 9 052 21 541 32 700 57 135 75 735 219122 69 559 31 746 39 438 49 381 61 803 61 697 313 697 56 056 12 903 6 542 4 355 4 728 4 603 198 522 2 793 102 199 80 500 59 445 49 232 39 173 845 154 34 374 56 010 49 694 38 813 34 829 25 423 339 266 23 323 42 827 26 951 19 493 12 879 11 522 354 418 9 658 3 362 3 856 1 139 1 524 2 229 151 472 1 393 18 402 16 636 8178 6147 8142 456 644 6 838 1 992 352 0 595 352 165 213 352 16 161 15 580 8 178 5 552 6 903 211 504 5 782 249 704 0 O 887 79 927 704 313 852 312 233 322110 324 328 322 584 2 777 890 291 435 156 940 150 837 144 025 118 482 53 219 1 250 824 51 347 91 042 81 978 80 192 55 025 17 390 688 801 16 741 65 898 68 859 63 833 63 457 35 829 562 024 34 606 126194 132 758 152 131 189 742 246 463 1 217 407 220 394 44 645 37 882 42 798 40 871 32 557 341 489 28 108 54 544 61 651 78 264 91 468 97 801 546 191 90 616 27 005 33 225 31 069 57 403 116104 329 725 101 670 30 718 28 638 25 954 16 104 22 902 309 659 19 694 2 635 1 570 1 480 1 806 594 56 003 594

7 245 11 219 9 924 9 506 10 560 127 001 8 791

Tabell 1A: 1990. Makmtal för hushåll där hushållsfönståndann är 18—64 år. Löpande priser (mkr).

Decil efter dispam'bel inkomst per k.e.

I 2 3 4 5 Lön 9 927 28 150 38 641 51 176 56 032 Företagsinkomst -315 1 570 2 207 1 418 1 377 Sjukpenning mm 1 158 3 542 3 736 4 341 4 420 Föräldrapenning 701 2 532 2 521 2 626 2 056 Arbetsmarknadsstöd 396 1 495 1 836 1 200 1 388 Övriga skattepliktiga inkomster 143 320 429 602 293 Pensionspremie 151 254 316 396 468 Avdrag för periodiskt understöd 16 56 67 103 103 Summa arbetsinkomst 11 843 37 299 48 987 60 864 64 995 Folkpension inkl pensionstillskott 349 1 735 2 127 1 449 1 512 ATP 295 1 125 1610 1731 2117 Arbetsmarknads- och övriga enskilda pensioner 184 268 679 460 862 Summa pensioner 828 3 128 4 415 3 640 4 491 S:a arbets- och pensjnk. 12 671 40 427 53 402 64 504 69 486 Ränteinkomster/utdelning 907 1 450 1 490 1 613 2 083 Ränteulgifter 1 185 3 293 5 529 6 818 7 406 Reavinst taxmässigt 44 69 176 108 313 Reaförlust 7 0 O 0 1 Kapitalinkomst 977 1 560 1 772 1 786 2 584 Reavinst brutto 70 110 282 173 501 Barnbidrag 1 158 2 614 2 282 1 933 1 442 Underhållsbidrag 441 1 385 892 762 388 Bostadsbidrag 470 1 278 1 158 593 388 Socialbidrag 833 1 177 695 330 240 Studiemedel 1 404 1 399 1 573 1 051 950 Övriga positiva transfereringar 193 122 72 54 33 Summa positiva transfereringar 4 498 7 974 6 673 4 723 3 439 Slutlig skatt 3 341 11 467 15 448 19 411 21 448 varav skatt på förvärvsinkomst () 0 0 0 0 Skatt på kapital 0 0 0 0 O Skattered för underskott av kap 0 0 0 0 0 Fastighetsskatt 146 150 185 224 243 Förmögenhetsskatt 39 20 19 3 22 Övrigt 0 O 0 0 O Simulerad skatt reavinst/reaförlust 1 1 29 60 50 137 Andra negativa transfereringar 144 266 351 428 458 Disp.ink. inkl. reavinst 14 661 38 228 46 048 51 174 53 603

Disp.ink. exkl. reavinst 14 602 38 147 45 826 51 051 53 239

6 7 8 9 10 Summa P9I-p99

61 956 66 335 74 225 88 568 118 804 593 814 103 252 1 940 1 060 1 263 2 207 3 145 15 872 2 763 5 087 5 214 5 043 5 077 4 228 41 846 3 738 1 510 1 176 761 665 447 14 995 425 1 042 1 087 800 532 219 9 995 219 239 393 244 369 549 3 581 371 690 736 865 1 590 4 323 9 789 3 534 99 118 108 84 224 978 197

70 985 74 411 81 363 95 744 122 845 669 336 107 037 1 311 1 310 1 238 1 070 656 12 757 584 2 270 2 340 2 434 2 260 1 593 17 775 ] 470 950 1 473 1 763 1 850 3 780 12 269 3182

4 531 5 123 5 435 5 180 6 030 42 801 5 236 75 516 79 534 86 798 100 924 128 875 712 137 112 273 2109 2647 2519 3893 11407 30118 6084 7 062 7 515 8 362 10 871 21 565 79 606 15 049 436 540 464 887 15 456 18 493 2 867

0 0 0 3 161 172 107

2 806 3 511 3 261 5 313 36 136 59 706 10 670 697 864 742 1 419 24 729 29 587 4 587

1 026 718 443 384 302 12 302 251 296 198 177 101 110 4 750 93 179 133 77 61 29 4 366 29 181 181 113 103 36 3 889 36 420 396 359 352 146 8 050 126 22 17 12 6 0 531 0

2 124 1 643 1 180 1 006 623 33 883 535 24 469 26 317 29 342 35 602 61 299 248 144 44 369 0 0 O O O 0 O

0 0 0 O O 0 0

0 O O O O 0 O

240 285 333 429 793 3 028 552 28 38 92 7] 1 400 1 732 334

0 0 O 0 0 0 0

203 281 239 432 9 530 10 972 1 572 480 554 . 544 .476. - '. 761" " 4” 462 _ _ ' _677 55 497 57 817 61 353 71 165 103 574 553 120 78 432

55 003 57 234 60 850 70 177 88 375 534 504 75 418

Tabell IB: 1990. Makruhl för tillgångar/skulderi hushåll där hushållsföreståndaren är 18-64 år . Löpande priser (mkr). Decil efter diseonibel inkomst E" k.e.

! 2 3 4 5 Bankmedel privat 7 967 13 474 12 475 14 684 17 355 Övriga finansiella tillgångar 5 194 6 693 8 289 8 267 12 081 Privatskuld exkl studieskuld 22 090 27 089 41 167 56 446 57 068 Studieskuld 2 325 5 578 6 162 5 265 5 553 Eget hem/fritidshus tax. värde 10 026 22 803 35 817 40 664 48 579 Eget hem/fritidshus marknadsvärde 18 875 43 254 68 009 77 340 92 468 Nettoförmögenhet exkl näring marknadsvärde 31 292 41 887 49 977 52 359 74 131 Nettoförmögenhet exkl näring taxeringsvärde 8 487 17 609 15 423 10 386 24 325

Tabell IC: 1990. Antal hushåll m.m. där hushållsföreståndann är 18-64 år. Decil efter disgonibel inkomst E" k.e.

I 2 3 4 5 Totalt antal ke 542 853 739 625 731 279 715 783 675 753 Antal hushåll 347 595 347 615 347 321 347 794 348 051 Fördelat efter familjetyp: Ensamstående man barn 273 430 160 707 159 197 153 126 171 205 18-24 215 677 74 898 63 735 63 004 54 755 25-44 39 865 49 423 51 227 50 724 70 468 45-64 17 888 36 385 44 236 39 397 45 981 Gifta/samboende utan barn 13 271 16 032 21 754 27 928 38 034 18-24 1 142 982 2 732 3 269 4 866 25—44 3 291 1 635 2 840 6 320 7 446 45-54 3 003 4 765 4 544 4 703 7 514 55-64 5 835 8 650 1] 637 13 636 18 208 Ensamstående med barn 16 028 62 605 42 249 38 856 14 556 Sammanboende med bam 44 866 108 271 124 121 127 884 124 256 1 barn 9 549 16 715 23 031 31 381 52 237 2 barn 14 253 45 489 59 610 73 441 59 728 2+ bam 21 064 46 066 41 480 23 062 12 292 Fördelat efter socioekonomisk grupp: Ej förvårvsarbetande: 179 586 72 665 71 707 31 103 28 475 - studerande 122 642 18 243 19 656 5 481 1 946 pens. 18-64 år 7 271 37 819 45 854 22 666 23 600 övr. ej förvarb. 49 673 16 603 6 197 2 956 2 929 Anställda: 119 403 242 973 250 847 301 864 305 669 'Arbetarfamiljer 64 878 119 469 132 208 159 101 156 325 - ej facklårda 43 661 76 789 78 083 93 466 85 393 - facklärda 21 217 42 680 54 125 65 635 70 931 Tjänstemannafamiljer 19 253 66 951 71 605 104 288 107 400 - lägre 10 629 29 797 20 418 38 866 38 562 - mellan 8 129 28 181 36 689 50 918 46 636 - högre 495 8 974 14 498 14 504 22 203 Övriga anställda 35 272 56 553 47 034 38 475 41 944 Lantbrukare 16 143 10 897 4 828 3 428 2 191

E enföreta are 32 464 21 079 19 938 11 398 11 716

6 7 8 9 10 Summa P91—p99

18 533 22 897 23 016 30 916 55 900 217 217 38 827 11 267 13 670 17 206 26 942 195 412 305 021 60 543 56 160 60 553 67 531 90 549 193 063 671 716 115 388 4 480 4 987 4 902 5 455 4 434 49 141 4 076 45 802 50 784 54 984 71 470 117 309 498 238 99 446 86 878 96 302 104 186 136 150 222 070 945 532 188 590 74 264 90 213 107 044 138 719 372 008 1 031 894 213172 26 198 34 349 41 099 56 064 232 711 466 651 108 119 6 7 8 9 10 Summa P9I-p99

636 931 604 607 581 624 601 961 600 338 6 430 754 538 725 347 134 348 228 347 682 347 517 347 986 3 476 923 313 074 172 921 177 879 166169 132 271 122167 1 689 072 109 739 44 377 33 272 15 608 11 733 7 198 584 257 6 555 69 329 89 505 84 311 70 414 60 766 636 032 55 876 59 215 55 102 66 250 50 124 54 203 468 781 47 308 60 939 84 094 126 481 167 416 191 065 747 014 173 284 5 894 10 091 12 413 6 222 2 277 49 888 2 277 12 419 18 435 31 029 43 046 43 676 170137 39 517 13 557 18 622 36 051 55 324 77 387 225 470 69 963 29 068 36 946 46 988 62 824 67 725 301 517 61 526 9 744 8 470 4 668 1 958 1 556 200 690 1 304 103 530 77 785 50 364 45 872 33 198 840147 28 747 55 247 48 328 34 936 34 344 22 931 328 699 20 530 42 527 26 035 14 254 10 230 9 153 354 720 7 228 5 756 3 422 1 174 1 298 1 114 156 728 988 17 783 14 851 6 972 5 579 9 288 438 009 8 627 643 643 0 331 643 170 228 643

17 140 13 887 5 990 5 248 7 029 186 504 6 368 0 321 982 0 1 616 81 277 1 616

314 373 325 621 329 155 329 023 326 743 2 845 671 294 239 161 642 139 812 131 535 119 708 61 691 1 246 369 59 396 92 612 74 373 61 046 54 898 25 603 685 924 24 281 69 030 65 439 70 489 64 811 36 088 560 445 35 114 116 937 147 726 160 349 179 892 242 195 1 216 596 214 867 39 504 43 782 42 827 33 407 30 722 328 514 28 552 48 629 77 798 78 997 87 454 90 807 554 238 82 994 28 803 26 146 38 525 59 031 120 666 333 845 103 321 35 794 38 083 37 271 29 423 22 857 382 706 19 976 3 698 2 070 2 132 1 262 1 833 48 482 1 710

11 279 5 686 9 423 11 652 10122 144 757 8 498

Tabell IA: 1991. Makrotal för hushåll där hmhållsfönståndaren är 18—64 år. Löpande priser (mkr).

Decil efter disponibel inkomst per k.e.

] 2 3 4 5 Lön 8 123 27 080 39 312 49164 56 201 Företagsinkomst -1 096 2 383 1 522 1 309 1 912 Sjukpenning mm 693 3 036 3 791 4 094 4 408 Föräldrapenning 563 2 731 2 906 3 145 2 594 Arbetsmarknadsstöd 923 2 625 2 043 2 375 3 027 Övriga skattepliktiga inkomster 109 639 535 682 398 Pensionsprem ie 75 17 3 288 375 367 Avdrag för periodiskt understöd 1 0 1 28 0 Summa arbeuinkomst 9 240 38 322 49 820 60 366 68 173 Folkpension inkl pensionstillskott 301 1 813 2 339 2 388 1 305 ATP 260 1 341 2 108 2 919 1 786 Arbetsmarknads- och övriga enskilda pensioner 68 187 575 811 802 Summa pensioner 630 3 341 5 022 6 117 3 894 S.a arbets— och pens.ink 9 870 41 663 54 842 66 483 72 067 Ränteinkomster/utdelning 985 1 143 1 286 1 537 1 600 Ränteutgifter 1 496 3 851 5 460 6 724 7 260 Reavinst taximässigt 114 215 226 224 474 Reaförlust 22 30 25 58 98 Kapitalinkomst 1 099 1 357 1 511 1 761 2 074 Reavinst brutto 114 215 225 224 474 Barnbidrag ] 083 3 920 3 164 2 749 2 010 Underhållsbidrag 319 1 670 1 277 755 527 Bostadsbidrag 502 1 846 1 635 1 088 416 Socialbidrag 862 1 552 669 472 454 Studiemedel 1 880 1 843 1 799 1 096 1 038 Övriga positiva transfereringar 221 115 62 26 22 Summa positiva transfereringar 4 868 10 946 8 607 6 187 4 466 Slutlig skatt 2 773 10 052 13 490 16 831 18 702 varav skatt på förvärvsinkomst 2 627 10 514 14 329 17 928 19 861 Skatt på kapital 278 297 311 342 374 Skattered för underskott av kap 284 1 028 1 489 1 819 1 955 Fastighetsskatt 271 350 436 491 590 Förm ögenhetsskatt 6 7 10 6 17 Övrigt -125 -88 —106 -1 17 -184 simulerad skatt reavinst/reaförlust 53 105 58 56 127 Andra negaliva tramfe'nnngar 172 362 429 463 461 Disp.lnk. inkl. reavinst 12 892 43 552 51 041 57 137 59 444

Disp.ink. exkl. navins! 12 831 43 443 50 874 56 969 59 097

6 7 8 9 10 Summa P91-p99

62 335 70 231 77118 90 029 133 052 612 645 114 383 1 471 1 307 1 425 1 640 2 404 14 277 2 226 4 598 4 143 5 042 4 892 4 421 39 118 3 986 1 733 1 135 544 827 631 16 809 624 2 421 1 982 1 174 814 539 17 923 496 385 409 281 280 2 066 5 784 806 547 737 908 1 419 4178 9 067 3 485

6 3 20 8 86 153 16

72 391 78 467 84 655 97 055 138 850 697 339 119 021 1451 1608 1245 1404 1263 15117 1 196 2 020 3 011 2 353 2 930 2 361 21 089 2 271 931 1 579 1 648 2 640 4 872 14113 4 086

4 402 6 198 5 246 6 974 8 496 50 320 7 553 76 793 84 665 89 901 104 029 147 346 747 659 126 574 1773 2118 2 486 3 546 10172 26 646 6 369 7 433 7 890 8 074 10 419 18 768 77 375 15 268 768 829 1 091 1 995 25 616 31 552 6 845 75 150 146 159 1 510 2 273 862

2 541 2 943 3 571 5 513 35 738 58 108 13 166 768 825 1 085 1 968 25 566 31 464 6 797

1 477 999 612 433 480 16 927 423 337 273 209 133 40 5 540 32 326 176 77 88 26 6 180 26 317 105 186 68 20 4 705 20 779 625 320 194 81 9 655 75

21 28 12 1 0 508 0

3 258 2 206 1 416 916 647 43 517 577 20 715 23 290 25 447 30 695 58 558 220 553 43 637 21 722 24 293 26 309 31 502 51 362 220 447 42 823 465 514 635 1045 8 754 13 015 2 618

1 930 2 024 2 011 2 577 4 082 19 199 3 496 576 644 657 835 1 812 6 662 1 470 34 30 34 87 1 098 1 329 495 -152 —167 -176 -197 -385 -1 697 -273 193 256 319 609 7 336 9112 1 807 496 516 557 581 711 4 748 642

61 381 66 008 68 884 79 182 124 462 623 983 96 038 60 806 65 439 68 118 77 824 106 232 601 633 91 048

___—___—

Tabell IB: 1991. Makmtal för tillgångar/skulderi hushåll där hushållsföreståndaren är 18-64 år . nämnde priser (mkr). Decil efter disponibel inkomst per k.e.

I 2 3 4 5 Bankmedel privat 9 378 10 943 13 775 15 154 17 127 Övriga finansiella tillgångar 7 068 6 647 6 687 9 169 9 217 Privatskuldlexkl swdieskuld 12 514 34 767 47 112 59 756 59 567 Studieskuld 3 291 6 043 S 780 5 909 6 431 Eget hem/fritidshus tax. värde 1] 351 24 673 34 356 41 013 44 688 Eget hem/fritidshus marknadsvärde 23 226 51 278 70 967 85 857 92 782

Nettoförmögenhet exkl näring marknadsvärde 27 220 34 264 45 168 53 030 62 655 Nettoförmögenhet exkl näring taxeringsvärde 15 345 7 659 8 558 8 186 14 561

Tabell IC: 1991. Antal hushåll m.m. där hushållsföreståndann är 18—64 år .

Decil efter disponibel inkomst E" k.e.

] 2 3 4 5 Totalt antal k.e. 515 872 778 999 748 398 740 880 693 654 Antal hushåll 349 193 348 849 349 331 349 558 349 532 Fördela! efter familjetyp: Ensamstående utan bam 283 224 152 700 149 918 144 513 167 749 18—24 225 143 82 189 57 072 53 313 57. 156 25-44 36 863 44 240 45 891 46 735 69 649 45—64 21 218 26 271 46 955 44 465 40 944 Gifta/samboende utan barn 12 137 21 969 21 582 28 995 39 263 18-24 1 291 2 926 3 557 3 383 7 316 25—44 1 610 4 889 2 582 4 333 8 537 45-54 4 367 3 930 4 926 6 162 7 954 55—64 4869 10224 10517 15116 15456 Ensamstående med barn 20 003 62 949 61 748 37 679 16 011 Sammanboende med barn 33 829 111 231 116 083 138 371 126 509 1 barn 7 975 15 983 17 903 36 944 46 746 2 barn 10 791 40 782 56 264 76 058 67 058 2+ barn 15 063 54 465 41 916 25 369 12 704 Fördela! efter socioekonomisk grupp: Ej förvärvsarbetandei 220 009 86 080 79 151 57 694 30 327 studerande 150 105 29 128 24 524 7 112 1 942 pens. 18-64 år 6 621 35 341 45 599 41 556 17 397 - övr. ej förvarb. 63 283 21 611 9 028 9 026 10 988 Anställda: 88 134 229 154 251 044 278 657 304 313 Arbetarfamiljer 46 445 117 988 129 618 133 259 149 338 - ej facklärda 31 928 79 267 77 397 80 314 89 479 - facklärda 14 517 38 721 52 221 52 945 59 859 Tjänstemannafamiljer 16 450 54 735 74 224 101 954 105 952 - lägre 5 809 20 929 24 696 37 814 37 561 - mellan 9 445 26 885 38 689 48 467 52 253 högre 1 196 6 921 10 839 15 674 16138 Övriga anställda 25 239 56 431 47 202 43 444 49 023 Lantbrukare 11 078 12 947 5 118 3 693 4 129

E enföreta are 29 970 20 668 14 018 9 514 10 763

6 7 8 9 10 Summa P9I-p99

18 689 23 330 26 433 35 345 61 039 231 213 47 976 12 339 13 366 14 001 23 941 100 158 202 593 57 428 58 245 62 954 64 100 80 305 147 947 627 267 119 338 5 560 4 782 5 037 5 180 5 315 53 328 4 910 46 570 53 911 54 537 67 952 135 268 514 319 113 947 96 054 111 327 112 750 141 335 277 854 1 063 430 234 357 73 197 91 346 96 000 130 226 306 260 919 366 233 403 23 714 33 930 37 788 56 842 163 674 370 257 112 993 6 7 8 9 10 Summa P9I-p99

647 473 626 227 586 197 595 333 627 921 6 560 954 564 364 348 999 349 523 349 370 348 930 349 723 3 493 008 314 754 176371 159220 176138 147 513 110810 1668156 100 476 42 603 29 073 21 282 6 466 1 297 575 594 1 297 78 056 77 551 81 442 72 675 55 602 608 704 51 081 55 712 52 596 73 414 68 372 53 910 483 857 48 098 54 057 102 988 114 952 159132 195 618 750 693 174 665 5 485 11 627 7 746 4 837 967 49 135 967

8 955 25 282 30 769 42 916 38 848 168 721 35 718 16 172 22 241 37 385 53 720 79 884 236 741 70 358 23 444 43 838 39 052 57 659 75 919 296 094 67 623 15 030 8 429 6 479 2 576 1 626 232 530 1 626 103 541 78 886 51 801 39 709 41 669 841 629 37 987 52 913 51 259 35 267 25 569 27 022 317 581 24 630 42149 23 380 13 955 13175 12 709 356 321 12 066 8 479 4 247 2 579 964 1 939 167 725 1 291

___—__—

16 450 1 296 13 215 1 939

319 596 155 571 93 293 62 278 122 913 46 437 53 207 23 269 41 112

2 619 10 332

17 627 0

16 657 970

322 638 147 702 72 481 75 222 133 170 42 425 66 124 24 620 41 766

1 767 7 491

8 293 0

7 645 648

331 926 137 456 67 786 69 670 148 999 42 065 71 017 35 917 45 471

1339 7 812

7 686 0 7 686 0

332 969 110 278 52 601 57 677 179 088 34 423 94 352 50 314 43 603

841 7 434

8 384

0 7 099 1 285

329 916 34 632 15 950 18 682

253 733 32 445

111 285

110 003 41 551

1 333 10 090

531701 214107 198 816 118 778

2 788 347 1 162 287 660 496 501 792 1 191 218 324 604 571 724 294 891 434 842

44 864 128 092

7 099 0

6 456 643

297 122 33 766 15 307 18 459

226 818 31 157

100 510 95 151 36 538

1 333 9 201

Tabell IA: 1992. Makmtal för hushåll där hushållsföreståndaren är 18-64 år. Löpande priser

(mkr). Decil efter disponibel inkomst per k.e.

I 2 3 4 5 Lön 8 045 22 601 38 778 49 731 56 584 Företagsinkomst —2 185 2 186 1 381 1 472 904 Sjukpenning mm 540 1 843 2 365 2 419 2 483 Föräldrapenning 682 2 377 3 045 2 980 2 411 Arbetsmarknadsstöd ] 743 5 330 5 05] 5 719 5 426 Övriga skattepliktiga inkomster 110 524 602 641 628 Pensionsprem ie 52 1 1 4 248 384 339 Avdrag för periodiskt understöd 1 6 O 1 0 Summa arbetsinkomst 8 881 34 741 50 973 62 577 68 099 Folkpension inkl pensionstillskott 349 1 876 2 493 1 817 1 271 ATP 350 1 362 2 332 2 278 2 050 Arbetsmarknads- och övriga enskilda pensioner 100 194 391 610 1 041 Summa pensioner 799 3 432. 5 216 4 705 4 362 S.a albets- och pens.ink. 9 680 38 173 56 189 67 282 72 461 Ränteinkomster/uldelning 1 074 1 295 1 595 1 883 1 910 Ränteutgifter 2 013 3 719 6 482 7 396 7 697 Reavinst tax.mässigt 85 95 99 133 160 Reaförlust 268 32 63 120 81 Kapitalinkomst ] 165 1 402 1 706 2 028 2 078 Reavinst brutto 90 106 111 145 169 Barnbidrag 1 304 3 325 3 356 2 807 1 977 Underhållsbidrag 338 1 293 1 403 840 624 Bostadsbidrag 707 1 965 2 084 1 283 684 Socialbidrag 1 000 2 654 1 066 617 184 Studiemedel 2 127 2 209 2 184 1 356 1 266 Övriga positiva transfereringar 187 210 187 167 89 Summa positiva iransfereringar S 663 11 655 10 280 7 070 4 823 Slutlig skatt 2 905 9 220 13 540 17 002 18 636 varav skatt på förvärvsmkomst 2 771 9 473 14 425 18 025 19 773 Skatt på kapital 250 282 287 309 297 Skattered för underskott av kap 388 948 1 725 1 930 1 992 Fastighetsskatt 314 350 481 553 550 Förm ögenhetsskatt 19 9 24 36 18 Övrigt -61 55 49 8 -11 simulerad skatt reavinst/reaförlust 6 22 13 1 1 24 Andra negativa transfereringar 163 279 403 . 467 496 Disp. ink. inkl. reavinst 13 440 41 731 54 232 58 911 60 230

Disp. ink. exkl. reavinst 13 355 41 646 54 134 58 777 60 086

6 7 8 9 10 Summa P91-p99

64 384 71 472 79 549 93 578 139 073 623 795 119 835 1 025 1 134 1 426 1 546 3 699 12 588 2 758 2 082 3 285 3 433 3 522 3 217 25 189 2 961 1 724 1 744 932 804 650 17 349 583 5 009 3 541 3 261 2 276 1 088 38 444 1 023 377 375 428 463 2 093 6 241 463 491 580 840 1 266 3 461 7 775 2 832

1 4 4 0 103 120 61

74 108 80 967 88 185 100 923 146 256 715 710 124 730 1 057 1 128 1 607 1 50] 1 007 14 106 840 1 995 2 273 3 066 3 004 2 150 20 860 1 842 1 347 1 481 2 677 3 000 5 516 16 357 4 463 4 399 4 881 7 350 7 505 8 672 51 321 7 145 78 507 85 848 95 535 108 428 154 928 767 031 131 875 2304 2 833 3 230 4155 10 831 31 110 7 275 8 718 9180 9 609 11774 ]9 690 86 278 16 426 280 608 458 632 10 253 12 803 3 287 291 216 204 453 1 978 3 706 1 022

2 602 3 474 3 728 4 829 22 189 45 201 10 784 299 641 498 674 11 359 14 092 3 509

1 482 1 100 669 553 505 17 078 418 338 199 275 109 116 5 535 90 357 147 195 90 37 7 549 37 529 129 101 58 115 6 453 115

1 097 576 503 267 148 11 733 142 63 64 44 32 20 1 063 16

3 866 2 214 1 786 1 108 941 49 406 818 20 439 23 216 26 353 31 096 54 930 217 337 43 408 21 729 24 274 27 345 32 275 52 756 222 846 43 717 385 547 631 714 4 253 7 955 1 770

2 269 2 318 2 460 2 926 4 288 21 244 3 757 578 629 794 964 1 856 7 069 1 474 24 72 85 105 660 1 052 349

-8 13 -42 -36 -306 -339 —144

40 120 77 67 2 549 2 929 718

_ 60,8, 673 ' 597 . .” 583 . '.815 5084 . "702 63 928 67 647 74 099 82 686 122 313 639 217 99 367

63 670 67 126 73 678 82 079 113 504 628 055 96 576

Tabell 1B: 1992. Mala-otal för tillgångar/skulderl hushåll där hushållsföreståndaren är 18-64 år .

Löpande priser (mkr). Decil efter diseonibel inkomst E" k.e.

I 2 3 4 5 Bankmedel privat 9 440 12 969 14 086 15 970 16 757 Övriga finansiella tillgångar 10 401 6 174 6 725 10 383 9 201 Privatskuld exkl sdxdieskuld 17 445 27 845 48 605 54 796 56 003 Studieskuld 2 251 6 210 7 894 6 699 6 348 Eget hem/fritidshus tax. värde 17 062 27 483 38 685 44 142 41 889 Eget hem/fritidshus marknadsvärde 24 749 45 221 65 039 80 155 75 333

Nettoförmögenhet exkl näring marknadsvärde 27 975 36 212 37 646 52 840 47 583 Nettofönnögenhet exkl näring taxeringsvärde 15 050 14 110 6 131 14 238 11 162 ___—___—

Tabell IC: 1992. Antal hushåll m.m. där hushållsföreståndann är 18-64 år .

Decil efter disponibel inkomst !" k.e.

I 2 3 4 5 Totalt antal k,e. 536 091 730 715 774 878 742 219 680 398 Antal hushåll 352 023 351 920 352 451 353 185 352 782 Fördelat efter familjetyp; Ensamstående utan barn 285 726 178 165 136 114 151 066 173 725 18-24 230 545 93 577 54 092 59 346 56 762 25—44 34 839 48 729 47 611 58 782 74 500 45-64 20 342 35 858 34 410 32 938 42 463 Gifta/samboende utan barn 13 293 25 664 26 750 26 886 37 748 18—24 2 197 4 476 2 226 5 094 6 993 25-44 1 422 8147 7 161 4158 6 253 45-54 4 485 3 737 4 995 5 019 6 967 55—64 5 189 9 304 12 368 12 615 17 535 Ensamstående med barn 9 635 52 268 62 906 44 416 25 862 Sammanboende med barn 43 369 95 823 126 681 130 817 115 447 1 barn 11 832 16 307 23 392 30142 48 562 2 barn 14 454 28 805 59 351 76 049 54 926 2+ barn 17 083 50 710 43 938 24 627 11 958 Fördelat efter socioekonomisk gmpp: Ej förvårvsarbetande: 236 067 129 671 103 419 60 409 41 501 - studerande 165 382 38 241 29 139 7 673 6 900 - pens. 18—64 år 7 005 35 997 48 501 32 228 20 918 - övr. ej förvarb. 63 680 55 433 25 779 20 508 13 683 Anställda: 72 339 190 769 233 346 277 502 303 210 Arbetarfamiljer 35 704 86 746 113 129 135 633 150 287 - ej facklärda 29 433 55 449 69 593 83 324 87 669 - facklarda 6 271 31 297 43 535 52 309 62 618 Tjänstemannafamiljer 11 905 37 978 7.3 408 95 295 99 212 - lägre 5 187 14 793 18 778 35 101 32 212 - mellan 5 607 18 307 42 555 43 775 49 643 —högre 1110 4878 12075 16419 17 356 Övriga anställda 24 730 66 045 46 809 46 574 53 711 Lantbrukare 13 764 9 095 4 578 3 291 2 046

Egenföretagare 29 853 22 385 11 107 11 983 6 025

6 7 8 9 10 Summa P9lvp99

20 314 24 462 29 317 34 837 60 667 238 819 47 425 11 598 16 672 19 436 26 274 87 420 204 284 54 515 63 793 65 878 68 329 86 923 148 267 637 884 122 396 6 249 6 987 5 400 4 648 4 660 57 346 4 237 48 302 53107 62 021 76 313 129 352 538 356 110 742 87 114 94 789 111 696 140 900 232 377 957 373 199 603 58 862 74 223 99 081 125 112 247 373 806 907 191 839 16 466 27 117 43 681 56 793 126 917 331 665 92142 6 7 8 9 10 Summa P91-p99

654 877 628 284 618 506 607 077 629 636 6 602 681 566 752 352 583 352 526 352 367 352 446 352 711 3 524 994 317 370 178186 176 973 147 043 145 769 114 026 1 686 793 100 078 44 076 27 171 10 188 10 943 1 261 587 961 1 261 84 916 94 129 79105 69 318 51 851 643 780 45 906 49194 55 672 57 750 65 507 60 913 455 047 52 911 52 604 81 792 140 804 158 383 195 184 759 108 178 594 9 090 9 835 9 571 5 397 591 55 470 591

9 212 23 801 32 126 37 429 36 590 166 299 34 557 11 421 16 662 45 388 57 641 86 235 242 550 77 489 22 880 31 493 53 719 57 916 71 768 294 787 65 958 14 158 6 854 9 592 4 017 3 443 233 151 2 982 107 635 86 907 54 928 44 277 40 058 845 942 35 716 55 326 54 433 36131 30 343 25 859 332 327 24 299 45 091 26 169 15 962 12 797 11 920 345 524 10 056 7 218 6 305 2 835 1 138 2 279 168 091 1 360 33 486 20 530 18 222 12 427 8 628 664 360 7 855 3 325 1 243 0 266 533 252 702 533 14 440 11 105 15 052 11 404 7 562 204 212 6 789 15 721 8 182 3 170 757 533 207 446 533 310 936 322 573 325 651 333 280 334 261 2 703 867 300 866 143 669 140 232 127 539 106 499 38 258 1 077 696 37 401 84 278 76 682 74154 47 460 19 713 627 755 19 713 59 391 63 549 53 385 59 039 18 544 449 938 17 687 118 835 134 417 139 714 171901 263 609 1146 274 235 310 35 494 41 212 40 306 35 188 33 922 292 193 30 697 63 534 61 317 64 603 84 129 110 551 544 021 102 693 19 807 31 888 34 805 52 584 119137 310 059 101 920 48 432 47 924 58 398 54 880 32 394 479 897 28 155 2 014 1 717 1 334 626 658 39 123 658

6148 7706 7160 6112 9164 117643 7994

. ."..l ?" '|'! || "" . .'|.'.'".' —. ' ' 4" -"-U . . .'||-';. ... .|.......J.._..'|J......'_|| _ ||.|._,.. ....

I - ' ___ >.— , | A. _._ " '|”'|'|.l|-I'|_xi-". " "' _P'CÅ _ " _.' """:"_ _- ".E'

"sw ||| |" . .- .: | ,.. ,.....1.'||...._....._.-....__.. m-..—.___;u...

"_'.'f 'g—j|...|||.||||||||_' |.|.|-;_-|. |l||_||||- ||_-; —||—._ .'||. '|| '.'." -"'..:..'c|.|.a.| |||—|... |||... ' |||-. "| "” ' . " || _|. ..|""|| __:||'.:"| .'|-|-!|'|'.-||' u', '||'.| .. -'.j.: '.'...1 - :| .'|-» .':| .

| 'f' " " " ' | . . ' | '

.,- ' w . .”11. för .1 v . " ."—="' " ' "'|'! 1' - ""'fl| 'i'J'l'lliF- "' ' ' " EH" [' 9 ...-| | = '.-.. '|-' " .. ... l' I II "I '. I '|'] "$" ' .' .;-"' ', -' . ' '|'; := .L'x- ||. .||.” ." . |||._|||||. M. . .. | .|| , | "| - || |- : ':x'l " 1" . ._| ..-| | ' || | | . .. |||? "

'. ' _._-'...

'|"'|"'|||.|.._. ' ". l”. " "' f-..-"L - _._ -

| _»:|.

| |

'||._'.'|ig|___.'

||r1

| .'|" RJ?- rJ|| hyn. .».—

.. .||= . | hun. ”A""

|. || - —. LWI :.||||||| |||-|'||l|||| || | Malm Cl! | _ ”||| |.|--'|'-||a.--. '- |- ' men .||

'—'i.| T| l| ||| |||

4 ||_ | I. . . || |.|I|| "||| || [43% ||.| ._..'.- "'|'-u.? |_|||||| F.dEt' ||

'"|'"'""_.'__.|'.|' |||,||.|._|| .||.- . .. "'|"' "|..".U'-'|'| "'i' " "är": '-'."-*'$||.r=|'..|||!|1|äp tyr'n ||| |||-|||?!- "..-.-'..-'""|'"||;|.' 3.155 . '-.=.='-' .||'|.'.....'|'.|.. .|| || .. .=||||'1|-||'-.|"|'l:""-||||. j;?k'u I |||| (882580 bä,-"1105” i"; |'-".l"'.?.|| "T' är. Gå'llhnk' "'. .|||'|"L||. i.|' "'.71',| .. . '|"P-n'| "MÄN 'N'"! 'h'i .".h"1"'|'l|l- '.'Fttn'i- i.u -. WIF-”|E." ||. 't. th'M't' _l”? |'.r |; 'lld'luicnlrf|r|-k||||||_ |'4'u 5;- 'i' |.'"|'.'r_1*:-!" 58515 |81|1|*->1lb'|"|g

liv?- | GFF-d åt?-"n' '|")"||' "I'll-'||

nl|,_1|

11:

INDIVIDER 1 AKTIV ÅLDER (18-64 ÅR) EXKL. STUDERANDE

Decil efter arbets+pensionsinkomst

- makrotal i mkr - antal individer

Tabell ZA: 1989. Makmtal för individer i ålder 18-64 år (studerande är exkluderade). Löpande

priser (mkr). Deciler efter arbetsinkomst+pensionsinkamst

I 2 3 4 5 Lön 8 624 17 343 27 384 35 165 44 500 Företagsinkomst -144 1 870 2 455 1 730 1 460 Sjukpenning mm 873 2 186 4 145 5 317 5 396 Föräldrapenning 720 1 610 2 541 1 814 1 183 Arbetsmarknadutöd 362 1 026 1 575 2 041 1 759 Övriga skattepliktiga inkomster 91 157 392 301 318 Pensionspremier 576 651 765 806 67 5 A'vdrag för periodiskt understöd 30 40 40 51 70 Summa arbetsinkomst 9 919 23 502 37 688 45 510 53 872 Folkpension inkl pensionstillskott ] 480 4 589 1 527 1 310 873 ATP 373 1 974 2 068 2 731 1 983 Arbetsmarknads- och övriga enskilda pensioner 132 668 769 878 889 Summa pensioner ! 985 7 232 4 364 4 919 3 745 S:a arbets- och pens.ink. 11 904 30 734 42 052 50 429 57 617 Ränuinkomsten'utdelning 2 729 2 081 1 812 1 534 1 895 Ränteutgifter ' _ 1696 1442 2151 2706 3437 Reavinst taxmä'ssigt 2 348 1 063 630 705 1 079 Reaförlust 25 6 60 0 15 Kapitalinkomst 6 487 3 782 2 820 2 661 3 622 Reavinst brutto 3 757 1 701 1 008 1 128 1 727 Slutlig skatt 4 ”168 8 594 12 576 15 872 19 380 varav skatt på förvärvsinkomst 0 0 O 0 0 Skatt på kapital 0 0 0 0 0 Skattered för underskott av kap 0 0 0 0 0 Fastighetaskatt 213 1 12 160 154 146 Färm ögenhetsskatt 290 138 156 99 260 Övrigt 0 0 O 0 0 simulerad skatt reavinst/reaförlust ] 106 554 323 404 650 -_—_—_—_____

6 7 8 9 10 Summa P9I-p99

52 830 60 318 69 667 83 121 127 067 526 019 105 904 988 1 563 1 710 2 240 2 663 16 535 1 887

5 063 4 642 4 094 3 921 2 451 38 038 2 264 822 991 718 660 542 11 601 509 938 387 323 235 88 8 734 88 270 273 218 200 260 2 480 243 684 955 | 100 1 575 3 755 11 553 | 2" 883 92 89 138 150 25.0 _ 950 " 190

60 136 67 130 75 492 88 652 129 055 590 956 107 823 698 652 525 313 188 12 155 177

1 704 1 452 1 407 721 465 14 878 442 1218 1120 1176 1202 1713 9765 1311 3 619 3 124 3 108 2 236 2 366 36 798 1 931 63 755 70 354 78 600 90 888 131 421 627 754 109 754 1 975 1 953 2 194 3 027 s 329 24 534 3 927 4924 7971 ' 9160 12116 11769 66472 17924 643 689 673 1 385 5 082 14 297 2 649

l l 4 l 2 24 148 4

3 004 3 060 3 271 5 242 13 461 47 410 8166 1 029 1 102 1 077 2 215 8132 22 876 4 239 21 140 23 191 26.416 92.515 57 583 ' 111535 ; 44746 0 O O O 0 0 0

0 0 0 0 0 0 0

0 0 O 0 0 0 0

153 185 245 260 468 2 096 377 134 114 155 224 612 2182 355

0 0 0 0 0 0 O

359 424 438 960 3 788 9 006 1 932

Tabell ZB: 1989. Makmtal för lillgångar/skulder för individer i ålder 18-64 år (studerande är

exkludemde). Löpande priser (mkr). Deciler efter arbetsinkomsl+eensionsinkomst

I 2 3 4 5 Bankmedel privat 18 222 18 554 16 332 15 072 15 407 Övriga finansiella tillgångar 33 233 10 801 21 722 10 262 26 052 Privalskuld exkl studieskuld 37 823 28 848 41 734 41 755 42 532 Studiesktuld 4 705 4 159 4 295 3 496 3 941 Eget hem/fritidshus tax. värde 14 013 16 331 20 264 22 811 20 877 Eget hem/fritidshus marknadsvärde 35 612 41 248 50 621 56 964 51 891

Nettoförmögenhet exkl näring marknadsvärde 78 557 53 186 59 512 55 902 69 786 Netloförmögenhet exkl näring taxeringsvärde 44 754 25 533 24 980 16 708 32 560

Tabell ZC: 1989. Antal individeri ålder 18—64 år (studerande är exkludemde).

Deciler efter arbelsinkomst+pensionsinkom st

I 2 3 4 5 18-24 år 133 202 106 763 85 984 78 837 91 739 25—44 år 192 702 188 134 229 185 235 634 235 836 45-54 år 65 547 69 856 89 827 87 039 88 014 55—64 år 97 666 124 008 84 133 87 773 73 652 Antal personer 18 -64 489 117 488 760 489 129 489 283 489 241 Medelålder 37,6 40,1 39,2 39,6 38,4 Heltid 58 536 65 431 100 938 177 584 335 423 Lång deltid 40 550 173 331 278 378 228 079 102 728 Kort deltid 166 568 119 281 53 911 35 417 18 569 Övriga 223 463 130 717 55 903 48 203 32 522

___—___—

6 7 8 9 10 Summa P9I-p99

18 949 16 355 19 910 21741 31 873 192 415 24 226 15 291 17 963 21 909 33 784 110 787 301 804 68 486 52 023 65 809 76 288 96 454 191 250 674 516 145 296 4 923 4186 3 477 3 502 4 449 41 133 3 915 28 126 34 217 40 700 50 820 73 274 321 433 62 989 69 310 86 529 101 782 129 271 195 220 818 448 166 746 68 375 74 057 94 827 117 411 215 395 887 008 162 365 23 454 17 464 25 805 33 876 70 808 315 942 44 482 6 7 8 9 10 Summa P9! 1799

54 913 43 247 32 326 17 088 8 871 652 970 8 871 250 755 251 573 256 053 257 391 245 126 2 342 389 227 493 101 569 104 961 119 006 131 856 153 863 1 011 538 134104 81 949 89 491 81 811 82 927 81 300 884 710 69 620 489 186 489 272 489 196 489 262 489 160 4 891 606 440 089 40,7 41,2 42,0 42,9 44,1 40,6 43,8 379 514 418 601 431 681 457 425 468 415 2 893 548 421 200 77 469 51 023 38 543 24 632 16 685 1 031 418 15 011 10 788 7 471 8 509 3 088 1 387 424 989 1 204 21 414 12177 10 463 4117 2 674 541653 2 674

Tabell 2A: 1990. Makmtnl för individer i ålder 18-64 år (studerande år exkludemde). Löpande

priser (mkr). Deciler efter arbetsinkomst+pensiansinkOms!

I 2 3 4 5 Lön 9 609 19 053 30 274 41 657 50 548 Föremgsinkomst —1 854 2 291 2 170 1 119 1 453 Sjukpenning mm 1 087 2 864 4 975 5 300 5 598 Föräldrapenning 1 012 2 671 3 345 2 316 1 450 Arbetsmarknadsstöd 604 1 188 1 989 1 963 1 564 Övriga skattepliktiga inkomster 121 266 306 561 208 Pensionsprem ier 533— 610 614 606 650 Avdrag för periodiskt understöd 19 45 50 53 73 Summa arbetsinkomst 10 027 27 678 42 395 52 257 60 098 Folkpension inkl pensionstillskott 1 663 4 521 1 573 1 204 902 ATP 448 2 322 2 768 2 444 2 188 Arbetsmarknads- och övriga enskilda pensioner 162 495 ] 079 886 1 285 Summa pensioner 2 273 7 338 5 421 4 533 4 375 Summa arbets— och pensink. 12 300 35 016 47 816 56 790 64 473 Rinteinkoms'er/utdelning 3 196 2 084 1 952 1 743 1 936 Ränteuigmer ' 1985 1827 2413 3611 4482 Reavinst laxmässigt 6 691 645 560 822 871 Reaförlust 7 O 0 0 108 Kapitalinkomsl 13 902 3 115 2 848 3 058 3 330 Reavinst brutto 10 705 1 031 896 ] 315 1 394 Slutlig skatt 7 933 9 456 14 166 17 327 20 180 varav skatt på förvärvsinkomst 0 0 0 0 0 Skatt på kapital 0 0 0 0 0 Skattered för underskott av kap 0 0 0 O 0 Fastighetsskatt 437 161 183 168 223 Förmögenhcuskatl 600 38 69 50 55 Övrigt 0 O 0 0 0

Simulerad skatt reavinst/reaförlust 3 884 303 274 404 442

6 7 8 9 10 Summa P9I—p99 59190 69 539 79 716 92 372 139190 591148 115 541 1 122 946 2 368 2 061 4194 15 870 2 765 5 908 4 647 4 243 4 587 2 866 42 075 2 623 1 259 825 627 855 654 15 014 634 1 128 636 444 259 64 9 839 64 182 297 321 284 636 3 182 475 622 740 854 1262 3384 9875 2684 99 122 138 166 211 976 197

68 068 76 028 86 727 98 990 144 009 666 277 119 221 697 577 400 453 289 12 279 272

1 712 1 259 913 956 732 15 742 661 984 1 094 1 034 2 166 2 984 12 169 2 332

3 392 2 929 2 346 3 574 4 004 40 185 3 265 71 460 78 957 89 073 102 564 148 013 706 462 122 486 2 150 2 366 2 235 2 946 7 076 27 684 4 199 6362 7970 10710 13679 26301 79340 19960 1 249 763 537 599 4 833 17 570 2 983 54 3 0 0 0 172 0

4 149 3 587 3 094 3 904 14 809 55 796 8 972 1 998 1 221 859 958 7 733 28 110 4 772 22 678 25 314 29 231 35 806 64 595. _ 246 686 50 380 0 0 0 0 0 0 O

O O 0 0 0 O O

0 0 0 O O 0 0

207 304 305 382 633 3 003 525

38 42 52 70 645 1 659 307

0 0 O 0 0 0 0

752 441 331 385 3 221 10 437 1 996

___—___..—

Tabell 213: 1990. Makmtal för tillgångar/skulder för individer i ålder 18-64 år (studerande är exkluderade). Löpande priser (mkh.

Deciler efter arbetsinkom st+pensionsinkom st

I 2 3 4 5 Bankmedel privat 17 921 18 887 16 595 16 102 18 171 Övriga finansiella tillgångar 73 824 8 845 11 921 9 450 9 149 Privatskuld exkl swdieskuld 59 056 29 026 39 422 49 235 51 921 Studieskuld 5 084 4 114 4 050 3 892 3 843 Eget hem/fritidshus tax. värde 25 513 27 015 32 298 30 959 35 911 Eget hem/fritidshus marknadsvärde 48 296 51 273 61 206 59 165 68 238 Nettoförmögenhet exkl näring marknadsvärde 148 851 60 343 62 266 60 896 66 679 Nettoförmögenhet exkl näring taxeringsvärde 95 658 32 380 29 .1 26 19 519 24 232

Tabell 2C: 1990. Antal individeri ålder 18-64 år (studerande är exkluderade).

Deciler efter arbetsinkam st+pensiansinkom st

I 2 3 4 5 18-24 år 131 600 102 217 74137 90116 79 337 25-44 år 197 145 202 178 240 450 233 353 242 555 45-54 år 69 164 73 939 88 155 90 640 89 779 55-64 år 93 477 113 015 88 225 77 448 79 716 Antal personer 18 -64 491 386 491 349 490 967 491 557 491 387 Medelålder 37,5 39,7 39,5 38,6 39,2 Heltid 61 190 52 899 49 898 165 887 337 330 Lång deltid 57 053 211 169 338 290 256 130 104 044 Kort deltid 160 057 110 263 40 051 30 928 22 693

Övriga 213 086 117 018 62 727 38 611 27 319

6 7 8 9 10 Summa PSU-1799

18 857 20 194 19 613 23 296 34 863 204 499 28 679 10136 16074 16398 24417 114271 294485 49318 56 219 70 730 82 129 102 429 198 253 738420 146 791 3 455 5 223 4 554 4 760 4 611 43 586 4198 41 653 46 841 59 182 77 121 118147 494 640 101 233 79148 89 070 112 335 146196 223 698 938 625 191 779 68 455 85 185 93 377 123 975 238 488 1 008 515 174 264 27 056 32 233 31 488 45 482 107 653 444 827 63 258

6 7 8 9 10 Summa P9I-p99

55 654 44 427 27 846 14 405 4 563 624 302 3 920 246 971 246 696 259 483 252 832 234 111 2 355 774 216161 105 817 117 005 127 070 140 935 173 623 1076127 153 572 83 257 82 958 77 270 83 113 79 311 857 790 68 695 491 700 491 087 49] 668 491 285 491 608 4 913 994 442 349 40,5 41,3 41,8 43,0 44,9 40,6 44,6

386 213 423 128 443 848 444 079 460 292 2 824 764 413 516

75 779 50 570 36 533 36 411 21 407 1 187 386 19 789 13 889 9 914 5 339 5 753 5 993 404 880 5 127 15 819 7 475 5 948 5 043 3 917 496 963 3 917

Tabell ZA: 1991. Makmtal för individer i ålder 18-64 år (studerande år exkluderade). Löpande

priser (mkr). Deciler efter arbetsinkvmst+pensiansinlcomst

I 2 3 4 5 Lön 9 429 19 206 31 635 41 481 52 347 Företagsinkomst -884 1 909 1 716 1 609 1 328 Sjukpenning mm 952 2 331 4 631 4 970 5 093 Föräldrapenning 973 3 118 3 506 2 648 1 900 Arbeismarknadsstöd 1 293 1 841 2 470 3 704 2 967 Övriga skattepliktiga inkomster 177 308 414 512 556 Pcnsionspremier 331 4 419 514 555 591 Avdrag för periodiskt understöd 24 1 O 0 4 Summa arbetsinkomst 11 587 28 293 43 858 54 370 63 596 Folkpension inkl pensionstillskott ] 721 5 538 2 014 1 215 731 ATP 405 3 208 3 583 2 666 1 453 Arbelsmarknads— och övriga enskilda pensioner 189 726 696 1 058 1 240 Summa pensioner 2 316 9 473 6 293 4 939 3 423 S:a nr'bets- och pensink. 13 903 37 766 50 151 59 309 67 019 Rånteinkomster/uldelning 3 085 1 945 1 565 1 485 1 480 Ränteutgifter 2 327 2 557 2 917 3 690 4 690 Reavinst taxmässigt 8 697 1 508 1 535 1 099 891 Reaförlust 126 50 104 104 107 Kapitalinkomst 11 769 3 451 3 086 2 580 2 371 Reavinst brutto 8 684 1 506 1 522 1 095 891 Slutlig skaft - 6 799 9 255 12 669 15 140 17 365 varav skatt på förvärvsinkomst 3 354 8 558 12 322 15 167 17 805 Skatt på kapital 3 284 863 729 590 520 Skattered för underskott av kap 386 525 693 954 1 238 Fastighetsskat! 572 365 393 418 387 Förm ögcnhetsskatt 181 55 24 29 27 Övrigt —205 —62 -107 409 _135

Simulerad skatt reavinst/reaförlust 2 648 436 443 311 257

6 7 8 9 10 Summa P91-p99

61 436 71 450 80 860 95 443 147 666 610 953 120 286 978 1 259 1 554 1 955 2 990 14 414 2 456

4 618 4 640 4 467 4 227 3 505 39 434 3 351 1 012 1 039 918 920 725 16 759 709 2 005 1 354 850 579 218 17 281 192 308 454 312 540 1 854 5 435 873 587 910 875 1 142 3 240 9164 2 517

0 8 15 11 80 143 33

69 769 79 277 88 072 102 510 153 641 694 973 125 316 850 556 695 506 572 14 398 523

1 979 1290 1 614 1 021 1 152 18 371 1053 1544 1297 1794 1751 3 819 14114 3 024 4 373 3 143 4 102 3 277 5 543 46 882 4 600 74 142 82 420 92 174 105 787 159 184 741 855 129 916 1 710 2 077 2 250 2 743 6 165 24 505 4 678 6 865 8 623 10 408 13 065 21 924 77 066 18 328 1 123 2 445 1 881 2 644 9 420 31 243 4 389 39 124 224 229 1 172 2 279 498

2 833 4 521 4129 5 378 15 541 55 659 9 021 1 123 2 444 1 879 2 635 9 375 31 154 4 344 19 322 22 342 25156 31 553 59 511 219 112 45552 20 182 23 035 26 461 33 089 59 796 219 769 47 045 531 967 733 933 3 145 12 295 1 522

1 746 2 217 2 656 3 301 5 419 19135 4 471 475 691 713 960 1 597 6 571 1 282 36 87 96 88 676 1 299 381 —154 -221 —191 -216 -283 -1 683 -207 322 724 505 783 2 586 9 015 1 176

___—___.

Tabell 23: 1991. Makmtal för tillgångar/skulder för individer i ålder 18-64 år (studerande är exkluderade). Löpande priser (mkr).

Deciler efter arbets-inkom st+pensionsinkvm st

I 2 3 4 5 Bankmedel privat 17 049 17 860 16 542 16 447 16 789 Övriga finansiella tillgångar 21 076 10 099 9 539 8 874 8 923 Privatskuld exkl studieskuld 33 996 32 244 33 908 37 572 47 617 Studieskuld 5 250 4 126 4 161 4 353 4 429 Eget hem/fritidshus tax. värde 28 511 28 382 31 084 34 765 32 978 Eget hem/fritidshus marknadsvärde 59 158 59 404 64 605 72 655 68 531

Nettoförmögenhet exkl näring marknadsvärde 69 451 61 596 64 516 67 858 55 819 Nettoförmögenhet exkl näring taxeringsvärde 38 804 30 574 30 995 29 968 20 266

Tabell 20 1991. Antal individeri ålder 18-64 år (studerande år exkludelade). Deciler efter arbetsinkomst+eensiansinkomst

1 2 3 4 5 18-24 år 131 278 88145 82118 83 641 73 495 25-44 år 191 223 212 817 225 773 242 401 251 157 45—54 år 77 690 86 708 94 386 92 751 99 188 55—64 år 87 475 99 862 85 648 68 975 63 884 Antal personer 18 -64 487 667 487 532 487 925 487 768 487 723 Medelålder 37,5 39,7 39,2 38,6 38,7 Heltid 69 850 59 748 102 140 178 285 328 906 Lång deltid 52 848 175 977 277 960 225 138 114 249 Kort deltid 140 922 115 195 43 403 36 173 17 682

Övriga 224 046 136 612 64 421 48 171 26 886

___—___—

6 7 8 9 10 Summa P9I-p99

19 702 22 644 21 919 26 618 38 132 213 702 30 602 10 430 14 425 19 783 21 845 71 849 196 843 51 188 60 675 76 203 87 144 112 290 178 081 699 730 147 412 3 899 4 220 4 382 5 084 5 765 45 669 5 263 38 620 52 078 57 716 79 829 124 681 508 644 102 800 80 278 107 316 119 943 164 953 254 951 1 051 794 210 282 61 870 82 574 91 587 122 035 214 37] 891 677 169 376 20 212 27 336 29 360 36 911 84 101 348 527 61 894 6 7 8 9 10 Summa P9I-p99

44 699 40 062 19 030 13 136 1 939 577 543 1 618 244 595 240 053 251 447 247 015 223 005 2 329 486 205 231 108 836 126 545 136 328 143 836 180 806 1 147 074 159 538 89 364 81 122 80 495 84 290 82 061 823 176 72 565 487 494 487 783 487 300 488 277 487 812 4 877 281 438 952 40,9 41,5 42,5 43,2 45,0 40,7 44,8 378 607 414 198 433 810 450 260 457 820 2 873 624 413 317 68 447 47 804 34 636 26 280 17 925 1 041 264 15 174 17 467 16 527 8 288 6 992 5 453 408 102 4 810 22 972 9 253 10 566 4 744 6 615 554 286 5 650

Tabell ZA: 1992. Makmlal för individer i ålder 18-64 år (studerande är exkludemde). Löpande

priser (mkr). Deciler efter arbetsinkomst+penxionsinkomst

] 2 3 4 5 Lön 7 977 18 821 31 770 42 851 53 205 Företagsinkomst -2 015 2 042 2 071 977 1 148 Sjukpenning mm 642 1 896 2 697 3 124 2 869 Föräldrapenning 1 247 2 562 3 782 2 456 1 839 Arbetsmarknadsstöd 1 686 4 249 5 627 7 004 5 930 Övriga skattepliktiga inkomster 131 367 443 564 486 Pensionspremier 250 285 443 469 471 Avdrag för periodiskt understöd 5 O 2 5 18 Summa a|be|sinkomst 9 412 29 651 45 945 56 503 64 987 Folkpensicn inkl pensionstillskott ] 549 S 292 ] 781 1 138 879 ATP 475 3 103 3 433 2 487 2 221 Arbetsmarknads— och övriga enskilda pensioner 234 560 815 1 381 1 304 Summa pensioner 2 259 8 955 6 029 S 006 4 404 S:a arbets— och pens.ink. 11 671 38 606 51 974 61 509 69 391 Rånteinkomster/utdelning 2 668 1 749 1 981 1 696 2 064 Rånteutgifler 2 974 2 551 3 405 4 667 5 652 Reavinst tzxmässigt 568 585 364 463 419 Reaförlust 371 278 119 31 256 Kapitalinkomst 3 275 2 373 2 356 2 186 2 515 Reavinst brutto 607 624 375 490 451 Slutlig skatt 3 757 9 111 12 890 15 454 17 860 varav skatt förvärvsinkomst 3 025 8 761 12 665 15 704 18 371 Skatt på kapital 648 535 531 428 519 Skattered för underskott av kap 436 650 880 1 181 1 503 Fastighetsskatt 530 382 518 494 433 Fönnögenhetsskatt 94 49 82 37 33 Övrigt -103 34 -25 -28 7

simulerad skatt reavinst/reaförlust 115 106 73 131 93

6 7 8 9 10 Summa P9l-p99

63 109 72 729 83 240 97 527 15] 693 622 922 125 213 1 062 1 048 1 196 1 601 3 527 12 657 2 356 3 093 2 999 2 826 2 962 2 420 25 528 2 192 1 001 1 043 1 020 1 250 1 068 17 268 1 007 4 740 3 403 2 322 1 248 594 36 803 528 260 414 455 544 2 065 5 729 531 446 692 855 1 122 2 794 7 827 2 238

3 4 17 22 44 120 7

72 817 80 940 90 188 103 987 158 528 712 958 129 581 697 630 577 630 609 13 782 566

1 721 1 502 1 445 1 657 1 110 19154 929 1 402 1 415 2 027 2 644 5 003 16 785 3 642 3 820 3 546 4 048 4 931 6 723 49 721 5 137 76 637 84 486 94 236 108 918 165 251 762 679 134 718 2 068 2 347 3 223 3 847 7 363 29 006 6 089 7 679 9 604 11 411 14 541 23 333 85 817 19 399 497 907 985 1 613 6 263 12 664 3 442 131 255 229 478 1 560 3 708 1 146

2 575 3 313 4 268 S 546 14 524 42 93] 9 915 508 967 1 045 1 699 7 16] 13 927 3 827 19 780 22 073 25 234 31 091 59 154 216 404 45 731 20 771 23 352 26 568 32 771 60 536 222 524 47 451 393 494 674 740 2 353 7 315 1 544

1 963 2 470 2 900 3 587 5 587 21 157 4 754 546 629 786 1 027 1 671 7 016 1 337 45 53 82 150 418 1 043 269

—13 15 24 -10 -236 -335 -116 110 201 226 366 1 461 2 882 733

___—___—

Tabell 23: 1992. Makrotal för tillgångariskulder för individer i ålder 18-64 år (studerande är

exkluderade). Löpande priser (mkr). Deciler efter arbetsinkamst+Eensionsinkomst

I 2 3 4 5 Bankmedel privat 16 373 16 498 18 084 16 445 19 670 Övriga finansiella tillgångar 23 387 10 358 10 749 10 402 8 956 Privatskuld exkl swdieskuld 36 399 28 677 36 132 45 507 49 548 Studieskuld 5 165 5 139 4 190 5 220 4 560 Eget hem/fritidshus tax. värde 32 635 29 577 36 774 38 794 35 549 Eget hem/fritidshus marknadsvärde 53 660 50 260 64 781 68 275 63 258

Nettoförmögenhet exkl näring marknadsvärde 63 523 54 640 64 451 59 037 51 873 Nettofönnögenhet exkl näring taxeringsvärde 33 544 29 831 32 835 25 129 21 387

Tabell 2C: 1992. Antal individer i ålder 18-64 år (studerande år exkludemde).

Deciler efter arbetsinkom sl+pensionsinkamxt

] 2 3 4 5 18-24 år 116 062 97 732 95 366 84 916 64 091 25-44 år 207 868 198 962 230 962 243 807 249 572 45-54 år 78 778 84 616 84 130 92 218 98 598 55-64 år 86 894 107 786 79 385 68 974 77 253 Antal personer 18 -64 489 602 489 097 489 844 489 916 489 513 Medelålder 37,9 39,8 38,2 38,4 39,6 Heltid 61 602 57 370 102 554 164 46] 31] 369 Lång deltid 41 684 166 624 241 791 217 308 98 325 Kort deltid 128 846 105 623 61 449 43 552 33 503

Övriga 257 470 159 479 84 050 64 595 46 317

6 7 8 9 10 Summa P9l-p99

18 584 19 983 23 932 27 013 40 497 217 079 33 385 10 094 12 483 19 478 28 252 59 443 193 602 44 921 61 789 75 435 88 420 112 854 175 443 710 204 147 049 4 408 5 076 4 307 4 708 4 933 47 706 4 363 44 291 51 423 64 261 81 743 119 883 534 930 101 608 79 456 92 413 116 825 148 574 212 896 950 398 181 720 58 463 63 566 88 129 110 488 162 944 777 114 135 422 20 193 18 907 30 846 38 160 56 334 307 166 45 352

6 7 8 9 10 Summa P9I-p99

46 932 36 076 15 543 13 174 1 015 570 907 1 015

250 790 248 504 261 672 229 967 216 238 2 338 342 200 429 112113 123 326 128709 146869 188637 1137 994 165218 79 677 81 938 83 719 99 458 83 869 848 953 74 073

489 512 489 844 489 644 489 468 489 758 4 896198 440 736

40,4 41,2 42,3 44,0 45,4 40,7 45,2 365 610 395 510 413 478 429 525 448 395 2 750 374 404 719 70 779 55193 51 749 37 835 26 759 1 009 047 23 861 20 756 22 250 13 212 10 204 7 288 446 683 6 566

32 367 15 891 11 206 11 903 6 817 690 095 5 591

_' ' " "" ' . "' '_'1—1.11'i' 7' ... 1' "" kl.". _1-",""—!:..',"r" 1): 1 _'|1._'.'|1'1."|"'|.|1nt'."'!||| |'.-.1.|'|l','|".'|||"117|.|1'||'.;"_l. ||lj|'l|'l||,'i'. "'-'1'."' ';|';:i|'||l'-|1";#5l'åu iJJ|.,|..1l|.. . " "|'| |.|| "'i'-"" .'.. wi ..,. '.'..|l" . -."' ' £| » .. | 1 .. 1||., ||1|1. 1 '|| '| "'

"| .

-'|'.1'

' 'lmiGl'Å |). " " '1' ' ' " || .||

.|.||l . || _?1 |||.=|1|1.|| . | | . . . . ._ .....111- H...... ' _.,.'Z'.1,,,',l,_.- '.'.1|1|l. '.,3 " ;: 1:.|;1 -_ -_ ' 1..|.'.l11|*'.1""""."' _ || | 1 |ä||ll'1.1".1' .1|':_1..'|'|. .1.1||f1 " .H.." . "."' ' ,,._- 1'1-'""11' . ” ".." "."',"'1..'".'|'11:".' '1|1l".'."""' .'il.l'".'" . | _- .. ' ' "1" . ' ||| ' ...|.» 1 . . ||. |- " _ _ 1'r1-1111 "15.11 ',l'n " -""||||' " '.'.11'.1.1. .||"|".1|'..å1. .|"'|;.'|||11||||| |.|'| |. . ' y'. '11|'|'|L||, "='|'1l'" ' I'M!"

1 .11' "." l. 1”1l.. . . ||c '. . . -'| ,' 'i'llll'l'Ft'l'l' ' '. " . "' "F' 11 """"-"'|'"'-'.'" ,,'l,'." ' -'. *. ' ' ' . »"1.ru..1,, 214-"11.111! ' -' 'H"'|'|||1||:|"'l."1, ... hål.....g ...||'|".:"'|'.'.'..|1|'|"|'.!'_.1' | _ |11__. - | _- .'| '_'51' |'1

"" "-1.||||,1j "121 ' ' " "" " " '.' .| ." | ' .L' ..._

1l1lll'”l _|111l';.|b" l"|'|l '|""l'l .'|. -| 'l'""'

. .,".|. ., .. ...11'1'1'" ""

'" .. ..1

'|.| 'L, "J"" '11," ".|,|"1,'.-"1-)

., |.. .. 1 _; .1 1. | . - ': .. '1 » '. .1|-|'| 11'111". 1- 1 | ,. 1.1 ,,.- .-. |1'1 ..'1'.||.' | . .'f,.-'1 _. '— . . -' 1'" | | |.|.| |.|. .__ . |'_' J ;; ,'-. .l'i. '||'.,'"|.1|.' .1| ' _.",,|-_.'.|',|.'._ ... , ' '. " %7 "HJT" "' ,|1| ,|-|11|_ | . 1 1 . _ . - _ Ph | ”få" |

| 2'" ||

' "..

1 . '...|1'i ""-|'1- ." - - ',.1- ' - " ', .'.,1'. . . . ..'.'11..'_'.' . .".'|'.'.1' """" ' 1" ”' 1 . . . _ 'L, . || "|.||11|.' |.11' 14. | | | |... |. . ||. |||| || ., | | . || _ .. .» » ....1. , .. 131-..' Hi...—..-| :.-j __','._'._-. ..::..l-u. .1-1.|"'-.'.1;|H|

. ||| . ||? | r | . ...' .. [

_ _ ' " "'|'l || "|| 1|." _' 1|'|" * '. '

.,', .. '— ' ,",.'1,.1 . '.'"1 . " ' . ' ." '., ..1' |.. | '...1 "" ||| '11. | | ,1 |'|. ..1|. _1.' || 1' ...?-[i. _|!|'||'.' || . | ' . -. |||_| JI11

"...111.,'.11',,'.'|""... _ | ||1| . | | ||| ||| || |1 | | | |'|; | . |11| ' "' " " "" 1'-""'|'1l|' ' '|' ' ._.- 't' 11"'|-1l'| | ' * " 1 1 ,. || ". , ' ,' ' || 1 . _ . |.| ||| _ | ' '||'|1|'|_'||J|."'.'|.'! | """” .' .||. ' . ||| |||... ". ,- '. :|..rl'... '_'|||l|r" "' ”HES." 'h1':|'|'-T..||F|lu || ' | | | 'l,',:,'." .. .."." Pl.!”"l. " . ..

..,,' . ...| -.'j|'..-"l.'l- L.,, |:": || .. ;. .-| |.. |||. ||_ '.'.ll |

'_'" " ] 1....1 'll'"- ' "' "-' ' ' $.... |E;

» "..'.': _ || 1'|'|1||||' |..-. . , »' . .1|.-|.|,|1|'1., ...|._,,.. ." '='""ii-'1 " ' | .'. . "..1 '- '31 .,,,|," '

. _ ..'|,'.4'r. ,.1.|:|.-.11.n

. lj' "|'||.' '|' " ' "|.."1"""|:'""||.||' run. " ,. :l" "" ' .'.1,'|1,'. " " """""' "1"""""q""-" "i'll"? '

. | I . " _4 _" 'I '. ,- , .'.- ,,||'_" .. _ '. 11 —_, 1, '7 1:1||"".'”.,|',...||| .| — .' ' 1..|.1||||||. .. -* ...'|.'|_|.-| ,' "|'1..|—'|'||_..- _ ||.."1,"|'|."|:|||1|| l . || .|'r"_- ',,1' .|£||'| ,_' ,1-1|' -_";,,_'_' 11-.|1"1".... ,| . , | | | .|, _.,_.|| | |. | ,|_ ..1 ..1|N1'11.| | ||_ | , _ ' '» 1'. , ' . _",,'| "|-|' |" |',1""'"'."|"1|. |. | | '. ., -._' _.1'r||1

. '_1, "'-"" . .. '. ..."" '|Q"iT".'.'. ll |11||||| |

HI:

PENSIONÄRSHUSHÅLL (65- ÅR)

- makrotal — antal - typfall (mer detaljerade uppgifter)

Tabell SA: Makmtal för pensionärshushåll (hushållsföreståndann 65- år). Löpande

priser (mkr).

1989 1990 1991 1992 Lön 6 858 9 912 10 726 9 729 Företagsinkomst 1 837 2 328 1 415 1 232 Sjukpenning mm 1 095 865 895 844 Föräldrapenning 2 23 0 1 Arbetsmarknadsstöd 209 121 162 278 Övriga skattepliktiga inkomster 114 228 167 263 Pensionspremie 907 694 361 417 Avdrag för periodiskt understöd 107 52 6 54 Summa arbetsinkomst 9 100 12 731 12 999 11 877 Folkpension inkl pensionstillskott 39 434 41 519 47 838 49 875 ATP 53 186 55 935 64 694 73 901 Arbetsmarknads- och övriga enskilda pensioner 19 842 19 645 24 064 26 502 Summa pensioner 112 462 117 098 136 597 150 278 Summa arbets— och pensionsinkomst 121 562 129 819 149 596 162 155 Ränteinkomster/utdelning 12 889 15 616 15 053 17 109 Ränteutgifter 4 198 4 351 4 434 5 354 Reavinst tax.mässigt S 078 2 537 3 792 3 021 Reaförlust 78 0 443 272 Kapitalinkomst 21 014 19 674 18 830 20 362 Reavinst brutto 8 125 4 058 3 776 3 253 Barnbidrag 6 9 12 16 Underhållsbidrag 15 8 0 6 Bostadsbidrag 3 788 4 387 6 066 5 461 Socialbidrag 347 214 137 420 Studiem edel & 19 4 8 Övriga positiva transfereringar O O 0 0 Summa positiva transfereringar 4 162 4 637 6 219 S 911 Slutlig skall 43 114 43 130 42 588 46 269 varav skatt på förvärvsinkomst O 0 36 467 39 995 Skatt på kapital 0 0 4 981 5 225 Skattered för underskott av kap 0 0 747 955 Fastighetsskatt 388 495 1 385 1 595 Förmögenhetsskatt 890 342 638 523 Övrigt 0 0 -137 »] 15 simulerad skatt reavinst/reaförlust 3 397 ] 495 1 104 82] Andra negativa transfereringar 109 55 7 16 Disp. ink. inkl. reavinst 103 515 110 955 132 050 142 143 Disp.ink. exkl. reavinst 98 787 108 392 129 377 139 711

Tabell 313: Makrotal för rillgångariskulder i pensionärshushåll (hushållsföreståndaren 65- år).

Löpande priser (mkr)

1989 1990 1991 1992 Bankmedel privat 133 442 138 490 159 563 175 603 Övriga finansiella tillgångar 52 142 56 982 70 420 69 948 Privatskuld exkl studieskuld 33 590 33 022 35 442 37 778 Studioskuld 0 38 43 16 Eget hem/fritidshus tax.värde 69 611 89 215 97 116 118 205 Eget hem/fritidshus marknadsvärde 179 659 169 337 202 215 207 313 Nettoförmögenhet exkl näring marknadsvärde 356 479 365 676 413 411 432 905 Nettofönnögenhet exkl näring taxeringsvärde 241 923 276 213 308 312 325 968 Tabell 30 Antal hmhåll m.m. där hushållsfönståndanen år 65— år

1989 1990 199! 1992 Totalt antal k.e. 1 577 754 1 543 095 1 637 163 1 651 697 Antal hushåll: Ensamstående 654 133 674 223 730 935 711 581 Sammanboende 433 848 402 920 410 394 429 309 Ålder-sammansättning, antal personer:

—64 92 987 88 716 87 144 92 946 65—74 864 073 812 974 783 684 836 891 75- 566 376 581 384 682 724 642 994 Totalt antal 1 523 436 1 483 074 ] 553 552 1 572 831

___—___—

298 Pensionärshushåll Appendix bilaga 4 4. Tabell: Spridning i pensionäremas disponibla inkomst per k.e. 1989 och 1992.

1989

Disponibel inkomst per k.e. 1989

Löpande priser, tkr

40,5 40,5-60] 60,7-81,081,0—101,2 101,2-

Dito ifasta priser (1992 års priser), tkr Pensionärskategori -50 50-75 75-100 100-125 125- Genomsnitt Median QI

Per k.e., kr (löpande pris): 62701 54 097 47 453 65 961 72 491 58 623 48 978 74 863 53 559 51 109 46 524 55 817 68 827 64 411 52 396 80 051 73 358 67 548 55 815 82 752 57 281 52 148 46 764 62 186 66 111 61 687 51 032 77 902

Antal pensionärer: Ensamstående 48 739 412 282 131 943 36 282 24 887 65-74 24 004 144 852 101 066 24 941 21 027 75- 24 735 267 430 30 877 11 340 3 860 Sammanboende 14 975 344 105 309 254 93 699 58 988 65-74 5 352 193 870 249 208 83 416 57 785 75- 9 623 150 236 60 047 10 283 1 202 Samtliga pensionärer 63 714 756 387 441 197 129 980 83 875

1992 Disponibel inkomst per k.e. 1992 Löpande priser, tkr Pensionärskategari »50 50-75 75-100 100—125 125- Genomsnitt Median QI

Per k.e., kr (löpande pris): 76 836 72 382 60 091 91 017 85 851 77 708 64110 98 872 69 792 64 923 57 604 75 077 94 986 88 588 70 674 110 486 102 024 92 556 74 369 114 287 78 946 69 310 58 202 85 906 86 476 84 604 67 183 107 298

Antal pensionärer: Ensamstående 59 137 374 784 180 801 57 130 39 729 65-74 22 890 113 710 101 981 42 679 30 856 75— 36 247 261 073 78 820 14 451 8 873 Sammanboende 16 294 259 201 291 438 141 047 98 113 65-74 5 656 130 082 222 480 118 238 83 797 75- 10638 129119 68958 22 809 14316 Samtliga pensionärer 75 431 633 985 472 239 198 177 137 841

”Urin.” "me" ' Ph :; i;." |'- :.J';": Hull. ."'.'.* ;'-".*..; l_l ldi' ' ' il;| ' ' ,. .l . _l " I ' -w m- "'i' ”_'" ' ' l"' '|'-. ; _ ; | .;;;';;; ;;i_;; .; .; _';.. ; . ' _. ; __;'.l_l.l;..._ ; ;. ir . - '. ;. lyn. . " _ r ' _ ”"iwlll _ | 61 . .L . |,F|.;| |*; ". u _ 'H _ '5;J; ";-”t;H. ; | F (1- ;_;.;. '. .;q m—FN'IIIH ; ; ; ' _"i LT. =!;*'|'**'|- ;_'. . _ ;... '.;i;.; .;- —;;.-;;';";';."_';|;';; __ "' ...'. nilzlsiiiileltumlnwuiui . - . ;;.__ ;;;.;._..l'|-i.fll |...i _ ;; ; __ _ ;..; |--| ..1... '.llll " c:.; -_ ' " "' ;= » .' » .; .;;._' | ;;; ' .ii' ' Hull 1"H' .. '.; ;' ' " _ ' ;' . ..f': .;_. '. "1.1 1" " "'i' ii.-li. ' ' "i 'I "I" "' -lw-' 'i";l'.ll'l.."l-._._';-;' ;; '.' 1"-| .|.* |* I " '. .'+.i'*”1 ' ; ' =; J'."' |' ;';'.;;;;_ ;; - '. "- " ' 'i ' .' " -'i ..." ;.;;.. '.'"i. .; ;;' .' ' . www.iw map.;- .- —. , ..' i _ . .'1.'i'."ka'*'.il liv;-" ”' ._J'l'.l. _ u; _ '; " ; ;' .' |..; = ...| » ' ' ' Il J'I alllll L..-H...! IM; '|| |' ' ___ . I ' ._;';. ';'N ; .; I i' _; ' I ; I ' _;;'_ ;ir'"";' ;1 _ ;.- .; _lhljrln ;. |... HJ..'.,'|;"; _; ;' ;; " ._ * ; _ _ '*'*;;'*;i; ;. _.' .; ; l'J'.I' hi "Wf'" --'r än . ;- _ -; _. '.'. '; ' ?i ' _|_,__.;...,;| _.r ;. |'. ;.;. |_1_..—,|—.i,y.;; ; " c'lii.i.'|.|.' " ;;**' |). |l"' _ , _ _. . _ . ' ' .'. Dil-”_' '. r-'.;"..'i:'|'1 :l'... ; .;;', " '. l- .. ., . .. H .; ;; - ; ;;”; ;__|'A' ' l _; l

tsm-- .' ni.-..'. _ ... mix-. ' |'|-...nu. lir-irl - ii.._'.1_'.- .. '._i . .i;_;.i;l'l._li.|; ;;;'. iiii'...- .b".".l'il |'| nu ett"

1'.l' -_

IQHW

midim-uälldW—e ""-','mlt'd. _...niiii r..—niin imanen—..... '.'.

ii'."..T'll'.'| i,.i l,-';' ..... .'

1791 .--.--.-1i-r. .. imi

..Hril lull". '.'iL'iI' ...' ', *i.* *;' ';'.'_.-r|;r.1LL.|-.'J.ii g|_.|1_' , 'ful”; .;..;. ' 'i'

Effekter av skatte- och bidragsförändringar för ett antal pensionärshushåll 1989-1992

Förutsättningar

Total-KPI, förändring.

Används vid uppräkning av ränteinkomster, lön samt inkomst efter skatt. 1989 - 1992 + 23.5%

1990 -1992 + 11.9%

1991 -1992 + 22%

KPI rensat för bostadspasten, förändring. Används vid uppräkning av disponibel inkomst efter betald hyra. 1989 - 1992 + 15.4%

1990 - 1992 + 60%

1991 - 1992 + 0.05%

Basbeloppet, förändring. Används vid uppräkning av pensioner. 1989 -1990 + 6.45%

1990 -1991 + 84%

1991 -1992 + 4.66%

KPIför hyreslägenheter, förändring Används vid uppräkning av hyrorna. 1989 1990 + 14.4%

1990 - 1991 + 26.2%

1991 — 1992 + 8.9%

1989 - 1992 + 57.2%

Hushållen antas bo i hyresrätt med genomsnittlig hyra för en tvårums- lägenhet.

KBT beräknas i samtliga fall enligt de regler som är vanligast före- kommande i kommunerna och som ger maximalt statligt bidrag till kom-

munen.

Viktiga regeländringar för pensionärerna i typexemplen nedan 1990-1992

1990: - Pensionstillskottet höjs från 48 till 50 procent av basbeloppet. - Övre hyresgränsen för KBT till ensamstående höjs från 1500 kr till 1700 kr. - Arbetsinkomst reducerar inte längre pensionäremas extra avdrag. - Statliga skattens grundbelopp sänks

1991: - Pensionstillskottet höjs från 50 till 54 procent av basbeloppet. - Statliga skatten sänks. Skatteskalan består av endast två steg. Margi- nalskatten begränsas till 50 procent vid 30 procents kommunalskatt. - Särskilt avdrag för pensionärer slopas. I stället införs ett särskilt grundavdrag för pensionärer. En spärr införs som gör att avdraget inte kan bli lägre än en icke-pensionärs. Kapitalinkomster över 1600 kronor reducerar grundavdraget liksom förmögenhet. - Schablonavdraget höjs från 3000 kr till 4000 kr. - Kapitalinkomster beskattas separat med 30%. Tidigare lades räntein- komster på toppen av alla andra inkomster och beskattades mot den progressiva skatteskalan. - Sparavdraget på 1600 kr (som drogs från inkomst av kapital) slopas. - Övre hyresgränsen för KBT höjs från 1700 till 1900 kronor för ensamstående. - Arbetsinkomster från aktiv näringsverksamhet skall inte längre reducera KBT (gällde redan tidigare för arbetsinkomst från anställ- ning). Reduktionen höjs från 33 1/3 till 35 procent av KBT—årsinkom- sten.

- Ett särskilt KBT införs som garanterar pensionärer att inte hamna under gränsen för vad som anses var skälig levnadsnivå.

1992: - KBT höjs inte 1992. Övre hyresgränsen för en ensamstående ligger kvar på 1900 kronor. Ett tillkommande särskilt KBT kan dock innebära en höjning av bostadstillägget.

1992 genomförs en hel del regeländringar. De flesta berör hushåll med eget hem, ränteutgifter och andra kapitalinkomster än bankmedel dvs. förhållanden som inte föreligger i typfallsberäkningarna.

Resultat

1. A Folkpensionärutan ATP.

1989

Löp pris Fast” Pension 40 176 Arbetsinkomst/aktiv närverks. 0 Ränteinkomst 0 Grundavdrag 10 000 Extra avdrag 30 100 Slutlig skatt O Ink. efter skatt 40 176 49 617 N ORMAL HYRA Hyra/mån 1 900 + KBT 18 000 Disponibel inkomst 35 376 40 818 HÖG HYRA Hyra/mån 3 000 + KBT 18 000 Disponibel inkomst

1990

Låp 43 362 0

0

10 000 33 300

43 362

2 175 19 440 36 702

3 430 19 440

Fas!

48 522

38 886

1991

Löp 48 300 0

0

48 300

48 300

2 740 21 932 37 352

4 330 34 052

Fax!

49 363

37 369

1992 Diff. (92-89) Lop 50 550

2 980 24 302 39 092

4 715 38 342

22 176 25 588 21 642 22 930 30 392 30 406 32 312

F av!

+ 933

-1 726

+6714

] Löpande pm omräknat till 1992 års varde KBT+ev. särskild KBT

1. B Folkpensionär utan ATP med länteinkomst

1989

Låp pris Fast” Pension 40 176 Arbetsinkomst/aktiv närverks. O Ränteinkomst 5 000 Grundavdrag 10 000 Extra avdrag 27 900 Slutlig skatt 2 120 Ink. efter skatt 43 056 53 174 N ORMAL HYRA Hyra/mån 1 900 + KBT 17 500

37 756 43 565

Disponibel inkomst HÖG HYRA Hyra/mån 3 000 + KBT 17 500

Disponibel inkomst

1990

Löp 43 362 0

5 520 10 000 30 700 2 310

46 571 2 175

18 854 39 326

3 430 18 854

Fast

52 114

41 666

1991

Löp 48 300 0

6 040 45 400

2 811 51 529 2 740

21 134 39 783

4 330 30 823

Fart

52 663

39 801

1992 Diff. (92-89) Löp 50 550 0

6175 47 600

2 852

53 874

2 980

22 909 41 023

4715 35 019

24 556 28 334 24 266 25 710 30 392 30 406 32 313

F as!

+ 700

-2 542

+3 979

Löpande pris omräknat till 1992 års värde

2 A. Kvinan pensionär med genomsnittlig pension. Nom1al hyra.

1989 1990 1991 Läp pris Fart” Läp Fast Låp Fast Läp WWW—sw—

Arbetsinkomst/aktiv närverks. O 0 0 O Ränteinkomst O 0 0 O Gfundavdrag 10 000 10 000 36 500 38 200 Extra avdrag 18 500 21 300 - - Slutlig skatt 10 575 10 300 9 369 9 803 Ink. efter skatt 47 025 58 076 51 020 57 091 57 101 58 357 59 757 Hyra/mån 1 900 2 175 2 740 2 980 + KBT 12 524 13 787 15 831 17 337 Disponibel inkomst 36 749 42 403 38 707 41 010 40 052 40 070 41 334

1992 Diff. (92-89)

Fast

+1681

-1 069

Löpande pris ommknat till 1992 års mde ” Folkpension 26 784 + Pensionstillskott 0 + ATP 30 816 = 57 600

2 B. Kvinnlig pensionär med genomsnittlig pension och ränteinkomst 1990

1989

Löp pris Fast” Pension 57 600 Arbetsinkomst/aktiv närverks. 0 Rånteinkomst 6000 Grundavdrag 10 000 Extra avdrag 15 500 Slutlig skatt 13 235 Ink. efter skatt 50 365 62 201 Hyra/mån ] 900 + KBT 11 524

Disponibel inkomst

Låp 61 320 0

6 620 10 000 18 000 13 122

54 818

2175 12 684

39 089 45 103 41 402

Fast

61 341

43 866

1991 Läp Fast Lop 66 470 69 560 0 O 7 250 7 410 32 800 34 400 12 691 13 204 61 029 62 372 63 766 2 740 2 980 14 561 16 039 42 710 42 730 44 045

1992 Diff. (92-89)

Fast

+1 565

-1 058

Löpande pris omräknat till 1992 år: värde

2 C Kvirmlig pensionär med genomsnittlig pension, ränteinkomst och arbetsinkomst.

1989 1990 1991 1992 Dyf.(92-89)

Löp pris Fast" Löp Fast Löp Fast Läp Fas! Pension 57 600 61 320 66 470 69 560 Arbetsinkomst/aktiv närverks. 50 000 55 180 60 390 61 750 Ränteinkomst 6000 6 620 7 250 7 410 Grundavdrag 10 000 10 000 35 400 37 000 Extra avdrag 0 16 500 - - Schablonavdrag 3 000 3 000 4 000 4 000 Slutlig skatt 38 370 32 294 29 067 30 316

Ink. efter skatt 75 230 92 909 90 825 101 633 105 043 107 354 108 404 +15 495 Hyra/mån 1 900 2 175 2 740 2 980 + KBT 0 0 14 561 16 039

Disponibel inkomst 52 430 60 496 64 725 68 577 86 724 86 764 88 683 +28 187

Löpande pri: omräknat till 1992 än varde

3 A. Manlig pensionär med genomsnittlig pension.

1989

Läp pris Fast" Pension 96 200 Arbetsinkomst/aktiv nätverks. 0 Ränteinkomst O Grundavdrag 10 000 Extra avdrag 400 Slutlig skatt 32 286 Ink. efter skatt 63 914 78 934 Hyra/mån 1 900 + KBT 0 Disponibel inkomst 41 114 47 439

1990 1991 Låp Fas! Låp Fart 102 400 111 010 0 0 0 0 10 000 17 200 2 600 - 31 668 29 178 70 732 79 149 81 832 83 632 2 175 2 740 94 242 44 726 47 387 49 194 49 216

1992 Diff.(92-89 Lop 116180 0

0 18 000

30 511 85 669 2 980

1 020 50 929

Fas

+6 73!

+3 49t

Löpande pris omräknat till 1992 års värde

3 B. Manlig pensionär med genomsnittlig pension och ränteinkomst.

1989

Låp pris Fast” Pension 96 200 Arbetsinkomst/aktiv närverks. 0 Ränteinkomst 6 000 Grundavdrag 10 000 Extra avdrag 0 Slutlig skatt 34 592 Ink. efter skatt 67 608 83 496 Hyra/mån 1 900 + KBT 0 Disponibel inkomst 44 808 51 702

1990 [991

Läp Far! Läp Fast 102 400 111 010 0 O 6 620 7 250 10 000 17 200 1 000 - 34 374 31 353

74 646 83 529 86 907 88 819 2 175 2 740 0 0 48 545 51 434 54 027 54 052

1992 Diff. (92-89, Lop 116180 0

7410 18 000

32 734 90 856 2 980

0 55 096

F ar

+7 361:

+3 394

Löpande pm omräknat till 1992 års värde

3 C Manlig pensionär med genomsnittlig pension, ränteinkomst och arbetsinkomst.

1989

Läp pris Fast" Pension 96 200 Arbetsinkomst/aktiv närverks. 50 000 Ränteinkomst 6 000 Grundavdrag 10 000 Extra avdrag 0 Schablonavdrag 3 000 Slutlig skatt 56 902 Ink. efter skatt 95 298 117 693 Hyra/mån 1 900 + KBT O Disponibel inkomst 72 498 83 652

1990 1991

Låp Fart Läp Fast 102 400 111 010 55 180 60 390 6 620 7 250 10 000 11 600 0 _ 3 000 4 000 57 240 50 271

106 959 119 687 128 379 131 203 2 175 2 740 0 0

80 859 85 671 95 499 95 543

1992 Diff. (92.39)

Lop 116180 61 750

7 410 12 300 4 000 52 419

132 921 2 980

0 97 161

Fast

+15 228

+13 509

, Löpande pris omräknat till 1992 år! värde

4 A. Pensionär med maximal ATP.

1989 1990

Låp pris Fast” Löp Fast Pension 135 594 144 342 Arbetsinkomst/aktiv närverks. O 0 Ränteinkomst 0 0 Grundavdrag 10 000 10 000 Extra avdrag 0 0 Slutlig skatt 51 335 49 913 Ink. efter skatt 84 259 104 060 94 429 105 666 Hyra/mån 1 900 2 175 + KBT O 0 Disponibel inkomst 61 459 70 914 68 329 72 395

199! Löp Fas! Lop 156 492 163 782 0 0 O 0 12 700 13 300 44 647 46 724 111 845 114 306 117 058 2 740 2 980 0 0 78 965 79 001 81 298

1992 Diff.(92-89)

Fast

+12 998

+10 384

Löpande pris omräknat till 1992 års värde

4 B. Pensionär med maximal ATP och ränteinkomst.

1989 1990

Lop pris Fast'J Lop Fast Pension 135 594 144 342 Arbetsinkomst/aktiv närverks. O O Ränteinkomst 8 000 8 830 Grundavdrag 10 000 10 000 Extra avdrag 0 0 Slutlig skatt 54 413 53 061 Ink. efter skatt 89 181 110 139 100 111 112 024 Hyra/mån 1 900 2 175 + KBT 0 O Disponibel inkomst 66 381 76 593 74 011 78 415

1991 Låp Fas! Läp 156 492 163 782 0 0 9 660 9 880 12 700 13 300 47 545 49 688 118 607 121 216 123 974 2 740 2 930 0 0 85 727 85 766 88 214

1992 Dif/'.(92-89)

Fast

+13 835

+11 621

Löpande pris omräknat till 1992 års värde

4 C. Pensionär med maximal ATP, ränteinkomst och arbetsinkomst.

1989 1990

Löp pris Fast” Läp Fast Pension 135 594 144 342 Arbetsinkomst/aktiv närverks. 100 000 110 370 Ränteinkomst 8 000 8 830 Grundavdrag 10 000 10 000 Extra avdrag 0 0 Schablonavdrag 3 000 3 000 Slutlig skatt 117 193 118 119 lnk. efter skatt 126 401 156 105 145 423 162 728 Hyra/mån 1 900 2 175 + KBT 0 0 Disponibel inkomst 103 601

1991 Löp Fast Låp 156 492 163 782 120 790 123 500 9 660 9 880 10 300 10 700 4 000 4 000 102 577 104 719 184 365 188 421 192 443 2 740 2 980 0 O

119 540 119 323 126 423 151 485 151 554 156 683

1992 Dif.(92-89)

Fast

+36 338

+37 143

Löpande pris omräknat till 1992 års varde

| '||? TI ” | | PT |||1|1|Wz|||| : . ' |l|x.|. .|_|'|lj _ '. |||; '" 'a' -.".".'.l""" . ...|-. 'i . || ...|.....'.'. "'"-'- ""- ' |."" ."'-|... ...som. ' ' ||.|". ' ".""...|'..'.'.'|"""'"". ' . "|' ;mt-|.||||.',1|-P- .::. | ': '

"..""'" |||||. .- |||.|'| .|| ..

..| ||. '..|.,.|. .. '|"t.' '

"|'|-W |'| |E»'»»'»'| "' ..Wl'. "'i||',;..'--Et"""i.,'." ' . mm - "H't-l' amma-mn

"|"||,I| . .|'. '.'|' || ' .. i. " 1'|' : . ' '|'I" "' | 'Iqj garn-ul -' 'I'H H|'|' *"tié'. " "| | '1".|" |'|".' ...|| ."'-'.”' | |'|” »; .. gm, || .. .. ...i. m.m., .| |"|".' | | "..|".|." '- " " ' " målare.-"wmwm ipn-fram nu». ...|...- nie'w .. . Munn-.|' |'||||.|||||||||| |...|| .. ||".|| |:: .- |: |' || |' '|"|||| | ||

..-|||| '|.'.'| ..'-'.'.'||"'. '. ' "- || .. - ..

.'|-|.| .' & .l','..|. 'l_:'g_.F'. "" ,l'T|| - i., .|_. -

| |.| _... | |"|"L| '.|| ." || '_.' |_ . ' '| | ' ...; . '|| .]..|| |.||'" ';'|"'11|'| '"""."1ll'| "Ean:” .. . u " " ' ||] damm |”me " . ' |'—-. || "låg"" '||. "ii'gii'l" "nME-v || ' mr.-mur ' |

|"|'|.' " ' '||- || |..|'|,|'| '|'-||"-.|.'"| mph. '-..'Ml'.|' | |.. ..' '.. a.m.; nu " . "'."|. '.| |'|'|'-." |"' ' |. *." '| .'. " 1" '. || | Mm..-|||! '? .'. M mun—| w |.|' in" ., ""In.l . - M ...—m, -'

' il'| | | | | . ||| ||'"'.|' ||. . ".'.-|'| mål-| -"-'1£'|-.|n||' |--||||| |s||"| mm .l.-i'm fun-rm. min |inv- - -.- '||—namn. »: -"- .'1' ' ". . '...""." '|..|»'»|'..| - -|.|',|"-"'.E |...|| | ' '|'-||"! ".w; |—|'1l' | ' ' om": ..... || || . ||| ||.| ||. | .. . . | | | R I|||| || | || " ' ' Munin-'||. 'un'- ||||- '..'||

”i;? '| ... men? blr-'n |.' ; . _. -|| nm.-'m- mn ||_ _ | | 'äut'lll. " ." '.M Q" " milf 'mtli |1 lr'i W T"|.l. :| .-' .'- | . |. | av min.-mu

"" .'.j". "||'"'.|'. 'R' ' |'|. w.. ma Wi |.'-www.. "' "|.|'-|." "T'" |.|'e |.|'1.|'er||'"' ' 'na roc »» Iliian ”mm um usd-MMS:

|||—:| ||||| |||"? .. m gumman-.f- |||"? ..

u .".".:i" '.'-|'1, 'ne'-|.. .men. inom [w.—||| mar-ibm m.m iommi un mum-anim '|| | |.| |'| ||| |A | |

||| ,. * mmm: '... ' m. .- m :, -.um- | 5.1 .- aims-.- um- |"|. '|| " |'|5i ".. '| |. 'n .|'|' '|| |. . från 4- || ' " ' ' |.|;n [a.intwimwuummmm Min-»Wm

Bilaga 5

Fördelningseffekter av skattereformen

Rapport till KUSK

av Bengt Eklind, Joakim Hussénius och Rolf Johansson

Bengt Eklind, Joakim Hussénius och Rolf Johansson är anställda vid Finansdepartementet där de arbetar med fördelningspolitiska studier och effektberäkningar av olika slag.

Innehåll 1 Inledning

2 Metod 2.1 Två separata beräkningar 2.2 Basbreddningar 2.3 Att mäta inkomst Redovisningsgrupper

3 Resultat 3.1 Utfallet för olika befolkningsgrupper Decilindelning efter ekonomisk standard Hur tolka disponibel inkomst per konsumtionsenhet? Decilindelning efter bruttoinkomst Socioekonomiska grupper Hushållstyp Boendeform Region Ålder Förmögenhet

3.2 Den övergripande inkomstfördelningen 3.3 Fördjupad analys Känslighetsberäkning för några basbreddningar Känslighetsberäkning dynamiska effekter Alternativ decilindelning

4 Sammanfattande kommentarer

APPENDIX Basbreddningar Förändringar av vissa viktigare basbreddningar Några problem vid basbreddning Basbreddningar och budgeteffekter

309

310 310 312 313 315

316 316 316 318 319 320 321 323 323 324 325 326 327 327 331 332

333

335 335 336 337 338

1 Inledning'

Skattereformen 1990/91 innebar omfattande sänkningar av marginalskattesatserna. Det betyder att höginkomsttagare skulle ha fått de största skattesänkningarna om enbart förändringar i skatte- skalan hade gjorts. Avsikten var emellertid att ettfördelnings- mässigt godtagbart resultat skulle erhållas. Därför finansierades reformen på ett sådant sätt att höginkomsttagare inte skulle gynnas framför andra grupper. Detta innebar bl.a. en utvidgad och likformig beskattning av förmåner, minskat värde av de tidigare så omfattande kapitalavdragen, ökad beskattning av pensionsfonder m.m.. Vidare gjordes fördelningspolitiskt motiverade komplett- eringar i transfereringssystemet, bl.a. i form av ökade barn— och bostadsbidrag.

I samband med skattereformens genomförande gjordes omfattande beräkningar och analyser av dess fördelningseffekter såväl inom som utanför Finansdepartementet. Detta gäller såväl det ursprung- liga förslaget från utredningen om reformerad inkomstbeskattning (RINK) som den slutliga propositionen Reformerad inkomst- och företagsbeskattning (prop 1989/90:110). Resultaten av de flesta beräkningar var förhållandevis samstämmiga. Skattereformen skulle gå att genomföra med godtagbara fördelningseffekter.

Avsikten med denna studie är att med nya data så långt som möjligt upprepa de beräkningar av fördelningseffekter som genomfördes av Finansdepartementet och som finns redovisade i de olika reformpropositionema.

' Förutom författarna har till denna rapport ett antal andra personer bidragit. Ylva Andersson vid Finansdepartementet har utfört omfattande beräkningar, Leif Johansson och Kjell Jansson vid SCB har lämnat goda råd och utfört bakgrundsberäkningar. För eventuella fel och brister svarar dock enbart författarna.

2 Metod

Det finns flera tänkbara metoder för att utvärdera skattereformens utfall ur fördelningssynvinkel. En metod är att bedöma vilka förändringar som inträffat i den faktiska inkomstfördelningen sedan 1989 och därefter försöka avgöra vilka och hur stor del av dessa som direkt kan hänföras till regeländringar, till hushållens an- passning till de nya förutsättningama samt slutligen bedöma vilka förändringar som kan antas vara långsiktigt bestående. Sådana bedömningar kan t.ex. utgå från jämförelser mellan årliga under- sökningar av hushållens inkomstförhållanden. En annan metod är att mäta skatternas och bidragens omfördelande egenskaper före och efter skattereformen. En tredje metod är att i mera detalj studera fördelningseffekterna av de regeländringar som genomför- des genom skattereforrnen. Denna metod används här. Den ställer stora krav på detaljerade uppgifter och kunskaper om skatte- och bidragssystemen.

I denna studie simuleras regeleffektema av skattereformen på ett likartat sätt som i skattepropositionen och jämförs med de be- räkningar som redovisas i denna. Beräkningarna är i huvudsak statiska, dvs. de beaktar ej de eventuella beteendeförändringar som kan inträffa. Avsikten är att renodla skattereformens effekter så att de inte skall sammanblandas med alla andra regeländringar och förändringar som genomförts eller inträffat samtidigt eller därefter. Beräkningarna är teoretiska i den meningen att de endast omfattar de förslag som finns redovisade i de olika reforrnpropositionema.

Ingen metod kan ensam ge fullständigt svar på reformens för- delningseffekter. Val av ansats, använda data, antaganden, definitioner och mätmetoder osv. påverkar i hög grad resultaten. Analysema i denna rapport skall således ses som ett komplement till andra studier.

Beräkningarna är utförda med hjälp av den mikrosimulerings- modell som Statistiska centralbyrån (SCB) utarbetat i samarbete med regeringskansliet. De är baserade på statistiska uppgifter för de ca 10 000 hushåll som ingåri stickprovsurvalet för SCBs årliga inkomstfördelningsundersökning (HINK). I denna modell efter- bildas gällande skatte- och bidragsregler. För varje individ och hushåll i databasen görs individuella beräkningar av skatt och bidrag så att en disponibel inkomst för vart och ett av de 10 000

hushållen kan beräknas. Man kan säga att ett omfattande bok- föringsschema utförs för varje individ och hushåll. Resultaten räknas därefter upp till att avse hela befolkningen. Genom att ändra i gällande skatte- och bidragssystem kan såväl fördelnings- effekter som påverkan på den offentliga budgeten av olika regeländringar beräknas. I beräkningarna beaktas inte de eventuella förändringar i individernas beteende t.ex. vad gäller arbete och sparande som reformen kan ge upphov till.

Beräkningarna i propositionen baserades på ett statistiskt material avseende de hushåll som ingick i 1987 års HINK. Detta var det mest aktuella material som fanns att tillgå våren 1990, då be- räkningen gjordes. Som illustreras i figur 1 skrevs samtliga uppgifter i undersökningen fram till att avse 1991 års ekonomiska miljö. Därefter beräknades en disponibel inkomst för varje hushåll med både 1989 års regelsystem (fortsättningsvis kallat "gamla regler”) och de som föreslogs i de olika reformpropositionerna ("nya regler”).

Figur 1. Material för beräkningari skattepmpositionen

Beräkningar: 1. Gamla regler 2. Nya regler

lnkomstär 1989 IFE-.m- 1992

I de förnyade beräkningar som redovisas i denna rapport har statistiska material baserade på SCBs HINK dels för år 1989, dels för år 1992 kunnat användas (figur 2). Nu finns alltså statistiskt material för åren både före och efter skattereformen att tillgå. Därmed bortfaller den osäkerhet som framskrivningen av materialet i skattepropositionsberäkningen medförde. För respektive år har den disponibla inkomsten beräknats med gamla respektive nya regler.

Figur 2. Material för nya beräkningar redovisade i denna rapport

Beräkningar: 1. Gamla regler 2. Nya regler

Beräkningar: 1. Gamla regler 2. Nya regler

lnkomstår ___-mamm-

Två separata i tiden åtskilda material har alltså använts som underlag för beräkningarna. Mellan dessa år har inkomster m.m. förändrats vilket bör påverka resultaten. Metoden att använda två separata material för beräkningarna ger viss information om hur känsliga resultaten är avseende olika är och inkomstförhållanden.

I såväl beräkningarna i prop. 1989/90:110 som de här redovisade används som ((nya regler” de som föreslogs i de olika reformpro- positionema och som skulle gälla när skattereformen var fullt genomförd. Detta betyder att det finns en del avvikelser i jämförel- se med de faktiska regler som slutligen gällde för år 1991. I en de] fall beaktas regeländringar som skulle införas senare. Exempel på detta är att 1,5 % fastighetskatt har använts i stället för de 1,2 %, som gällde övergångsvis för år 1991. Ett annat exempel är barnbidraget som har satts till 10 020 kr i stället för 9 000 kr år 1991. Å andra sidan har senare beslutade regeländringar ej beaktats.

Skattereformens krav på beskattningsmässig likformighet och finansiering innebar att vissa inkomster blev skattepliktiga eller beskattades hårdare än tidigare. Detta brukar man uttrycka som att skattebasema breddades, basbreddning.

Närjämförande beräkningar skall göras mellan de gamla och nya reglerna är basbreddningama en mycket viktig aspekt. För varje individ i stickprovsmaterialet gäller det att lyfta fram de under de gamla reglerna ”dolda” skattefria inkomsterna. När sedan de gamla reglerna tillämpas, ökas den disponibla inkomsten fullt ut med dessa dolda, skattefria inkomster. Med de nya reglerna kommer de däremot att beskattas. För att få en fördelningsmässigt korrekt beräkning av reformen gäller det att försöka identifiera hur varje individ berörs av ett stort antal basbreddningar (se Appen- dix). Felaktigheter uppkommer både om basbreddningama fördelas ut på för många individer och om motsatsen inträffar.

Beroende på den information som finns tillgänglig kan en bas- breddning tekniskt utföras på olika sätt. När uppgifter redan finns i datamaterialet, som t.ex. beträffande bilförmån, behöver de nya reglerna bara appliceras på de gamla värdena för att beräkna storleken på en ny bilfömiån. I vissa fall finns emellertid inga uppgifter att tillgå. Man kan då vara tvungen att söka ett "näst bästa” kriterium för hur basbreddningen rimligen slår. Detta kan ske med ett fast belopp eller proportionellt mot någon lämplig variabel, t.ex. lönen. I vissa fall har det bedömts som lämpligt att beloppen dessutom riktas mot vissa grupper.

Basbreddningarna i de förnyade beräkningarna skiljer sig på en rad punkter från de tidigare beräkningarna i samband med skattepropo- sitionen. Anledningen är främst att andra och säkrare uppgifter nu finns tillgängliga. Skillnader kan också bero på att basbreddningens storlek nu enligt senare information bedöms annorlunda än vid arbetet med skattepropositionen.

Skillnader orsakas också av att basbreddningama skiljer sig beroende på olikheter i den ekonomiska miljön. Vi har nämligen låtit skillnaderna i ekonomiska förhållanden för åren 1989 och 1992 slå igenom i beräkningarna. Därigenom kan man få en uppfattning om vilken betydelse detta har för beräkningsresultaten. Det tydligaste exemplet är den skärpta reavinstbeskattningen på aktier. Basbreddningen i 1989 års material är betydligt större än för 1992 då aktievärdena var mycket lägre.

SCB har innehållsmässigt utvidgat 1989 och 1992 års HINK i syfte att erhålla ett basmaterial för utvärdering av skattereformen. Det statistiska urvalet gjordes också större och mer tillförlitligt än vad som är normalt. Detta gäller särskilt beträffande antalet personer med högre inkomster. SCB har dessutom genomfört ett omfattande grundarbete när det gäller det statistiska materialets detaljerings- grad som väsentligt förbättrat möjligheterna till beräkningar.

Basbreddningamas tekniska utförande behandlas utförligare i Appendix.

Ekonomisk standard bestäms i första hand av hushållets och inte av den enskilde individens inkomster. Beräkningarna i denna rapport avser därför storleken på den förändring av hushållens disponibla inkomst, dvs. inkomst efter skatt och bidrag, som

uppkommit genom skattereformen. Resultaten redovisas genom- gående som förändring av den disponibla inkomsten efter avdrag för boendekostnader och med hänsyn tagen till ökade momsut- gifter. Boendekostnaderna beaktas därför att skattereformen medförde ökade utgifter på detta område.

I tabellredovisningen finns två huvudbegrepp nämligen bruttoin- komst och disponibel inkomst. Bruttoinkomsten beräknas som summan av lön, näringsinkomst, inflationskorrigerad inkomst av kapital, reala långsiktiga realisationsvinster, 3 % av förmögenheten i eget hem samt positiva transfereringar (t.ex. barnbidrag och bostadsbidrag) innan skatten betalats. Disponibel inkomst är defi- nierad som bruttoinkomst minus skatt. Som nämnts tidigare beräk- nas en disponibel inkomst med hänsynstagande till boendeutgifter och ökade momsutgifter. Det är skillnaden i detta senare inkomst- begrepp som redovisas i tabellerna.

För att på ett adekvat sätt jämföra hushåll av olika storlek har den disponibla inkomsten justerats med en så kallad ekvivalensskala. Den disponibla inkomsten för varje hushåll har dividerats med antalet konsumtionsenheter. En ensamstående vuxen har därvid vikten 1,16, ett gift/sammanboende par 1,92. Vikten är 0,56 för varje barn 0-3 år, 0,66 för barn 4-10 år samt 0,76 för äldre barn. Detta viktsystem används av Socialstyrelsen vid fastställande av den vägledande socialbidragsnormen.

Liksom i propositionen beräknas kapitalinkomsterna realt. De reala kapitalinkomsterna beräknas som 40 % av följande poster:

ränteinkomster - andra ränteutgifter än boenderäntor + andra kapitalinkomster + långsiktiga realisationsvinster

samt 75 % av aktieutdelningarna.

I skattepropositionen ansågs enbart 33 % samt 66 % av aktieut- delningarna vara reala. Ett högre realränteantagande (4 %) än tidigare används nu. Denna förändring har dock ingen annan betydelse än att hushållen får en något annorlunda inkomst- klassificering än i propositionsberäkningarna. Detta eftersom det är den nominella och ej den reala avkastningen som beskattas.

Beräkningarna av långsiktiga realisationsvinster på aktier baseras på en bedömning av bl.a. den långsiktiga värdestegringen och den

takt med vilken olika aktier omsätts. Dessa beräkningar kopplas till aktieförmögenheten för de enskilda åren (se vidare Appendix). Aktieförmögenheterna varierar kraftigt från år till år. Detta har fått påverka beräkningarna då de avspeglar den faktiska ekonomiska situationen. Således kommer basbreddningen från reavinster av aktier att variera mellan olika år. För aktier var börsvärdet 1992 lågt jämfört med 1989.

En viktig beräkningsförutsättning vid införandet av basbreddning är här, liksom vid propositionsberäkningen, att arbetsgivarnas arbetskraftskostnader förutsätts vara konstanta. Basbreddningarna under inkomst av tjänst medför bl.a. ökat underlag för arbetsgivar- avgifter. De höjda arbetsgivaravgifterna antas bäras av de anställda i form av en omedelbar löneminskning. Avkastningsskatten på pensionsfonder och särskild löneskatt på pensionspremier antas också belasta löneutrymmet enligt samma princip.

Redovisningsgrupper

Hushållen har i tabellredovisningen indelats efter olika klassifice- ringsgrunder som nivån på disponibel inkomst per konsumtionsen- het, nivån på bruttoinkomst per konsumtionenhet, socioekonomisk grupp, familjens sammansättning m.m.. För de olika indelnings- grunderna redovisas resultaten som procentuell förändring av disponibel inkomst per konsumtionsenhet.

Redovisade resultat avser hushåll i åldern 20-64 år och där ingen av de ingående personerna har folkpension eller delpension. Klassificering efter socioekonomisk grupp, och hushållets ålder sker efter förhållanden för den så kallade hushållsföreståndaren. Denna är den person i hushållet som har högst förvärvsinkomst (arbetsinkomster och arbetsrelaterade transfereringar som pensioner och sjukpenning). Klassificeringama följer den standard som används av SCB vid redovisning av resultat från inkomstför- delningsundersökningarna.

3 Resultat

Som konstaterats i andra beräkningar och som även syns i våra resultat var skattereformen underfinansierad. Storleksordningen på den erhållna underfinansieringen i hushållssektom överensstämmer med beräkningar baserade på andra material genomförda inom Finansdepartementet (se Anders Kristoffersson "Was the tax reform fully frnanced”). I de följande tabellerna kommer detta att medföra att hushållen genomsnittligt erhåller en ökning av den disponibla inkomsten.

De stora posterna som påverkat resultaten ur fördelningssynpunkt jämfört med de tidigare beräkningarna är minskad basbreddning på aktier, minskad avkastningsskatt för pensionsfonder, minskad basbreddning avseende uthyrning av privatbostad och den särskilda löneskatten för pensionspremier. Flertalet av dessa poster berör inkomsttagare med höga inkomster i större utsträckning än andra inkomsttagare. Även inkomstskattema har blivit lägre än förväntat.

I detta avsnitt redovisas den procentuella förändringen av hus- hållens disponibla inkomst när vi jämför gamla och nya regler. Materialet redovisas efter olika grupperingar, där kanske decilgrup— pering och socioekonomisk grupp tillhör de mest intressanta.

] proposition 1989/90:110 redovisas resultat för den sammantagna skattereformen. För att möjliggörajämförelser med de ursprungliga reformberäkningama återges dessa resultat i kolumn 2 i de olika tabellerna. Dessa siffror avser skattepropositionens kalkyler där en dynamisk effekt på 1 % antagits. 1 kolumn 3 redovisas resultat av skattereformens regeländringar tillämpade på 1989 års datamaterial och i kolumn 4 resultat av beräkningarna med utgångspunkt från 1992 års material.

Decilindelning efter ekonomisk standard

l tabell 1 har hushållen delats in i olika decilgrupper efter ekono- misk standard, disponibel inkomst per konsumtionsenhet. En sådan indelning innebär att materialet delas in i 10 stycken lika stora grupper. I den första decilen ingår hushållen med lägst disponibel inkomst per konsumtionsenhet, i den andra de med näst lägst inkomst osv.

I tabellen redovisas de genomsnittliga förändringarna av disponibel inkomst minskad med utgifter för boende. Läsaren bör betänka att skillnaderna inom olika decilgrupper kan vara stora. I tabellerna finns också en uppgift om hushållets sysselsättningsgrad. Den är beräknad som summan av de i hushållet ingående personernas sysselsättningsgrad. Om båda makarna arbetar heltid så är sysselsättningsgraden 100 för hushållet. Arbetar däremot båda halvtid så är sysselsättningsgraden 50.

Tabell ]. Förändring av real disponibel inkomst genom skattereformen i deciler efter ekonomisk standard (20-64 år). Procent

Decil Enligt Nya beräkningar Sysselsättningsgrad proposition

1989 års 1992 års 1989 års 1992 års material material material material (1) (2) (3) (4)

1 0,0 0,1 0,6 50 41 2 1,8 2,8 2,3 70 59 3 2,5 3,0 2,9 78 67 4 2,8 2,8 2,4 85 78 5 2,7 3,0 3,5 89 82 6 2,9 3,5 3,4 91 86 7 3,6 4,2 3,5 94 89 8 4,2 4,9 4,2 94 91 9 3,8 4,3 3,9 94 93 10 0,2 2,7 3,4 96 95 Samtliga 2,5 3,4 3,3 84 78

De nya beräkningarna av skattereformens effekter för olika inkomstklasser ger en ganska likartad bild som den som redovisa- des i prop. 1989/90:110. Eftersom reformen var underfinansierad erhålls positiva procentuella förändringar i genomsnitt. Enligt alla tre beräkningar (kolumner 2-4) medför reformen ett något gynn- sammare utfall för de övre decilgrupperna jämfört med de undre. Allra störst förbättring får decilgrupp 8. För decilgrupp 10 ger dock de nya beräkningarna klart bättre utfall än vad som redovisa- des i propositionen, nämligen 2,7 % respektive 3,4 % jämfört med 0,2 %. De nya beräkningarna tyder alltså på att skattereformens utfall för den högsta decilgruppen underskattades vid propositions- beräkningen. Som diskuteras längre fram i rapporten beror detta bl.a. på nya antaganden om basbreddningama samt utebliven bas- breddning i kapitalinkomstbeskattningen.

För decilgrupp 1 med den lägsta disponibla inkomsten per konsumtionsenhet medför reformen en oförändrad eller svagt negativ disponibel inkomst. Denna grupp är emellertid mycket heterogen till sin sammansättning. Som framgår av de i tabell 1 redovisade sysselsättningsgradema ingår många hushåll som har låg arbetstid t.ex. till följd av studier, vämpliktstjänstgöring, företagare med nystartad verksamhet m.m.. En stor del av dessa hushåll befinner sig där tillfälligt.

Vissa skillnader i resultat finns mellan 1989 och 1992 års material. Av tabellen framgår att sysselsättningsgraden är lägre 1992 än 1989, och särskilt för de lägsta decilerna. Detta tolkar vi som ett utslag av den sämre konjunktursituationen med följande högre arbetslöshet som rådde 1992. En annan förklaring till skillnaderna mellan de olika materialen är förmodligen att aktieförmögenheten var betydligt högre 1989 än 1992. Allt annat lika bör detta i beräkningarna medföra att hushåll med stora aktieinnehav påverkas starkare av basbreddningama när beräkningarna görs på 1989 års material.

Hur tolka disponibel inkomst per konsumtionsenhet?

Begreppet disponibel inkomst per konsumtionsenhet är inte helt trivialt att tolka i förhållande till lönebegrepp m.m.. Som en tolkningshjälp kan därför tabell 2 användas. I denna redovisas, utan korrigering för konsumtionsenheter, bruttoinkomst och disponibel inkomst för några olika familjetyper som ingår i respektive decilgrupp (decilgruppering enligt tabell 1). Dessutom finns en kolumn där det procentuella antalet är angivet för respektive hushållstyp. Se även figur 4 nedan samt avsnittet "alternativ decilindelning”.

Tabell 2. Genomsnittlig bruttoinkomst och disponibel inkomst förnågra olika hushållstyper (1992 års priser)

Ensamstående Sammanboende Sammanboende utan barn utan barn med två bam Decil Brutto- Disponibel Pro- Brutto- Disponibel Pro- Brutto- Disponibel Pro-

inkomst inkomst cent inkomst inkomst cent inkomst inkomst cent 1 64 000 50 500 10,6 116 800 86 500 2,8 187 900 140 500 9,8 2 92 000 70 900 7,6 160 600 115 500 2,7 271 300 196 400 13,5 3 112 300 82 000 8,9 186 500 136 500 2,7 317 700 229 600 18,1 4 129 400 90 800 10,1 211 800 149 900 3,0 356 700 252 200 17,3 5 147 500 99 100 12,3 235 400 164 900 4,3 400 000 278 500 13,9 6 162 300 108 500 13,1 259 900 179 500 5,7 439 300 305 500 10,1 7 179 400 118 500 11,2 288 000 197 700 10,9 492 100 334 600 7,3 8 200 900 131 100 10,2 322 500 218 200 17,0 580 800 368 400 5,4 9 232 900 148 500 8,7 372 800 248 700 23,1 682 900 420 500 2,8 10 354 100 217 300 7,3 540 200 334 400 27,7 913 400 536 600 1,9 Samt— 162 900 109 000 100,0 366 000 239 800 100,0 377 600 261 000 100,0

liga

Decilindelning efter bruttoinkomst

I tabell 3 redovisas fördelningseffekterna av skattereformen när hushållen uppdelas enligt deciler efter bruttoinkomst per konsum- tionsenhet. Bruttoinkomsten mäts som summan av lön, före- tagarinkomst, inflationskorrigerad inkomst av kapital samt transfereringar. Fördelningsprofilen överensstämmer i stort med vad som redovisades ipropositionen. Ökningen av den disponibla inkomsten är störst i de högsta decilgrupperna. Även här avviker dock den högsta decilen jämfört med beräkningen i reformproposi- tionen genom att utbytet är större än vad som då beräknades.

Tabell 3. Förändring av real disponibel inkomst genom skattereformen i deciler efter bruttoinkomst (20-64 år). Procent

Decil Enligt pro- 1989 års 1992 års Sysselsättningsgrad position material material

1989 års 1992 års material material 1 —2,2 -0,8 -l,8 44 35 2 1,2 2,2 0,8 71 58 3 1,8 2,5 1,3 80 72 4 2,3 2,2 1,8 85 76 5 2,3 2,5 2,3 89 81 6 2,6 3,2 2,8 93 87 7 3,3 3,4 3,1 93 91 8 3,8 4,3 3,8 94 92 9 4,5 4,7 4,5 96 94 10 1,7 4,7 6,6 95 95 Samtliga 2,5 3,4 3,3 84 78

Socioekonomiska grupper

Materialet har även indelats i s.k. socioekonomiska grupper enligt de definitioner som används av SCB (tabell 4). Det innebär att varje hushåll tilldelas en socioekonomisk grupp efter hushållsföre- ståndarens förhållanden. Indelningen bygger i huvudsak på normal organisationstillhörighet och yrkets normala utbildningskrav. Den socioekonomiska grupperingen är alltså subjektivt bedömd och man kan inte vara säker på att exakt samma principer har tilläm- pats varje undersökningsår. Uppgifterna bör därför tolkas med viss försiktighet.

Tabell 4. Förändring av real disponibel inkomst genom skattereformen för olika socioekonomiska grupper (20-64 år). Procent

Grupp Enligt 1989 års 1992 års proposition material material Icke facklärda arbetare 3,6 3,9 3,6 Facklärda arbetare 3,5 4,2 3,7 Lägre tjänstemän 2,6 4,4 3,3 Tjänstemän på mellannivå 2,7 3,6 2,8 Högre tjänstemän 2,4 5,7 7,8 Övriga 0,1 -l,3 0,7

Den socioekonomiska grupp för vilka enligt de nya kalkylerna den disponibla inkomsten ökat mest på grund av skattereformen är högre tjänstemän. För övriga arbetar- och tjänstemannahushåll är ökningen av disponibel inkomst relativt likartade för de olika beräkningarna.

I tabellen finns jämförelse- och tolkningsproblem bl.a. för gruppen uövriga”. I denna grupp ingår de som är arbetslösa. Detta kan förklara de stora skillnader vi ser mellan åren 1989 och 1992. I 1989 års material är gruppen "övriga” en ytterst heterogen grupp, medan den i 1992 års material har fyllts på med en grupp som blivit arbetslösa.

I figur 3 nedan kan samvariationen mellan decilgruppering efter disponibel inkomst och socioekonomisk gruppering studeras. Som man kan se har gruppen ”övriga” tyngdpunkten förlagd till decil

1. Högre tjänstemän är överrepresenterade i decil 10.

Figur 3. Decilemas sammansättning på olika socioekonomiska grupper

100%

80%

0%

Hushållst

l tabell 5 redovisas effekten på disponibel inkomst per kon- sumtionsenhet för olika hushållstyper. Det framgår att för en- samstående med två eller flera barn och sammanboende med tre barn eller fler ökar den disponibla inkomsten mest. En orsak till detta är de kraftigt höjda barnbidragen. 1 känslighetsanalysen som redovisas i tabell 10 framgår effekten av att istället för skattepro-

positionens förslag till barnbidrag använda det belopp som faktiskt kom att gälla för år 1991. För exempelvis ensamstående med ett barn skulle detta innebära en sänkning till 2,5 % (1992 års material). Motsvarande procentsats för sammanboende med två barn skulle bli 3,5 % (1992 års material).

Tabell 5. Förändring av real disponibel inkomst genom skattereformen för olika hushållstyper (20-64 år). Procent

Grupp Enligt 1989 års 1992 års proposition material material Ensamstående utan barn 2,4 2,5 2,2 Ensamstående med 1 barn 6,1 4,7 3,1 Ensamstående med minst 2 barn 6,3 5,2 3,9 Sammanboende utan barn 1,9 3,4 3,9 Sammanboende med 1 barn 2,5 4,2 3,7 Sammanboende med 2 barn . 2,4 3,8 4,3 Sammanboende med minst 3 barn 3,7 5,6 6,1

Skattereformen innebar som framgår av tabell 5 en förhållandevis stor förbättring för hushåll med barn. I figur 4 är familjetyp indelad efter decilgruppering. Mycket tydligt framträder här ett mönster där barnfamiljerna är lokaliserade i den nedre delen av inkomstfördelningen. Den högsta decilgruppen består huvud- sakligen av familjer utan barn. Placeringen påverkas starkt av att ekvivalensskalan minskar barnfarniljernas disponibla inkomster.

Figur 4. Decilemas sammansättning på olika familjetyper

100%

80%

40%—

20%—

0%

Decil

Boendeform

I tabell 6 redovisas förändringen av disponibel inkomst för hushållen uppdelade på olika boendeformer. Som framgår av tabellen ligger de nya beräkningarna något under propositionens när det gäller hyreslägenheter. Motsatsen gäller för bostadsrätt och eget hem. För hyres- och bostadsrätter skall dock denna tabell tolkas med stor försiktighet då vissa klassificeringsproblem finns i datamaterialet.

Tabell 6. Förändring av real disponibel inkomst genom skattereformen för olika boendeformer (20-64 år). Procent

Grupp Enligt 1989 års 1992 års proposition material material Hyreslägenhet 3,5 3,1 3,1 Bostadsrätt 3,5 4,8 5,0 Egna hem 1,5 3,6 3,0 Region

Ökningen av den disponibla inkomsten är ganska likartad i alla regioner. Ett undantag är Stor-Stockholm, där de nya beräk- ningarna visar ett bättre utfall än i skattepropositionen.

Tabell 7. Förändring av real disponibel inkomst genom skattereformen för olika regioner (20-64 år). Procent

Grupp Enligt 1989 års 1992 års

proposition material material Stor-Stockholm 2,3 4,5 4,4 Göteborg och Malmö 2,6 3,0 2,7 Större städer 2,5 2,9 3,2 Södra mellanbygden 2,5 3,1 2,8 Norra tätbygden 3,0 3,5 2,5 Norra glesbygden 2,5 2,5 2,6

Ålder

I tabell 8 är materialet uppdelat efter ålder. Någon motsvarande uppdelning gjordes inte i propositionen. Av tabellen kan utläsas att ökningen av den disponibla inkomsten är likartad i olika ålders- grupper. Undantaget är hushåll i åldersintervallet 20-24 år. Speciellt gäller detta 1992 års material. Orsaken är troligen att ungdomarna då börjat känna av en kärvare situation på arbets- marknaden.

Tabell 8. Förändring av real disponibel inkomst genom skattereformen för olika åldrar. Pmcent Grupp 1989 års 1992 års

material material 20 - 24 2,0 0,5 25 - 34 3,6 3,3 35 . 44 3,5 3,8 45 - 54 3.3 4,2 55 - 64 3,9 2,7

I figur 5 har indelning gjorts efter deciltillhörighet och ålder. Vi ser här att det föreligger stora skillnader mellan åldersgrupperna. I diagrammet ser man alltså spår av den naturliga vandringen genom decilgrupperna som präglar (de flestas) livscykel.

Figur 5. Decilemas sammansättning på olika åldersgrupper

100%

80%

60%

40%

20% --

O %

Förrnögenhet

Skattereformen innebar stora förändringar i kapitalbeskattningen. Värdet av ränteavdrag minskade. Det är därför av intresse att studera utfallet av skattereformen för hushållen uppdelade i förmögenhetsklasser. Av tabell 9 framgår att skillnaden i utfall mellan propositionsberäkningama och de nya beräkningarna är störst bland hushåll med de högsta förmögenhetsvärdena.

Tabell 9. Förändring av real disponibel inkomst genom skattereformen efter förmögenhet (20-64 år). Procent

Förmögenhet Enligt 1992 års proposition material - 200 000 3,3 3,0 200 000 - 400 000 3,0 4,3 400 000 600 000 2,3 4,9 600 000 — 800 000 2,3 4,3 800 000 - 1 000 000 1,5 3,7 ] 000 000 - -7,7 2,6

___—___—

I den disponibla inkomst som hittills redovisats har hänsyn tagits till såväl de direkta regelförändringarna som till de mer indirekta. I dessa senare inräknas samtliga höjningar av boendekostnad och indirekta skatter som var ett led av skattereformens finansiering. Vi skall här visa hur känsliga resultaten är för definitionen av disponibel inkomst. I figur 6 nedan är förändringarna av disponibel inkomst enligt tre begrepp utritade.

' Den första (övre kurvan) år den disponibla inkomst som definieras utan att hänsyn tas till varken indirekta skatter eller vissa boendekostnader. Detta är den definition som SCB an- vänder vid inkomstfördelningsstudier. ' Om vi från denna drar bort ökningen som beror på skatterefor— men av indirekta skatter exklusive vissa boendekostnadsökningar erhålls ett andra disponibel inkomstbegrepp. ' Om vi slutligen belastar hushållen med samtliga ökningar av boendekostnadema som blir följden av skattereformen erhålls ett tredje begrepp. Det är detta begrepp som har använts i redo- visningarna.

Figur 6. Förändring av disponibel inkomst. Olika definitionen 1992 års material. Procent

D'sponlbel hkorrst

_ ' ' ' - _ - _Ö'sponlbel inkomst minus blade indlrekta skatter ' + . .

% 4 3 _ 2 _ D'spombel inkorrst minus ökade indirekta slanor och boendekostnader 1 0 T——— | | | —+ | | | + | 1 2 3 4 5 6 7 B 9 10

Decll

Med den första definitionen av disponibel inkomst får hushållen en påtaglig positiv förändring. När sedan de indirekta skatterna dras

av skiftar kurvan nedåt. Skiftet sker parallellt eftersom de indirekta skatterna i beräkningarna dras av proportionellt mot disponibel inkomst. När därefter höjda boendekostnader frånräknas sker ytterligare ett skift nedåt, denna gång dock inte proportionellt. Anledningen till detta är att boendekostnaden i de lägre decilgrup- perna utgör en större andel av den disponibla inkomsten.

Förändringar av inkomstfördelningar kan även mätas med aggrege- rade, sammanfattande mått. I dessa försöker man sammanfatta de många förändringar som ägt rum med ett mått. Ett vanligt tillvägagångssätt är att använda den s.k. Ginikoefficienten. Denna är ett ojämnhetsmått som kan anta ett värde mellan 0 och 1, där ett högre värde motsvarar en ojämnare fördelning. Koefficienten är dock mycket trögrörlig. Vi har beräknat förändringen av Ginikoef- ficienten för de tre olika disponibla inkomsterna gällande 1992 års material, se tabell 9. För de två första kan endast en ringa förändring uppmätas. När vi däremot tar hänsyn till de ökade boendekostnadema finner vi en mätbar ökning av Ginikoefficien- ten. Hur den disponibla inkomsten definieras påverkar således resultatet så tydligt att det även märks i detta trögrörliga mått.

Tabell 9. Beräknade Ginikoefficienter

Begrepp Gamla regler Nya regler Differens Disponibel inkomst 0,210 0,212 0,002 Disponibel inkomst minus 0,210 0,212 0,002 indirekta skatter

Disponibel inkomst minus 0,210 0,217 0,007 indirekta skatter och boende

3.3. Fördjupad analys

Känslighetsberäkning av basbreddningar

I detta avsnitt redovisas dels beräkningar där några viktiga basbreddningar utförts på samma sätt som i skattepropositionen och dels några andra känslighetsberäkningar. Avsikten är att få en uppfattning om vilken effekt ändrade antaganden om basbredd- ningamas volym och utförande har på den profil som erhålls över decilgrupperna. Kalkylema har enbart utförts på 1992 års datama- terial.

De beräkningar som utförts beskrivs nedan och resultaten presente- ras i tabell 10.

a)

b)

d)

I beräkning (a) har beskattning av fönnånliga lån utförts på samma sätt som i skattepropositionen. Detta innebär att volymen höjts från ca 100 till 760 miljoner kronor. I för- hållande till propositionsberäkningama har denna post således nedreviderats väsentligt. Dessutom används samma teknik som i skattepropositionen vilket innebär att beloppet läggs ut riktat mot privata tjänstemän. Som man kan se i tabell 10 har denna basbreddning en utpräglad inkomstprofil, störst effekt erhålls i decilgrupp 10 med en minskning på 0,3 procentenheter. Den ökade skattebasen är i detta fall lokaliserad högst upp.

Avkastningsskatten på avtalsenliga pensionsfonder har beräknats på samma sätt som i propositionen. Volymen har fördubblats från 2 till 4 miljarder kronor. Tekniken är dess- utom mer progressiv. Även denna kalkyl ger större effekt i de övre decilerna.

Basbreddning för uthyrning av privatbostad har reviderats ner kraftigt, från ca 3 miljarder kronor i propositionen till ca 700 miljoner kronor. När vi antar den gamla nivån och använder samma teknik som i propositionen, erhålls en relativt kraftig- are effekt i de övre decilerna.

Ett exempel som skiljer sig från de ovanstående är basbredd— ning av traktamente. I 1992 års material finns, förutom för endagstraktamente, uppgifter om traktamenete i materialet. För dem som hade uppgifter, skrevs dessa upp med en faktor för lönesubstitution (se Appendix). Inför skattepropositionen lades däremot traktamente ut proportionellt mot lön över en viss undre gräns, en "bred” utläggning. Kontentan är att inför propositionen träffades många av denna basbreddning, medan i 1992 års material färre. Detta avspeglas i resultatet genom att vi här får ett annat resultat än för de tre första känslighetskal- kylema. I de två översta decilerna erhålls med "propositions- metoden” en mindre basbreddning än vid de nya beräk- ningarna, därav de positiva förändringarna.

Eftersom marknadsvärdet på aktier under 1992 var lågt, kan det vara av intresse att studera känsligheten för nivån på aktievärdet när det gäller reavinst för aktier. Här har aktievär- det skrivits upp med ca 80 % för att ungefär nå den nivå som gällde vid halvårsskiftet 1995.

0

g)

h)

I-lur hushållen belastas på grund av pensionsfondbeskattning och särskild löneskatt på pensioner kan antas påverka för- delningsprofilen relativt starkt. För att undersöka detta har därför alla dessa effekter i beräkningarna nollställts. Det gäller alltså avkastningsskatt på privata pensionsfonder, avkastnings- skatt på avtalenliga pensionsfonder för privatanställda och särskild löneskatt på pensioner utöver folkpension och ATP. Den förväntade effekten av den här manövern kommer att bli ett tillskott för de berörda hushållen. I tabellen ser vi att så blir fallet. Vi ser också att fördelningsprofilen är relativt stark, den högsta decilgruppen ökar med 0,9 procentenheter medan den lägsta decilgruppen endast ökar med 0,3 procentenheter.

En känslighetsberäkning har även utförts för barnbidragen. Den kalkylen innebär att vi istället för skattepropositionens grundbelopp på 10 020 kronor har använt det grundbelopp som faktiskt kom att gälla år 1991, nämligen 9 000 kronor. I tabellen kan vi se att detta ger en mycket stark effekt för de lägsta decilerna, som mest minus 0,8 procentenheter i den

lägsta decilgruppen.

Slutligen har en känslighetsberäkning avseende inkomst av näringsverksam het utförts. Den basbreddning på ca 7 miljarder kronor som antagits i beräkningen sätts till noll. Dessutom slopas basbreddningen för underskott av näring på ca 380 miljoner kronor. Denna kalkyl är att uppfatta som just en känslighetsberäkning och utgör ingen bedömning av storleken på de faktiska basbreddningama i dessa avseenden.

Tabell 10. Känslighetsberiikningar. 1992 års material

Decil

10

Samt— liga

Procen- tuell för- ändring 1992 års material

0,6 2,3 2,9 2,4 3,5 3 4 3,5 4,2 3,9 3 4

3,3

Känslighetsberäkningar Differens i procentenheter mot ordinarie beräkning (kolumn 2)

Bas— bredd av ränte- förmån enl prop

(8) 0,0 0,0

00 :

00 )

0,0

0,0

Bas- bredd av avkast- nings— skatt enl PmP

( |?)

0,0

Bas— bredd uthyr» ning av privat- bostad enl prop (e)

Bas- bredd av trakta- mente enl PTOP (d)

Rea- vinst aktier enl

95 års nivå

Ingen förändrad beskattn pensions- fonder

Barn- bidrag enl 91 års reg - ler

In! ba: bn nä. rin v er sar

Bilaga 5 Resultat Känslighetsberäkning dynamiska effekter

Inför beräkningen till skattepropositionen togs även hänsyn till s.k. dynamiska effekter. I de här redovisade beräkningarna har vi ej beaktat dessa. Dock har en känslighetsberäkning gjorts där vi antar en dynamisk effekt som ger en höjning av arbetsinkomsten med 1 %. Resultatet för olika decilgrupper kan studeras i figur 7. Den översta linjen är den där den dynamiska effekten ingår. Det hela leder till en nivåförändring som är något större i de högre deciler- na.

Figur 7. Känslighetsberälming av dynamiska effekter

50--

4.5 _

4.0 —

3.5 i

3.0 1

% 2.5 — 2.0 --

1.5 Prop-beräkning

1 O +1992 års data

0.5 +1992 års data 1%

0.0

ut"

Alternativ decilindelning

Genom att undersöka inkomstfördelningen inom varje hushålls- grupp kan jämförelser göras som inte är så starkt beroende av vilken ekvivalensskala som används. I tabell 11 har en ny decilindelning tagits fram inom varje hushållsgrupp (alltså en sortering inom varje hushållstyp). I tabellen redovisas både nivån på disponibel inkomst per konsumtionsenhet och förändringen av disponibel inkomst per konsumtionsenhet.

Tabell ll. Förändring av real disponibel inkomst genom skattereformen för olika hushållstyper (20-64 år) i deciler efter ekonomisk standard. 1992 års priser. Procent

Ensamstående utan barn Decil Dispo- För- nibel ändring inkomst % I 42 781 -5,0 2 61 815 -l,5 3 72 742 0,5 4 80 191 1,9 5 86 384 3,0 6 92 826 3,4 7 99 435 3,9 8 108 636 5,1 9 121 543 4,1 10 173 151 1,2

Samt— 93 981 liga

2,2

Ensamstående med barn Dispo- För- nibel ändring inkomst % 42 578 4,8 53 860 3,9 58 897 3,9 62 145 3,6 65 190 5,5 68 600 3,1 72 258 5,4 77 635 2,0 84 152 5,0 115 832 -0,3 70 164 3,4

Sammanboende utan barn

Dispo- För- nibel ändring inkomst %

61 654 -l,1

87 943 2,6 101 318 2,9 109 573 3,5 116 610 4,3 124 074 3,5 133 330 3,9 144 554 3,5 162 645 5,4 207 169 5,6 124 920 3,9

Sammanboende med barn Dispo- För- nibel ändring inkomst 42 612 6,9 58 131 5,0 65 960 4,9 72 300 5,2 77 737 3,7 82 949 4,3 89 694 3,9 97 764 2,7 108 709 3,8 140 992 4,5 83 716 4,31

4 Sammanfattande kommentarer

Jämförelserna mellan våra kalkylresultat och beräkningarna inför skattereformen visar att den huvudsakliga bilden av fördelnings- effekterna står sig. För de allra flesta grupperna visar kalkylerna en förändring av disponibel inkomst baserad på faktiskt utfall för många basbreddningar etc. som är mycket nära den som förutsågs i beräkningarna inför reformen. På några viktiga punkter skiljer dock sig resultaten. De nya beräkningarna ger ett bättre utfall för de 10 % av hushållen med högst ekonomisk standard än vad som visades inför reformen. Fortfarande är dock ökningen för denna grupp i allmänhet nära genomsnittet för alla hushåll. Den socioeko- nomiska indelningen visar också att högre tjänstemän vunnit mer på reformen än vad som förutsågs i analyserna före reformen, och dessa grupper har också fått ett bättre utfall än andra grupper.

Känslighetsberäkningama har visat att en bedömning av reformens effekter påverkas relativt mycket av metodval. Indelning i olika grupper ger mer information om t.ex. utfallet för de mest välbe- ställda hushållen, effekter som inte fångas i sammanfattande mått t.ex. Gini-koefficienten. Med ett traditionell mått på disponibel inkomst, som används i den ordinarie inkomststatistiken, fångas en mindre del av fördelningseffekterna än vad som fångas med det här använda måttet som bl.a. i högre grad beaktar finansieringens fördelningseffekter. Detta pekar således på att en bedömning av reformens effekter bör göras med användning av flera inkomstmått och indelningsgrunder.

Resultaten från de två olika årgångarna 1989 och 1992 följeri stort varandra. Vissa avvikelser finns. Ofta ligger resultaten för 1989 mellan skattepropositionens och 1992 års resultat. En trolig förklaring till detta är den skillnad i ekonomiska förhållanden som föreligger mellan 1989 och 1992. Aktieförmögenheten var hög 1989 men låg 1992. För arbetslösheten gäller det omvända, den var mycket låg 1989 men hade börjat stiga 1992.

Den mindre - men viktiga - förändringen i de nya beräkningarna nämligen att hushållen med de högsta inkomsterna fått ett något bättre utfall än väntat kan till största delen förklaras av att vi nu har tillgång till bättre information om olika basbreddningars faktiska utfall och fördelning. Den största delen av denna ökning sammanhänger med underfinansieringen av reformen. Ett antal basbreddningar beräknades ireformkalkylen bli större än enligt de nu reviderade beräkningarna som baseras på observerade utfall. Det gäller t.ex. basbreddningar på traktamenten, inkomst av uthyrd

privatbostad och avkastningsskatt för pensionsfonder. Flertalet sådana nedrevideringar av finansieringen av reformen gynnar högre tjänstemän och ekonomiskt välbeställda hushåll.

Det finns också tekniska förklaringar till de något annorlunda resultaten. Förutom att ett antal basbreddningar reviderats ned, har i de nya kalkylerna vissa basbreddningar och finansieringar lagts ut på ett annat sätt än i beräkningarna före reformen. I vissa fall finns i de använda HINK-undersökningarna tillgång till nya data som nu kan ersätta tidigare basbreddningar där antagna för- delningsprofiler använts. I andra fall finns nya data enligt vilka vissa basbreddningar kan 4*läggas ut” med högre precision än tidigare. I några fall har möjligheterna att lägga ut basbreddningar försämrats. Den sammantagna effekten av dessa förändringar är dock att basbreddningama i de nya kalkylerna har en något jämnare fördelningsprofil än vad som antogs före reformen.

I flera fall är det dock svårt att veta om de nivåer som antagits kan anses vara korrekta i ett långsiktigt perspektiv. Även om två skilda inkomstfördelningar har använts, från olika faser i konjunkturen, kan båda dessa år 1989 och 1992 var och en anses ha präglats av exceptionella ekonomiska förhållande.

Skattereformen genomfördes i två etapper. Beslut om den sista fattades i riksdagen i juni 1990. Sedan dess har närmare ett hundratal justeringar skett i skattesystemet. Till detta kommer de stora förändringar som skett i ekonomin. Resultaten skulle givetvis _in annorlunda om beräkningen i stället gäller de sammantagna regeländringarna från 1989 till t.ex. 1995.

APPENDIX Basbreddningar

I detta avsnitt skall ytterligare några tekniska aspekter på be- räkningarna kommenteras. Genomförandet av beräkningarna har principiellt skett i två steg:

' Införandet av olika basbreddningar ' Regeländringar m.m.

Detaljer om hur basbreddningama utförs finns senare i detta Appendix. Nedan listas de basbreddningar som har beaktats. Då redovisningen enbart omfattar hushåll där hushållsföreståndaren är mellan 20 och 64 år tas här inte upp förändringar som berör pensionärer.

Följande basbreddningar avseende arbetsinkomster har beaktats: - Skärpt beskattning av diverse småposter

- Högre värdering av bilförmån - Skärpt beskattning förmånliga lån från arbetsgivaren - Slopad skattefrihet för måltidssubventioner - Slopandet av 600-kronors regeln om skattebefrielse - Skärpt traktamentsbeskattning - Skärpta regler, ersättning resor i tjänsten - Skärpt beskattning konvertibler m.m. till anställda - Beskattning av vissa försäkringsförrnåner (AGS m.m.) - Slopade skattereduktioner hemmamake - Basbreddning näringsverksamhet - Begränsning underskott näringsverksamhet - Sänkning av skattereduktioner för fackföreningsavgift

För kapitalinkomster har följande basbreddningar beaktats:

- Beskattning av allemansfond/spar - Skärpt reavinstbeskattning av skuldebrev m.m. - Skärpt reavinstbeskattning av aktier - Skärpt beskattning, sparade arbetsinkomster via aktier - Skärpt reavinstbeskattning bostadsrätt - Skärpt beskattning uthyrning bostad - Skärpt reavinstbeskattning för villor och fritidshus - Höjda taxeringsvärden villor och fritidshus - Slopat extra avdrag kapital - Slopad schablonintäkt och höjd fastighetsskatt småhus

Hänsyn har även tagits till avkastningsskatt och särskild löneskatt:

- Avkastningsskatt privata pensionsfonder - Avkastningsskatt avtalsenligapensionsfonderförprivatanställda - Särskild löneskatt på pensioner utöver folkpension och ATP

Vi har också försökt ta hänsyn till höjningen av indirekt skatt och dess påverkan på boendekostnaden. Boendekostnaden har justerats genom att hyran höjts proportionellt. Detta är en förenkling i så måtto att vi därmed antar att hyran är helt kostnadsbestämd och därför helt belastar de boende. För egna hem har driftskostnaden höjts på ett liknande sätt. Därefter har den disponibla inkomsten minskats proportionellt med indirekt skatt.

Förändringar av vissa viktigare basbreddningar

Angående basbreddningamas volym och tekniska utförande finns en del skillnader jämfört med beräkningarna inför skattepropositio- nen. Här skall nämnas några skillnader som har en viss effekt på resultatet.

' Nya bedömningar har lett till att basbreddning för traktamenten har nedreviderats med 2 miljarder kronor från ca 10 till ca 8 miljarder kronor.

' Basbreddning på reavinst av aktier beräknades inför proposi- tionen till ca 13 miljarder kronor. Då vi bl.a. låtit börskursemas värde slå igenom erhålls med 1989 års data en basbreddning på ca 11 miljarder kronor och 1992 en betydligt mindre basbreddning på knappt 6 miljarder kronor.

' I skattepropositionen antogs att inkomst av uthyrd privatbostad skulle uppgå till ca 3 miljarder kro