Prop. 1980/81:10

om ändring i kreditupplysningslagen (1973:1173), m.m.

Prop. 1980/81:10 Regeringens proposition

1980/81: 10 om ändring i kreditupplysningslagen (l973:1173), m. m.;

beslutad den 10 juli 1980.

Regeringen föreslår riksdagen att anta de förslag som har tagits upp i bifogade utdrag av regeringsprotokoll ovannämnda dag.

På regeringens vägnar

JAN-ERIK WIKSTRÖM HÅKAN WINBERG

Propositionens huvudsakliga innehåll

Kreditupplysningslagen('1973:1173) och inkassolagen(19742182) har gällt sedan 1974. Båda lagarna syftar främst till att skydda medbtn'garna mot olika slags integritetskränkningar i samband med yrkesmässigt bedriven kredit- upplysningsx-erksamhet och inkassoverksamliet. Efterlevnaden av lagarna övervakas av datainspektionen som tillsvnsmyndighet.

l propositionen läggs fram förslag till ändringar i kreditupplysningslagen och inkassolagen . Förslagen grundar sig främst på datainspektionens erfarenheter.

Ändringarna i kreditupplysningslagen innebär att enskildas integritets- skydd fi'ärbättras i en del hänseenden. Det sker bl. a. genom att tidsgränsen för hur gamla uppgifter som får tas med i s. k. persrmupplysningar sänks från fem till tre är. Vidare skall kreditupplysningsföretagen underrätta den som avses med en personupplysning om vem som har begärt upplysningen. En rätt till automatisk underrättelse om de uppgifter som har lämnats ut i en kreditupplysning införs även för enskilda näringsidkare m. fl.. vilka i dag inte erhåller en sådan underrättelse.

l fråga om inkassolagen föreslås att lagens tillämpningsområde utvidgas till att omfatta praktiskt taget all indrivning av fordringar. Undantag görs dock för bl. a. enskilda personers indrivning av egna fordringar av privat natur. En del ändringar föreslås i syfte att förbättra rutinerna vid krav mot gäldenärer. samtidigt som utrymme lämnas för borgenärer att framställa enkla betal- ningspåminnelser utan att det blir fråga om inkassoverksamhet i lagens mening. 1 syfte att förbättra integritetsskyddet pä inkassoomrädet föreslås helt nya regler om gäldeni'irsregister som används i inkassoverksamhet.

Vidare läggs i propositionen fram förslag som innebär att den nuvarande

Prop. 1980/81 : 10

IJ

prt.)cessrättsliga regleringen av rätten till ersättning för inkassokostnader byts ut mot nya civilrättsliga regler. som blir tillämpliga inte bara vid process utan också i andra sammanhang. Ett viktigt syfte med reglerna är att skydda gäldenärerna mot alltför höga ersättningsanspräk. Den nya civilrättsliga regleringen föranleder en del ändringar i lagsökningslagen och annan processrättslig lagstiftning.

Förslagen avses i sina huvuddelar träda i kraft den 1 juli 1981.

Prop. BSO/81:10 Propositionens lagförslag

] Förslag till Lag om ändring i kreditupplysningslagen(1973:1173)

Härigenom föreskrivs i fråga om kreditupplysningslagen(1973:1173) dels att lätsi skall upphöra att gälla. dels att 1. 3—14. 16. 19. 20 och 22 ss skall ha nedan angivna lydelse.

Nuvarande lydelse

Denna lag gäller yrkesmässigt bedriven kreditupplysningsverksam- het. Förmedling av upplysningar mellan kreditinrättningar omfattas dock ej av lagen, i den mån det är fråga om Sveriges riksbank. Sveriges investeringsbank AB eller annan kreditinrättning under bankinspek- tionens tillsyn än finansbolag enligt lagen (19802) om finansbolag. Ej heller gäller lagen förmedling av upplysningar mellan företag inom samma koncern.

Föreslagen lydelse

1.51

Denna lag gäller kreditupplys- ningsverksamhet som innebär att någon. utom i enstaka fall, länznar kreditupplvsningar mot ersättning el- ler som ett led i näringsverksam/tet. ' Lagen gäller också annan kreditupp- lysningsverksam/zet. om den är av större omfattning.

Lagen omfattar inte förmedling av kreditupplvsningar inom en krets som utgörs av Sveriges riksbank. Sveriges investeringsbank AB och sådana kretlitinriittningar eller för kreditupplysningsverksamhet inrät- tade företag som står under bankin- spektionens tillsyn och inte är finans- bolag enligt 5 sq lagen (19801) om finansbolag.

Lagen gäller inte heller förmedling av kreditupplysningar mellan företag inom samma koncern.

3.5

Kreditupplysningsverksamhet fär bedrivas endast efter tillstånd av data-

inspektionen.

Tillständ behövs ej för kreditupp- lysningsverksamhet. i den mån den bedrives genom offentliggörande av kreditupplysning i tryckt skrift.

' Senaste lydelse 1980528

Tillstånd behövs ej för kreditupp— lysningsverksamhet. i den mån den bedrivs genom offentliggörande av kreditupplysning i tryckt skrift eller annan skrift som avses i ] kap. 5 55 tryckfrihetsförordningen .

Prop. l980/81:lO

Nuvarande lydelse

Tillstånd att bedriva kreditupplys- ningsverksamhet får meddelas en- dast om det från allmänna synpunk- ter finns behov av verksamheten och den kan antagas bli bedriven på ett sakkunnigt och ('mulömesgillt sätt. Tillstand högst tio år i sänder och får förenas

meddelas för en tid av

med föreskrift om hur verksamheten skall bedrivas.

Föreslagen lydelse

tf./i

Tillstånd att bedriva kreditupplys— ningsverksamhet får meddelas en- dast om det frän allmänna synpunk- ter finns behov av verksamheten och den kan antas bli bedriven på ett sakkunnigt och omdömesgillt sätt.

Tillstand/iir meddelas för en tid av högst tio är i sänder. 'l'illstdndet får förenas med fi.)reskrift om hur verk- skall

skyldighet att anmäla lindring av

samheten bedrivas och om

förhållanden som har haft betydelse för tillståndet.

Tillstånd får ej meddelas någon för vilken gäller inskränkning i rätten att förvärva fast egendom enligt lagen (19161156) om vissa inskränkningar i rätten att förvärva fast egendom m.

Kreditupplysningsverksamhet. skall bedrivas så att den ej leder till otillbörligt intrång i personlig integ- ritet genom innehållet i de upplys- ningar som förmedlas eller på annat sätt.

'Jl

m .

tf./i

Kreditupplysningsverksamhet skall bedrivas sä att den ej leder till otillbörligt intrång i personlig integ- ritet genom innehållet i de upplys- ningar som förmedlas eller på annat sätt eller till att oriktiga eller missri- sande uppgifter lagras eller lämnas ut.

6.5

Uppgift om någons politiska eller religiösa uppfattning. ras eller hudfärg får icke insamlas. lagras eller vidarebefordras i kreditupplysningsvcrksam- het.

Uppgift om att någon misstänkas eller dömts för brott eller avtjänat straff eller undergått annan påföljd för brott eller varit föremål för åtgärd enligt barnavårdslagcn (1960:97). lagen (1954:579) om nyk— terhetsvård. lagen (1956:2) om soci- alhjälp. lagen (1966:293) om bere-

Uppgift om att någon misstänks eller ltar dömts för brott eller har avtjänat straff eller undergått annan påfi'iljd för brott eller har varit före- mål för åtgärd enligt barrnn'ardsla- gen (1960:97). lagen (195-1z579) om nykterhetsvard. lagen (1956:2) om socialhjälp. lagen (1966:293') om

Prop. BSO/81:10 Nuvarande lule/se

dande av sluten psykiatrisk vård i vissa fall. lagen (1967z940) angående omsorger om vissa psykiskt utveck- lingsstörda. lagen (1964z450) om åtgärder vid samhällsfarlig asociali- tet eller utlänningslagen(I954.'193) får ej utan medgivande av datain- spektionen insamlas. lagras eller vidarebefordras i kreditupplysnings- verksamhet. Detsamma gäller upp- gift orn sjukdom. hälsotillstånd eller liknande.

Föreslagen lydelse

beredande av sluten psykiatrisk vård i vissa fall. lagen (1967z94ll) angåen- de omsorger om vissa psykiskt ut- vecklingsstörda. lagen (1964:450) om åtgärder vid samhällsfarlig asoci- alitet. lagen (1971-558) om tillfälligt omhändertagande. lagen ( [ 976.151 1 ) om ()mhändertagande av berusade personer m. m. eller utlänningslagen (l980:376) får ej utan medgivande av datainspektionen insamlas. lagras eller vidarebefordras i kreditupplys- ningsvcrksamhet. Detsamma gäller uppgift om sjukdom. hälsotillstånd eller liknande.

Medgivande som avses i andra stycket får lämnas endast om synnerliga skäl

föreligger.

7 s Personupplysning får ej innehålla uppgift om annan betalningsförsummcl- se än sådan som fastslagits genom domstols eller annan myndighets avgörande eller åtgärd eller som lett till betalningsinställelse. konkursansö- kan eller ackord. Uppgift som enligt det sagda ej får lämnas ut får icke heller

lagras. .

Datainspektionen får medge un- dantag från bestämmelsermt i första stycket.

Personupplysning får ej innehålla uppgift om omständighet eller för— hållande som är av betydelse för bedi")mningen av någons vederhäf- tighet i ekonomiskt hänseende. om fem år förflutit från utgången av det är då omständigheten inträffade eller förhållandet upphörde. Upp-

Regeringen eller. efter regeringens bestämmande. datainspektionen får j'öreskriva undantag från bestäm-

melserna i första stycket. om det

finns särskilda skäl.

Pctsonupplysning får ej innehålla uppgift om omständighet eller för- hållande som är av betydelse för bedömningen av någons vederhäf— tighet i ekonomiskt hänseende. om ' tre år förflutit från utgången av det år då (.mrstz'indighetcn inträffade eller förhållandet upphörde. Uppgift som

Prop. l980/81:10

Nuvarande lydelse gift som enligt det sagda ej får lämnas ut skall efter "den angivna tiden gallras ut ur register som användes i kreditupplysningsverk- samhet. Gallringen skall göras så snart det kan ske och i vartfall innan upplysning lämnas om den som upp- giften avser.

Personupplysning får ej lämnas ut, om det finns anledning antaga att upplysningen kommer att användas av annan än den som på grund av ingånget eller ifrågasatt kreditavtal eller av liknande anledning har behov av upplysningen. Vad nu sagts gäller ej offentliggörande av person- upplysning i tryckt skrift.

Föreslagen bale/se

enligt det sagda ej får lämnas ut skall efter den angivna tiden gallras ut ur register som används i kreditupplys- ningsverksamhet. Gallringen skall göras så snart det kan ske och i vart fall innan upplysning lämnas om den som uppgiften avser.

9.5

Personupplysning' får ej lämnas ut. om det finns anledning anta att upplysningen kommer att användas av någon annan än den som på grund av ingånget eller ifrågasatt kreditav- tal eller av liknande anledning har behov av upplysningen. Vad nu sagts gäller ej offentliggörande av person- upplysning i tryckt skrift eller annan skrift som avses i 1 kap. 5 s? tryckfri- hetsförordningen.

105

Var och en har rätt att mot skälig avgift hos den som bedriver kredit- upplysningsverksamhet få skriftligt besked om innehållet i de uppgifter som finns lagrade om honom.

Var och en har rätt att mot skälig avgift hos den som bedriver kredit- upplysningsverksamhet fa skriftligt besked om huruvida deti verksamhe- ten finns uppgifter lagrade om honom och. om det finns sådana uppgifter. vad de har för innehåll.

11%?

Om personupplysning lämnas på annat sätt än genom offerztli_gg(')'rarz(1e i tryckt skrift. skall skriftligt medde- lande om upplysningens innehåll samtidigt lämnas kostnadsfritt till den som upplysningen avser.

När skall den som avses med upplysning-

personupplysning lämnas. en samtidigt och kostnadsfritt tillstäl- las ett skriftligt meddelande om de uppgifter. omdömen och råd som upplysningen innehåller rörande ho- nom och om vem som har begärt upplysningen.

Prop. HSO/81:10

Nuvarande lydelse

Förekommer anledning till miss- tanke att uppgift i kreditupplysning som lämnats under den senaste tolv- månadersperioden eller i register som ant-'ändes i kreditupplysnings- verksamhet är oriktig eller missvi- sande. skall den som bedriver verk- samheten utan dröjsmål vidtaga skä- liga åtgärder för att utreda förhållan- det.

Visar sig uppgiften vara oriktig eller missvisande. skall den. om den förekommer i register. rättas. kom- pletteras eller uteslutas ur registret. Har uppgiften tagits in i kreditupp- lysning som lämnats på annat sätt än genom tryckt skrift. skall rättelse eller komplettering så snart det kan ske tillställas var och en som under

Föreslagen lydelse

annan kredt'tupplysning rö- rande enskild person länmas. skall den som avses med upplysningen samtidigt och kostnadsfritt tillställas ett skriftligt meddelande om de upp- gtfter som uplvsningen innehåller rörande honom.

Har som ett led i en upplysning som avses iförsta eller andra stycket uppgift. omdöme eller råd lämnats även beträffande en annan enskild person. skall detta anges i meddelan- det jämte den andra personens nanut. Andra uppgifter rörande den perso- nen än identitetsuppgifter och adress får ej framgå av meddelandet.

Första tredje styckena gäller ej krcditupplysning som lämnas genom offerttliggörande i tryckt skrift eller annan skrift som avses i 1 kap. 5 55 tryckfrihetsförordningen.

Förekommer anledning till miss— tanke att en uppgift i kreditupplys— ning som lämnats under den senaste tolvmanadersperiodcn eller i regis- ter som används i kreditupplysnings- verksamhet är oriktig eller missvi- sande. skall den som bedriver verk- samheten utan dröjsmål vidta skäli- ga åtgärder för att utreda förhållan- det.

Visar sig uppgiften vara oriktig eller missvisande. skall den. om den förekommer i register. rättas, kom- pletteras eller uteslutas ur registret. Har uppgiften tagits in i en kredit- upplysning som lämnats på annat sätt än genom tryckt skrift eller annan skrift som avses i 1 kap. 5 # tryckfrihetsförordningen . skall rät-

Prop. HSO/81:10

Nuvarande lydelse

den senaste tolvmänadersperioden fått del av uppgiften. Har uppgiften lämnats i periodisk skrift. skall rät- telsen eller komplettering så snart det kan ske införas i ett följande nummer av skriften. Vad som sägs i detta stycke gäller dock icke. om uppgiften uppenbarligen saknar be- tydelse för bedömningen av veder- börandes vederhäftighet i ekono- miskt hänseende.

Har fråga om rättelse eller liknan- de åtgärd tagits upp efter framställ- ning från den som uppgiften avser. skall denne kostnadsfritt underrättas om huruvida sådan åtgärd vidta- gits.

Register som användes i kredit- upplysningsverksam het fär överlåtas eller upplåtas till annan endast efter medgivande av datainspektionen.

Upphör någon att bedriva kredit- upplysningsverksamhet. skall han anmäla detta till datainspektionen. Inspektionen föreskriver i sådant fall hur det skall förfaras med register som anvc'ints [ verksamheten.

14

Den som är eller varit verksam i kreditupplysningsverksamhet får ej obehörigen yppa vad han till följd

Föreslagen lydelse

telse eller komplettering sä snart det katt ske tillställas var och en som under den senaste tolvmänaderspe- rioden fått del av uppgiften. l-lar uppgiften under den senaste tolv/nä- mtdersperioden lämnats i periodisk skrift. skall rättelse eller komplette- ring så snart det kan ske införas i ett följande nummei av skriften. Vad som sägs i detta stycke gäller dock icke. om uppgiften uppenbarligen saknar betydelse för bedömningen av vederbörandes vederhäftighet i ekonomiskt hänseende.

Har en fråga om rättelse eller liknande åtgärd tagits upp efter framställning från den som uppgif- ten avser. skall denne kostnadsfritt underrättas om huruvida sädan

åtgärd vidtagits.

135

Register som används i kreditupp- lysningsverksamhet fär överlatas el— ler upplätas till annan endast efter medgivande av datainspektionen.

Den som upphör att bedriva kre- ditupplysningsverksamhet eller som avser att flytta sådan verksamhet till ett annat land eller att kassera ett register som används i sådan verk- samhet skall anmäla detta till datain- spektionen. Inspektionen föreskri- ver i sådana fall hur det skall förfaras med register som berörs av atgär- den.

& Den som är eller har varit verksam" i kreditupplysningsverksamhet får inte obehörigen röja eller utnyttja

Prop. 1980/81:10

Nuvarande lydelse därav fått veta om enskilds personli- ga förhällanden eller om yrkes— eller affärs/lemlighet.

()

Föreslagen lvdelse

vad han till följd därav fält veta om enskildas pers0nliga fifirht'illanden eller om yrkes— eller affinis/icailiglic-

f("l'.

105

Datainspektionen har rätt attföre- taga inspektion hos den som bedri— ver kreditupplysningsverksamhet och att taga del av samtliga handling-

ar som rör verksamheten.

Datainspektionen har rätt attfitjre- ta inspektion hos den som bedriver kreditupplysningsverksamhet och att ta del av samtliga handlingar som rör verksamheten.

Den som bedriver kreditupplysningsverksamhet skall lämna datainspek— tionen de upplysningar om verksamheten som inspektionen begär för sin

tillsyn.

Bedrivs samhet genom utgivande av tryckt

krediliipplysitingsverk—

skrift eller annan skrift som avses i I kap. 5 sf tryt'kf'ri/tcis/i'irordiiiiigeii. skall den som bedriver verksainlu'ten inom en vecka efter utgivandet kost- iiadsfritt tillställa dataiiispektionen ett exemplar av skriften.

tvä-"-

Till böter eller fängelse i högst ett år dömes den som uppsatligen eller av oaktsamhet

]. bedriver kreditupplysnings- verksamhet titan tillständ enligt deti- nti lag, när sådant erfordras.

2. bryter mot 6—9 eller 13 s'eller mot föreskrift som meddelats enligt 4 s*" första stycket eller I 7 s*. eller

2Senaste lydelse 1975z741.

Till böter eller fängelse i högst ett ar döms den som uppsätligen eller av oaktsamhet 1. bedriver kreditupplysningsverk- samhet utan föreskrivet tillstånd.

2. bryter mot ("»—() s. Bs första stycket eller andra stycket första meningen eller I 6 s tredje stycket.

3 . [tryter mot föreskrift som med— delats enligt 4 # andra stycket. 13 s andra stycket andra meningen eller

17 &. eller

Prop. 1980/81:10

Nuvarande lydelse

3. lämnar osann uppgift i fall som avses i 10 eller II % elleri 16 & andra stycket.

11)

Föreslagen lydelse

4. lämnar osann uppgift i sådana fall som avses i 10% eller lo & andra stycket eller i ett meddelande enligt ll s* såvitt angår _ft'irluillanden som avses i l l s* första eller andra styck et eller tredje stycket första meningen.

Till böter döms den som genom oriktiga uppgifter uppsåtligen föratt- leder att någon som bedriver kredit- upplysningsi'erksamltet. i annat fall ("in som avses i 9 s” andra meningen. lämnar ut en personupplysaing utan att lta grund till detta enligt 9 s*. 'l'ill samma straff döms den som genom att utnyttja uppgifter hos någon som bedriver kreditupplysningsverksam- ltel uppsåtligen beredersig tillgång till en persontt/.7/>l_v.sning utan att lnt grund till detta enligt 9 s”. I ringa fall döms dock inte till ansvar.

20.5

Har kreditupplysningsvcrksamhet bedrivits utan tillstånd enligt denim lag. närsådant erfordras. skall regis- ter som använts i verksamheten för- klaras förverkat. om det ej är uppen- bart obilligt. Detsamma gäller. om register överlåtits eller upplåtits i strid med 13 & första stycket.

Om den som bedriver kreditupp- lysningsverksamhet icke fullgör vad som äligger honom enligt 10. 11 eller 12 5. får datainspektionen förelägga vite. Detsamma gäller. om den som bedriver sådan verksamhet underlä- ter att lämna tillgång till handling

Har kredituppl_vsningsverksamhet bedrivits utan _föreskrit-fet tillstand. skall register som använts i verksam- heten förklaras förverkat. om det ej är uppenbart obilligt. Detsamma gäller. om register överlätits eller upplåtits i strid med 13 & första stycket eller om föreskrift som med- delats enligt 13 s andra sty-'eket andra meningen ej följts.

()m den som bedriver kreditupp- lysningsverksamhet inte fullgör vad som äligger honom enligt 11). 11 eller 12 &. fär datainspektitmen förelägga vite. Detsamma gäller. om den som bedriver sadan verksamhet underlä-

ter att lämna tillgang till handling

Prop. 1980/81:10 . 1.1

t'vluvarande lydelse- Föreslagen little/se

eller att lämna upplysning i fall som eller att lämna upplysning i fall som avses i 16 &. avses i 16 & första eller andra styck- et.

Denna lag träder i kraft. såvitt avser upphävandet av 18 .ö den 1 januari 1981 och i övrigt den 1 juli 1981.

Utan hinder av första stycket fär clatainspektioncn i ett tillständsärendc som avgörs före den 1 juli 1981 meddela föreskrift enligt-4 s andra stycket om skyldighet att anmäla ändring av visst förhållande. sävitt angår tid från och med nämnda dag.

Bestämmelsen i 6 å andra stycket första meningen gäller även i fråga om uppgift om att någon har varit föremäl för åtgärd enligt den före den 1 juli 1981) gällande utlänningslagen(1954:193).

Prop. HSO/81 : 10

2. Förslag till Lag om ändring i inkassolagen (1974: 182)

Härigenom föreskrivs i fråga om inkassolagen(1974182) dels att 16 & skall upphöra att gälla. dels att 1—3. 5. 7. 111. 11. 12 och 17 så skall ha nedan angivna lydelse. dels att rubrikerna närmast före 1 och 2 så skall ha nedan angivna

lydelse.

het".

dels att rubriken närmast före 4 s'- skall'lyda ""Regler för inkassm'erksam-

dels att närmast före *)å skall införas en ny rubrik. "Verkan av viss

betalning".

dels att närmast före 10. 1 1 och 12 &; skall införas nya rubriker av nedan

angivna lydelse.

dels att i lagen skall införas tva nya paragrafer. ll) a & och 17 a ;. av nedan angivna lydelse samt närmast före dem nya rubriker av nedan angivna

lydelse.

Nuvarande lydelse

Inledande bestämmelser

Denna lag gäller _vrkesnu'issigt

l-"erk- sant/ter hus exekutiv myndig/tet (nn- bedriven inkassaverksam/tet. fattas (lack ej av lagen.

Med inkassaverksam/tet avses i denna lag verksam/tet med .vv/te att

driva in betalning för _lbrdran.

"I./-

Föreslagen lydelse

'l'illämpningsområde

Denna lag gäller indrivning av egen eller annans fordran genom krav eller annan ittkttssr'nitgiit'tl titt- Med gt'ird förstas åtgärd som inne/>är

k assa I 'erksatnl tet ) . ink assot'n- annan påtryckning pit gäldenären ("in angivande av tid för betalning eller uppgift om att ford/ingen. om den inte betalas. kommer att Överliitnnas .'"l/ nagon annan för inkasso. Beträj/intde enskilda personers el- ler döds/vans indrivning av egnaj'urd-

ringar tillämpas lagen endast om I/in'dringen ltar u].>pk(>mntit i närings- verksant/tet eller har övertagits för indrivning.

Lagen gäller ej exekutiva m_vndig- hete/'s verksam/tet.

Prop. 1980/_8l:10 Nuvarande lydelse

Tillstånd m. m.

lnkassewerksamhet. som avser in- drivning av ft.")rdringar för annans räkning eller fordringar som överta- gits för indrivning. far bedrivas endast efter tillstand av datainspek-

tionen.

Tillständ behövs ej för inkasso— verksamhet som bedrivs av Sveriges riksbank. Sveriges investeringslmnk AB. företag under bankinspektio— nens tillsyn eller advokat.

('.)

l 3 föreslagen lule/se

Tillstånd för viss inkassoverksam- het

lnkassoverksamhet. som avser in— drivning av fordringz-u' för annans räkning eller fordringar som har ("övertagits för indrivning. fär bedri- vas cndast efter tillstånd av datain- spektionen.

Ont inkassoverksamheten utgör ett underordnat led i en annan verksam- het och inte någon av verksamheterna utgör näringsverksamhet eller om inkassoverksamheten bedrivs av ett _löretag för ett annat företag inom tillstånd endast ifall dö inkassaverksamheten samma koncern behövs avserfordringarsom tillkommer eller har övertagits från någon som inte utan tillstånd enligt denna lag hade kunnat driva in fordringarna.

Tillstand behövs ej för inkasso- verksamhet som (ir av till/"(tllig natur och avser cnrlas/ enstaka jon/ringar eller som bedrivs av Sveriges riks— bank. Sveriges ins-'esteringslmnk AB. företag under bankinspektio— nens tillsyn eller advokat.

3.5

Tillstand fär meddelas endast om verksamheten kan antagas bli bedri- ven pä ett sakkunnigt och omdömes- gillt sätt. 'l'illständ meddelas för en tid av högst tio är i sänder och far förenas med föreskrift om hur verk- samheten skall bedrivas.

1 Senaste lydelse [9805—27

Tillstand far meddelas endast om verksamheten kan antas hli bedriven pä ett sakkunnigt och ntmlömesgillt sätt.

Tillstand/lir meddelas för en tid av högst tio är i sänder. "I'll/ståndet fär förenas med föreskrift om hur verk- samheten skall och bedrivas om

Prop. HSO/81:10

Nuvarande lydelse

Krav mot gäldenär skall framstäl- las skriftligen.' Vad som fordras i kapital. ränta och ersättning för kostnader skall anges var för sig. 1 fråga om ränta skall särskilt anges beloppet av upplupen ränta. ränte- satsen samt den tid och det kapital- belopp som ligger till grund för ränteberäkningen.

'Jl

14

Föreslagen lydelse

skyldighet att anmäla ändring av förhållanden som har haft betydelse för tillståndet.

Krav mot en gäldenär skall fram- ställas skriftligt. Kravetskallinnehål- la tydlig uppgift om lmrgenärens namn och om det förhållande sotn for(lringen grundar sig på. Är det fråga om en fordran som ltar överlä- tits eller pantsatts och kan gäldenären på grund härav ej med befriande verkan betala till fit-'erlt't'taren eller pantsättaren. skall kravet innehålla en tydlig upplysning om detta förhål- lande. I krav bör lämnas ant-'isning om lämpligt betalningsst'itt.

[ krav skall vad som fordras i kapital. ränta och ersättning för kostnader anges var för sig. I fråga om ränta skall särskilt anges belop- pet av upplupen ränta. räntesatsen samt den tid och det kapitalbelopp som ligger till grund för ränteberäk- ningen.

[samband med krav skall anges viss skälig tid inom vilken gäldenären har att betala frivilligt eller anmäla om han har någon invändning mot kravet.

Bestämmelserna i 5 och 6 då gäller ej. om gäldenären uppenbarligen söker undandraga sig att betala eller om det annars föreligger särskilda skäl att frångå vad som föreskrives där.

7.5

Bestt'itnmelsen i 6 .$ gäller ej, om

gäldenären uppenbarligen söker undandraga sig att betala eller om det annars föreligger särskilda skäl

att frångå vad som föreskrivs där.

l'rop. 1980/81:10

,NY/varande lydelse

Medel som inkasserats för annans räkning skall hållas avskilda och utan dröjsmål insättas på räkning i bank eller

motsvaramle. Har ej

annat avtalats. skall medlen titan dröjsmål redovisas till huvudman-

Ile/l.

l't'ireslagen [vt/else

Hantering av inkasserade medel

H).—$

Medel annans räkning skall hållas avskilda.

som ltar inkasserats för

Har med/ett ttpplntrits i inkassoverk- sant/tet som ittte är av tillfällig natur oelt inte avser endast enstaka ford- ringar, skall de utan dröjsmål insät- tas pä räkning i bank eller motsva- rande.

(.)m den som får en horgenärs uppdrag att driva in en fordran ltar ett annat. fortlöpande uppdrag av Imr- genären att i vt't'senrlig (mtfattning uppbära medel för dennes räkning tttan skyldighet att hålla dessa medel avskilda. kan parterna skriftligen överenskomma om undantag från första stycket.

t'l-ledel som ltar inkasserats för annatts räkning skall utan dröjsmål redovisas till dettne. om ej annat ltar avtalats.

Register i inkassovcrksamhet

lt") a &

Register som avser gäldenärer och som används i tillståndspliktig inkas- soverksamltetfår Över/ätas elle/' llpp- låtas till annan endast efter medgivan- de av dataittspekticmen.

Den som upphör med tillstånds— pliktig inkassoverksamhet eller som avser att flytta en sådan verksantltet till ett annat land eller att kassera ett register som avser gäldenärer och som används i sådan verksamhet

skall anmäla detta till datainspektio-

Prop. 1980/81:10

Nuvarande lydelse

Den som är eller har varit verksam i inkassoverksamhetför vilken krävs tillstånd enligt denna lag får ej obe- hörigen yppa vad han till följd därav fatt veta om enskilds personliga för- hållanden eller om _vrkes- eller af-

färs/tentligltet.

Om gt't'ldetu't'rs skyldighet att ersät- ta kostnad för inkassoåtgärd i vissa fall finns särskilda bestämmelser.

Föreslagen lydelse nett. lttspektiotten föreskriver i så— tlana fall ltttr det skall för/arus med

register som nu nämnts och som

berörs av titgärden.

'l'ystnadsplikt i inkassoverksamhet

lls'

Den som är eller har varit verksam i en inkassoverksamhet som avser indrivning av fordringar för annans räkning eller fordringar som ltar övertagits/"ör indrivning får inte obe— hörigen röja eller utnyttja vad han till följd därav ltar latt veta om enskildas personliga förhållanden eller 'om _vrkes— eller a_l'j'ärshentliglteter. Vad som ltar sagts nu gäller dock inte i fråga om inkassoverksam/tet som är av tillfällig ttalur och avser endast enstaka fordringar.

Första stycket tillämpas ej ifråga om den som enligt annan författning är underkastad en motsvarande tyst— nadsplikt. ! dct allmännas verksam- het tillämpas hestätnine/serna isekre— tess/a gett ( 1980.- I('t(t ).

Kostnader för inkassoätgärder

Om gäldem'irers skyldighet att ersätta kostnader för inkassoätgär-

der finns särskilda bestämmelser.

17.53

Till böter eller fängelse i högst ett år döntes den som uppsätligen eller

av oaktsamhet

3 Senaste lydelse l*)75:744.

Till böter eller fängelse i högst ett är döms den som uppsåtligen eller av oaktsamhet

Prop. 1980/81 : 10

Nuvarande lydelse l. bedriver inkassmferksamhet titan tillstånd enligt denna lag. när sådant erfordras. eller

2. lämnar osann uppgift i fall som avses i 14.5 andra stycket.

17

Föreslagen lydelse

l. bedriver inkassoverksamhet utan _/'t.')'reskrivet tillstånd.

3. bryter mot _l'tfireskriji enligt 3 .Ö' andra st_veket att anmäla ändring av visst förhållande,

3. bryter mot 1!) a s* första styeket eller andra st_veket första meningen eller nwt föreskrift som har medde- lats enligt ll) a s* andra stveket andra meningen. eller

4. lämnar osann uppgift i sådana fall som avses i 14 s*" andra stycket.

Förverkande av register

5

Ha?

Har inkassaverksamhet bedrivits utan föreskrivet tillstånd, skall regis— ter som avser gt'ildenärer nelz som har använtsi verksam/teten förklaras för- verkat. om det ej är uppenbart obil- ligt. Detsamma gäller. om ett register har överlätits eller upplåtits i strid med IO a s* första stycket eller om föreskrift srnn har meddelats enligt It) (! s* andra stycket andra meningen ej har följts.

Denna lag träder i kraft. sävitt avser ll s och upphävandet av to & den 1 januari 1981 och i övrigt den 1 juli lt)8l..

Utan hinder av första stycket fär datainspektionen i ett tillständsi'iremlc som avgörs före den 1 juli 1981 meddela föreskrift enligt 3 åantlra stycket om skyldighet att anmäla ändring av visst förhållande. sävitt angär tirl frän och med nämnda dag.

3 Riksdagen ] (MOI-"SI . l saml. Nr lt')

Prop. HSO/81:10 ls

3. Förslag till Lag om ersättning för inkassokostnader m. m.

Härigenom föreskrivs följande.

lå Denna lag gäller en gäldenärs skyldighet att ersätta en borgenärs kostnader för atgärder som syftar till att förma gäldenären att erlägga betalning för en förfallen skuld.

lä Gäldenären är skyldig att utge ersättning för skriftlig betalningspätnin— nelse rörande skulden. om avtal därom har träffats senast i samband med

skuldens uppkomst.

$& Gäldenären är vidare skyldig att utge ersättning för

1. krav ri'irande skulden. om kravbtev som har utformats pä ett sadant sätt som anges i Så inkassolagen (IW—1:18?) har lämnats över eller sänts till gäldenären. '

2. upprättande av fullständig plan för amortering av aterstäende del av skulden. om planen har tillkommit i samråd med gäldenären samt har satts upp skriftligt och lämnats över eller sänts till gäldenären.

45 Ersättningsskyldighet enligt 2 och 3 ss gäller endast kostnader sotn har varit skäligen påkallade för att ta till vara borgenärens rätt. Ersättning utgår med skäligt belopp enligt vad regeringen närmare föreskriver.

5 & Har nagon annan ätgärd än som avses i 2 och 3 && vidtagits i syfte att förmä gäldenären att erlägga betalning för en förfallen skuld. är denne inte skyldig att ersätta kostnaderna för atgärden. Vad nu sagts inskränker dock inte den skyldighet som pä annan grund än denna lag kan ävila gäldenären att ersätta kostnader för mer omfattande förhandling för biläggande av tvistefräga rörande en fordran.

Gå Avtalsvillkor som utvidgar gäldenärens skyldighet att utge ersättning utöver vad som följer av denna lag är ogiltigt.

Denna lag träder i kraft den I juli 1981. Bestämmelsen i ö & tillämpas även på avtalsvillkor som har tillkommit före den nya lagens ikraftträdande.

Prop. HSO/81:10

4. Förslag till

19

Lag om ändring i lagen (l946:808) om lagsökning och betalningsfo-

reläggande (lagsökningslagen)

Härigenom föreskrivs i fråga om lagen (ltt-lözfstlfl) om lagsökning och

betalningsförelz'iggande (lagsökningslagen)'

dels att i 22% ordet "Konungen" skall bytas ut mot "regeringen". dels att 1. 3. 12 och 18 Så" skall ha nedan angivna lydelse.

Nuvarande lydelse

För fordran som grundar sig ä skuldebrev eller annat skriftligt ford- ringsbevis och är till betalningförfal- len mä gäldenären lagsökas enligt vad nedan sägs.

Om fi'irf'ordran som avses i första stycket skriftligen upplåtits panträtt i fast egendom. skepp eller skepps- bygge. kan borgenären genom lag- sökning söka betalning ur egendo- men. l-lar borgenären för fordringen inteckning i luftfartyg eller reservde- lar till luftfartyg eller företagsinteck- ning. kan han genom lagsökning söka betalning ur den egendom vari

inteckningen gäller.

' Senaste lydelse av Blå 197324]. 3 Senaste lydelse 197321074.

ls—

l—"öreslagen lydelse

För fordran som grundar sig på skuldebrev ellerannat skriftligt ford- ringsbevis och är förfallen till betal- ning fär gäldenären lagsökas enligt vad som sägs i det följande.

Om panträtt i fast egendom, skepp eller skeppsbygge ltar skriftli- gen upplätits för en fordran som avses iförsta stycket. kan borgenären genom lagsökning söka betalning ur egendomen. llar borgenären för fordringen inteckning i luftfartyg eller reservdelar till luftfartyg eller företagsinteckning. kan han genom lagsökning söka betalning ur den egendom vari inteckningen gäller.

För en fördran pä ersättning som avsesiZ ellerJ' % lagen (1980-000) om ersättning för inkassokastnader m. ut. får lagsökning äga rutn även om flirt/ringen inte grutular sig på skriftligt fördringsbet'is. En förutsätt- ning är dock att lagst'tkningen äger rutn isamhand med lagsökning enligt första eller andra stycket för den fordran som ltarföranlett den åtgärd som ersättningsanspräket avser.

Lagsökning för fordran pä ersätt- ning som avses i tredje stycketfär äga

Prop. BSO/81:10

Nuvarande [vt/else

Vad i denna la ' sa' 's om uäldenä- & & :.—

ren tillämpas vid lagsökning enligt andra stycket pä ägaren av den egen- dom ur vilken betalning sökes.

Finnas åberopade handlingar ieke innefatta bevis om fordran eller rätt till betalning ur angiven egendom eller prövar rätten eljest hinder möta att upptaga ansökan enligt 1 & första eller andra stycket. skall den avvisas. Bevis därom skall tecknas å ena exemplaret av ansökningen.

1

Gör gäldenären mot kravet ttnnan int-'ändning än i ltloch 1| äs'sägs och vill styrka den. skall han genast förete sina bevis; ej tnå andra än skriftliga bevis gälla. Finnes gäldenä- ren ltava skäl för invämlningcn. lzän— skjute rätten malet såsom tvistigt till

rättegång.

Grundas kravet ä fordringsbevis vari gäldenären betingat sig vederlag för den utfästa betalningen och gör gäldenären invändning som har avseende å vederlaget. skall mälet såsom tvistigt hänskjutz'ts till rätte- gång. om gäldenären fo'rebragt san— nolika skäl för invändningen eller

7” Senaste lydelse link-Wo.

lll

Föreslagen lydelse rttm endast i den mån den fordrade ersättningen kan tttgå enligt lagen om ersättning för ittkassokostnader nt. ut. Vad som sägs i denna lag om gäldenären skall vid lagsökning som avserfastställelse till betalning ur viss egendom tillämpas pa ägaren av egendt'mten.

3 :*

Finner rätten att de handlingar som har åberopats ej utgör bevis om fordran eller rätt till betalning ur den egendom som har angivits eller fin- ner rätten annars att hinder förelig— ger mot att ta upp en ansökan enligt 1 s* första. andra eller tredje stycket. skall den avvisas. Bevis om avvisning skall tecknas pä det ena exemplaret av ansökningen.

&" G ör

in vändning mot kravet än som anges i

gäldenären någon annan lt) och 11 så och vill han styrka sitt invändning. skall han genast förete sina bevis. Ilärvid gäller endast skriftliga bevis. Finner rätten att gäl— denären har skäl för invändningen. skall malet hänskjutas som tvistigt till rättegång.

(.irundas kravet på ett fordringsbe- vis enligt vilket gäldenären skall ha en motprestation för sin betalning och gör gäldenären en invändning skall målet som tvistigt hänskjutas till som gäller molprestationen. rättegäng. om gäldenären har visat sannolika skäl för invändningen eller

Prop. HSO/81:10

Nuvarande lydelse borgenät'cns rätt till betalning eljest finnes stridig.

Föreslagen lvde/se

borgenärens rätt till betalning an- nars är oklar. [.)etsamtna gäller när gt'i/denären gör invändning mot ett krav sotn avser ersättning enligt 3 eller 3 s lagen ( ] 98():t)t)ll) om ersätt-

ning fi't'r inkassoko.stnader tn. ut.

1854

För utf'ående av penningfordran som ej grundar sig (3 skriftligt ford- ringsbevis och icke avser skadestånd äge borgenären utverka betalnings- föreläggande enligt vad nedan sägs.

Betalningsföreläggande må givas avser inkassoät-

för fordra n som

gård.

För att få ltt en penningfordran som inte grundar sig på skriftligt fordringsbevis och inte avser skade- ständ katt borgenären utverka betal- ningsföreläggande enligt vad som sägs i det följant'le.

Betalningsft'tireläggande färges för fordran på ersättning som avses i 2 eller 3 S* lagen (I 98l):()0(l) om ersätt- ning fo'r ittkassokt'tstnatler m.m. [ den mån den fordrade ersättningen katt utgå enligt den lagen.

Denna lag trädcri kraft den .1 juli 1981. Äldre bestämmelser gäller dock fortft-n'ant'le i fräga om kostnad för inkassmttgärd som har vidtagits före nämnda dag.

"1 Senaste lydelse 1071318.

Prop. 1980/81:10 33

5. Förslag till Lag om ändring i rättegångsbalken

Härigenom föreskrivs att 18 kap. ss riittegängslnilken skall ha nedan angivna lydelse.

Nuvarande lydelse föreslagen lydelse

& ä'

Ersättning för rättegängskostnad skall fullt motsvara kostnaden för rättegångens förberedande och talans utförande jämte arvode till ombud eller biträde. sävitt kostnaden skäligen varit pakallad för tillvaratagande av partens rätt. Ersättning skall ock utgä för partens arbete och tidsspillan i anledning av rättegängen. Såsom ätgärd för rättegängens förberedande anses förhandling för biläggande av tvistefräga som har omedelbar betydelse för partens talan.

Inkassot'itgi'ird som vidtagits f'o're rättegången ersättes som rättegångs- kastnad. Ersättning för sådan kost- nad atgår enligt bestämmelser som regeringen meddelar.

Ersättning för rättegängskostnad skall även innefatta ränta efter sex procent från dagen dä målet avgi'ires till dess betalning sker. Denna lag träder i kraft den 1 juli 1981. Äldre bestämmelser gäller dock fortfarande i fråga om kostnad för inkasscnitgärd som har vidtagits före nämnda dag.

' Senaste lydelse 107-12573.

Prop. 1980/81 : 10

6. Förslag till Lag om ändring i lagen ( 1974z8) om rättegången i tvistemål om mindre värden

Härigenom föreskrivs att 8 & lagen ('1974:8) om rättegängen i tvistemäl om mindre värden skall ha nedan angivna lydelse.

Nuvarande lydelse

Ersättning för rättegangskostnad far ej avse annat än kostnad för

1. rädgivning enligt rättshjälpsla- gen (1972—139) vid ett tillfälle för varje instans.

2. ansökningszwgift.

3. resa och uppehälle för part eller ställföreträdare i samband med sam- manträde eller. om personlig instäl- lelse ej föreskrivits. resa och uppe— hälle för ombud.

4. vittnesbevisning.

5. översättning av handling.

6. inkassoåtgt't'rd srmt vidtagits före rii/tegt'lngen.

Ersättning som anges i första st _vckct 3 ()(/t () utgär enligt bestäm— melser som regeringen meddelar.

&

thireslagen lydelse 1

Ersättning för rättegangskostnad far ej avse annat än kostnad för

1. rädgivning enligt rättshjälpsla— gen (1971-1291 vid ett tillfälle för varje instans.

2. ansökningsavgift.

3. resa och uppehälle för part eller ställföreträdare i samband med sam-

tnanträde eller. om personlig instäl- lelse ej föreskrivits. resa och uppe— hälle för ombud. 4.vittnesbevisning.

5. översättning av handling.

Ersättning som anges i första stycket 3 utgär enligt bestämmelser som regeringen meddelar.

Med kostnad som sägs i första stycket 1 jämställes kostnad för annan rådgivning som lämnas av advokat eller biträdande jurist på advokatbyrå. i den man den ej överstiger i rättshjälpslagen bestämd rädgivningsavgift.

Har mal till en början handlagts i annan ordning än enligt denna lag. utgär ersättning för kostnad som uppkommit i samband därmed enligt vad som gäller därom.

Denna lag träder i kraft den 1 juli 1981. Äldre bestämmelser gäller dock fortfarande i fräga om kostnad för inkassoätgärd som har vidtagits före nämnda dag.

' Senaste lydelse l$)77:114-l.

Prop. 1980/81 :10 34

Utdrag

.lUS'l'lTlEDEPA R'l'EMENTET P RO'l'O 1401 .1- vid regeringssammanträde 1 980-114-24

Närvarande: statsministern Fälldin. ordförande. och statsråden Ullsten. Mundebo. Wikstri'im. Friggebo. Mogärd. Åsling. Söder. Krönmark. Buren- stam Linder. Johansson. Wirten. Holm. Boo. Winberg. Adelsohn. Danell. Petri

Föredragande: statsrädet Winberg

Lagrådsremiss med förslag till ändring i kreditupplysningslagen (l973:1173). m. m. '

1. Inledning

Den yrkesmässigt bedrivna kreditupplysningsverksamheten regleras i första hand genom kreditupplysningslagcn (1973zll73. ändrad 1975:742). medan den yrkesmässiga inkassoverksamheten regleras genom inkassolagen (19741183. ändrad 1975z744). Ett väsentligt syfte med häda lagarna är att ge skydd mot kränkningar av den personliga integriteten. Efterlevnaden av lagarna står under offentlig tillsyn genom datainspektionen.

Datainspektionen överlämnade i november 1977 till _justitiedepartementet tvä promemorior om inspektionens erfarenheter från tillämpningen av krcditupplysningslagen resp. inkassolagen . l promemoriorna redovisades ätskilliga problem från den praktiska tillämpningen som kunde ge anledning till en översyn av de häda lagarna. Frågan om en översyn togs ocksä tipp i en motion vid 1977/78 ärs riksmöte (WW/78799). Med anledning av motionen uttalade riksdagen att det fanns skäl att ändra och komplettera kreditupp- lysningslagen och inkassolagen i olika hänseenden (NU 1977i7äz53).

En gäldenärs skyldighet att ersätta borgenärens kostnad för inkassoätgär— der regleras f. n. genom bestämmelser i 13 kap. Bä rättegängsbalken samt i 15 och 22 ss Iagsökningslagcn (1946308. ändrad senast 1977z598) och den anslutande kungörelsen ( 1974:811 ) om ersättning för inkassokostnad och kostnad i mål om lagsökning eller betalningsföreläggande (inkassokostnads- kungörelsen. ändrad senast 19791331).

Genom beslut den 2 december 1976 uppdrog regeringen är datainspektio-

Inledning

Prop. HSO/81:10 25

nen att undersöka inkassoft'iretagens faktiska kostnader för bl. a. inkassoät— gärdet och att komtna med förslag till en mera långsiktig reglering av ersättningen för sådana kostnader. Datainspektionen redm'isadc sitt upp- drag i en den 20 juni 1978 dagtecknad utredning. där inspektionen lade fratn sina överväganden beträflande en längsiktig reglering av crsättningsbelop- pens storlek. Vidare föreslog inspekticmcn en ny lagstiftning rörande rätten till ersättning för inkassokostnad. Detta förslag innebar i huvudsak att ersättningsrätten skulle regleras genom bestämmelser av civilrättslig natur och inte som f. n. behandlas som en rätt till ersättning för processkost- nad.

Pa grundval av datainspektionens promemorior och utredning om inkassokostnader utarbetades inom justitiedepartementct prometm'n'ian (Ds .ln 197018) Kreditupplysning och inkasso. Departementspromenu'n'ian inne- haller förslag till ändringar i kreditupplysningslagen och inkassolagcn samt förslag till en ny lag om ersättning för inkassokostnad och därav föranledda ändringar i bl. a. lagsökningslagen. Till promemorian har fogats datainspek- tionens utredning om inkassokostnader.

Departementspromemorian har jämte avsnitten 7 och S i datainspektio- nens utredning om inkassokostnader remissbehandlats.

Till protokollet i detta ärende bör fogas dels som bilaga I de lagförslag som har lilgts fram i departementspromemorian. dels som bilaga 2 avsnitten 7 och Si datainspektionens utredning om inkassokostnader med en därtill hörande bilaga. dels som bilaga 3 en förteckning över de remissinstanser som har yttrat sig i ärendet och en sammanställning av remissyttrant'lena.

2 Gällande rätt 2.1 Kreditupplysningslagen

Kreditupplysningslagen syftar främst till att hindra att kreditupplysnings— verksamhet leder till otillbörligt inträng i den personliga integriteten eller till skada genom oriktiga eller missvisande upplysningar. lifterlevnaden av lagen star under tillsyn av datainspektioncn.

Lagen gäller enligt 1 # för yrkesmässigt bedriven kreditupplysningsverk- samhet. Härmed avses i första hand sädan kreditupplysningsverksamhct som bedrivs i förvärvssyfte. dvs. framför allt de egentliga krcditupplysningsföre- tagens verksamhet. Vidare ('unfattas den kret'litupplysningsserviee som lämnas av banker och andra kreditinrättningar samt av branschföreningar och liknande företagarorganisaticmer.

Utöver den krets som nu har angetts är lagen avsedd att gälla i princip all kreditupplysningsförmedling som ingär som ett led i en viss näringsverksam— het. När det gäller företag utanför den egentliga kreditupplysningssektorn krävs emellertid att kreditupplysningsverksamheten inte är av alltför obetydlig (nnfattning för att den skall omfattas av lagen. Sädan förmedling av

( fällande rätt

l'rop. HSO/81:10 30

kreditupplysningar som förekommer t. ex. pä advokat— eller revisirmsbyräer torde sälunda normalt falla utanfih' lagen (se beträffande det nu anförda prop. 19731155 s. Bo).

Fran tillämpningen av kreditupplysningslageu undantas intern förmedling av kreditupplysningar mellan kreditinrättningar. i den man det är fräga om Sveriges riksbank. Sveriges investeringsbank AB eller kreditim'ättning under bankinspektionens tillsyn. Lagen är emellertid i sin helhet tillämplig i den män lmnk eller annan kreditim't'ittning förmedlar kreditupplysningar utanför den angivna kretsen. Fran tillämpningen av lagen undantas vidare intern förmedling av kredilupplysningar mellan företag inom samma koncern.

l praxis har det av affärsbankerna_ Sparbankernt-ts bank och Sveriges föreningsbankcrs förbund gemensamt ägda krcditupplysningsförctaget Upp— lysningscentralen UC AB. som enligt sin av regeringen godkända bolags- ordning stär under bankinspektionens tillsyn. jämställts med sadana kredit- inrättningar som är undantagna frän lagen när det gäller deras interna förmedling av kreditupplysning. Detta företag ombesörjer numera huvud- delen av bankernas interna kreditupplysningsförmcdling.

Kreditupplysningslagen omfattar även yrkesmässig kreditupplysnings— verksamhet som bedrivs genom offentliggörande av kreditupplysningar i tryckt skrift. Utrymme för detta lämnas genom bestämmelserna i 1 kap. l) s* 3 tryckfrihctsförordningen. Förutsättningarmt för att kreditupplysningsverk- samhet genom tryckt skrift skall anses yrkesmässig är enligt motiven till kreditupplysningslagcn desamma som för annan kreditupplysningsverksam- het. Lagen omfattar dock inte utgivande av dagstidningar eller tidskrifter som huvudsakligen innehaller allmänt inft>rmationsmaterial (prop. 1973: 155 s. Bo).

Med kreditupplysning avses enligt _7 s* uppgift. omdöme eller räd som lämnas till ledning för bedömning av annans kreditvärdighet eller vederhäf— tighet i övrigt i ekonomiskt hänseende. En speciell typ av kreditupplysning. för vilken gäller särskilda skyddsregler. är den s. k. personupplysningen. Med detta uttryck avses kreditupplysning om enskild person. förutsatt att vederbörande varken är näringsidkare eller har sa väsentligt inflytande i viss näringsverksamhet att uppgift om hans egna förhällant'len behövs för att belysa verksamhetens ekonomiska ställning. Kreditupplysningar som inte utgör personupplysningar brukar kallas företagsupplysningar.

För yrkesmässig kreditupplysningsverksamhet som bedrivs pä annat sätt än genom offentliggörande av upplysningar i tryckt skrift krävs tillständ av datainspektionen enligt bestämmelser i 3 och 4 N'. 'lillständ ges för högst tio äri sänder. Det fär meddelas endast om det frän allmänna- synpunkter finns behov av verksamheten och denna kan antas bli bedriven pä ett sakkunnigt och omdömesgillt sätt. Tillstand fär förenas med föreskrifter rörande verksamheten. För att hindra utländskt ägarinflytandc över kreditupplys- ningsverksamhet vilken ofta bygger pä omfattande registrering av uppgifter om bl. a. företag och enskilda personer gäller enligt 4 i att tillstand inte far

Gällande rill!

Prop. [980/81 : lt) 37

meddelas nägon som enligt lagen ( tvn»: [Sot om vissa inskränknirrgari rätten att förvärva fast egendom m. m. är underkastad sädan inskränkning.

Kreditupplysningsverksamhct skall enligt 5 35 bedrivas sä att den inte leder till otillbörligt inträngi personlig integritet. Denna allmänna. grundläggande regel kompletteras i olika hänseenden av mera detaljerade fi'rrcskrifter.

Hit hör till en början bestämmclscrna i (> s”. som pä närmare angivet sätt förbjuder att särskilt ömtälig och integritetskränkant'le information insamlas. lagras eller lämnas ut i kreditupplysnirrgsverksamhct. Exempel pä sädan information är uppgifter om politisk eller religiös uppfattning. ras. hudfärg. ht'ilsotillständ. brottslighet och sociala ingripanden.

! fräga om personupplysningar gäller ytterligare begränsningar av rätten att lagra och lämna ut information. lin personupplysning fär enligt 7.6 i princip inte innehalla uppgift om betalningsförsummelse som inte har fastställts pä visst auktoritativt sätt. t. ex. genom avgörande av domstol eller annan myndighet. Datainspcktionen kan dock medge undantag. L—"nligtS 9” får personupplysning inte heller innehälla uppgift om fi'irhällande som ligger fem är eller längre tillbaka i tiden. En uppgift som inte fär lämnas trt enligt 7 eller S & fär inte heller lagras i register. (Äienom bestämmelser i () Q' ges vidare ett visst skydd mot att en personupplysning lämnas ut till nägon som inte har ett legitimt behov av upplysningen. 9,5 gäller dock inte personapplysning som offentliggörs i tryckt skrift.

Lagen innehäller vidare bestämmelser om insytt i kreditupplysningsverk- samhet. Enligt 1!) s* har var och en rätt att mot en skälig avgift fä skriftligt besked om de uppgifter som finns lagrade om honom hos den som bedriver kreditupplysningsverksarrrhet. En sädan rätt gäller för säväl juridiska personer som enskilda näringsidkare och privatpersoner. Det bör framhällas att bestämmelsen i ll.) & inte inskränker den skyldighet som ett kreditupp- lysnirrgsföretag kan ha enligt 10 & datalagerr (197339. ändrad senast 19791334) att pä begäran kostnadsfritt lämna enskild person besked om uppgifter rörande honom i ADB—register. Sädant besked behöver ä andra sidan lämnas endast en gäng per är.

Beträffande perst'umrpplysning gäller dessutom enligt ll s* att. när sädan upplysning lämnas, ett skriftligt meddelande om upplysningens innehäll skall samtidigt lämnas kostnadsfritt till den som upplysningen avser. s. k. personttpplysningskopia. Skyldigheten att lämna en sädan kopia gäller dock inte i fräga om persontrpplysning som offentliggörs i tryckt skrift.

Kan det misstänkas att en uppgift i kreditupplysningsr'egister eller i kreditttpplysning som har lämnats under det senaste äret är oriktig eller missvisande. gäller enligt lZ s* kredittrpplysningslagen att den som bedriver verksamheten är skyldig att göra den utredning som skäligen kan fordras och att pä närmare angivet sätt vidta den rättelse som behövs.

Som tidigare nämnts ger () 5 ett skydd mot att enpersonapplysning i det enskilda fallet lämnas ut till tttnyttjande av nagon som kan betraktas som obehörig. l—läruti'iver innehäller lagen bestämmelser som mera generellt

Gällande räl!

Prop. HSO/81:10 gg

syftar till att hindra obehörig spridning av uppgifter som har samlats in och lagrats i kreditupplysningsverksamhet. Enligt [3 $ gäller sälunda bl. a. att register inte fär överlätas eller trpplätas till annan utan medgivande av datairrspektionen. I 14 .$ ges vidare en bestämmelse om tystnadsplikt för den som är eller har varit verksam i kreditupplysrringsverksamhet.

[ lie/8 $,$ finns bestämmelser om datainspektiorrens tillsynsverksarrrlret enligt lagen. Bl. a. gäller att datainspektionen har rätt att företa inspektion hos den som bedriver kreditupplysaingsvcrksamhet. (')m den som har fatt tillständ att bedriva kreditupplysningsverksamhet ZlSlth.)StlltCl' en bestämmel- se i lagen eller en föreskrift som har meddelats med stöd av lagen. fär datainspektiorrerr meddela nya eller ändrade föreskrifter. | sista hand kan inspektionen aterkalla tillständet.

Till en del är reglerna i kreditupplysningslagerr straffsanktioncrade. _Stral'fbestämrnelserna finns i If) $. Vid vissa förfaranden i strid mot lagen kan kreditupplysningsregister förklaras förverkat enligt 20 .$.

Lagen innehäller även bestämmelser om skadestand. Den som bedriver krcditupplysningsverksamhct skall enligt 2/ .$ ersätta skada som till följd av verksamheten tillfogas nägon genom otillbri'rrligt inträng i hans personliga integritet eller genom att oriktig uppgift lämnas om lronorrr. Ersättning kan utgä även för s. k. ideell skada. Skyldighet att utge skadeständ inträder dock inte. om den som bedriver verksamheten kan visa att tillbörlig omsorg och varsamhet har iakttagits.

Enligt 22 .$ kan datainspektionen förelägga vite för att framtvinga att ltt, 11. 12 eller ros efterlevs.

Datainspektionens beslut enligt kreditupplysningslagen kan enligt 3.i.$ överklagas hos regeringen. Justitiekanslern fär föra talan för att ta till vara allmänna intressen.

2.2 lnkassolagcn

lnkassolagerr syftar i första hand till att undanröja riskerna för att gäldenärer utsätts för otillbörliga inkassoätgärder eller i ("övrigt tillfogas onödig skada eller olägenhet genom inkassoverksamhet. Datainspektionen utövar tillsyn över efterlevnat'len av lagen.

Lagen gäller enligt I .$ inkassoverksarnlret som bedrivs _vrkesm'. sigt. Med yrkesmässig inkassoverksamhet avses i princip all indrivning som ingär som ett led i en viss näringsvcrksamhet. oavsett om indrivningen avser egna eller andras fordringar. Detta innebär att lagen omfattar inte bara de egentliga inkassoföretagen utan ocksä en stor del av landets övriga företag och andra näringsidkare. eftersom dessa som regel i större eller mindre utsträckning sysslar med att driva in i vart fall egna for't'lringar. Under begreppet yrkesmässig inkassoverksarnlret faller ocksä sädan inkassoverksamhet för annans räkning som bedrivs av banker och advokater samt av bransclrfi'ir- eningar och liknande företagarorganisationer. Enligt förarbetena krävs dock

Gällande rät!

l'rop. 1980/81: lt) 29

att inkassoverksamlreten inte är av alltför obetydlig omfattning (prop. 1974:42 s. HB f). Med ink;

betalning för en fordran. Enligt förarbetena innebär denna definition ett krav

”sot-'erksamhct förstas i lagen verksamhet med syfte att driva in

pä att verksamheten har ett inslag av-hot eller tväng. En typisk irrkassoätgärd är att sända ut kravbrev med hot om att rättslig ätgärd kommer att vidtas. orn betalning inte sker frivilligt. Åtgärder som endast innebär en ren pänrinnelse om betalningsskyldighet. t. ex. att sända ut en bctalnirrgsavi. faller däremot utanför begreppet inkassm'erksamhet (prop. [Walz—ll s.l(13).

Enligt 2 .$ krävs i vissa fall tillständ av datainspcktiorren för rätten att bedriva yrkesmässig inkassovcrksamlret. Detta gäller sädan inkassrwerksam- het som avser indrivning av h_rrdringar för annans räkning eller fordringar som har övertagits för indrivning. Tillständ behövs dock inte för inkasso- verksarnhet som bedrivs av Sveriges riksbank. Sveriges investeringsbank AB. kreditinrättning under bankinspektiorrcns tillsyn eller advokat. linligt .? ,$ fär tillständ meddelas endast om verksamheten kan antas bli bedriven pä ett sakkunnigt och omdömesgillt sätt. 'l'illstärrd meddelas för en tid av högst tio är i sänder och fär förenas med föreskrifter rörande verksarrrhcten.

Enligt 4.$ skall all yrkesmässig inkassoverksamhet bedrivas enligt god inkassosed. Därvid skall iakttas att en gäldenär inte vällas onödig skada eller olägenhet eller utsätts för otillbörlig pätryckrring eller annan otillbörlig inkassot'rtgärd. Det har fi'irutsatts att begreppet god inkassosed skall fyllas trt och närmare preciseras bl. a. genom föreskrifter av datainspektionen. [ vissa hänseenden innehäller lagen emellertid säfskilda besti'rnrmelser.

Krav mot en gäldenär skall enligt 5 .$ framställas skriftligen samt innehälla vissa närmare angivna uppgifter om borgenärens anspräk. Det skall ocksä anges en viss skälig tid inom vilken gäldenären skall betala frivilligt eller framställa invändning rrrot kravet. Rättslig '.'tgärd rrred anledning av en fordran fär enligt () ,$ inte vidtas förrän krav har tillställts gäldenären och den angivna tiden har löpt ut. Detta gäller dock inte. om gäldenären uppenbar- ligen söker undandra sig att betala eller om det annars föreligger särskilda skäl (7 $). Enligt 8 $ bör inkassoi'itgärd över huvud taget inte vidtas. om det föreligger sannolika skäl för att en fordran inte är lagligen grundad c. d.

1 9,$ ges en regel som innebär att gäldenären alltid har rätt att med befriande verkan betala till den som har borgenärens uppdrag att driva in fordringen. Betalning till denne är gällande rrrot borgenären.

Lagen innehäller ocksä vissa bestämmelser som tar sikte pä förhällandet mellan borgenären och den som driver in hans fordran. Den som har inkasserat medel för annans räkning skall sälunda enligt I().$ hälla dessa rrrcdcl avskilda och utan dröjsmäl sätta in dem pä räkning i bank eller motsvarande. l-lar annat inte avtalats. skall medlen tttarr dröjsmäl redovisas till huvudmannen.

[ II .$ föreskrivs viss tystnadsplikt för den som är eller har varit verksam i sädan yrkesmässig inkassoverksamhet som fordrar tillständ enligt lagen.

Gällande riitt

Prop. l980/8l : ltl 30

Datainspektionens tillsyn över att inkassolagen efterlevs gäller säväl tillständspliktig som icke tillständspliktig yrkesmässig inkassoverksamhet. Inspektionens tillsyn omfattar dock inte verksamhet som bedrivs av Sveriges riksbank. Sveriges im-esteringsbank AB. kreditin rättning under bankinspek— tionens tillsyn eller advokat. Bestämmelser rörande tillsynen finns i Lvl—lh N'. Datainspektionen har enligt 14 s* bl. a. rätt att företa inspektion hos den som bedriver inkassoverksamhet. [för att framtvinga att god inkassosed iakttas och att lagen i övrigt efterlevs fär inspektionen enligt 15 s* meddela de ft'h'eskrifter som föranleds av tillsynen. Sadan föreskrift fär förenas med vite. Beträffande den sotn har erhallit tillstand att bedriva inkassoverksamhet kan datainspektioncn i sista hand äterkalla tillstandet.

l [7 s* finns bestämmelser om straff för vissa förfarant'len i strid mot lagen. Den som uppsatligen eller av ("saktsamhct bedriver inkassoverksambet utan erforderligt tillständ kan dömas till böter eller fängelse i högst ett är. Ä-"lotsvarandc gäller. om den som bedriver inkassoverksamhet lämnar osann uppgift i upplysning som datainspektitmen begär för sin tillsyn.

Lagen innehäller även bestämmelser om skadestandsskyldighet. Den som bedriver yrkesmässig inkassoverksamhet är sälunda enligt 18 s' skyldig att ersätta skada som till följd av verksamheten tillfogas nägon genom otillbörlig pätryckning eller annan otillbörlig inkassm'itgärd. Ersättning kan utgä även för s.k. ideell skada.

Datainspektionens beslttt enligt inkassolagen kan överklagas hos regering- en. Justitiekanslern fär föra talan för att ta till vara allmänna intressen (!() f).

2.3 Regler om gäldenärers skyldighet att ersätta kostnader för inkassoätgär- der

Genom lagändring ar l*)7l infördes i lä kap. Så rättegängslmlken regler om skyldighet för en gäldenär att ersätta kostnad för inkassoätgärd sotn har vidtagits före en rättegang. Kostnaden ersätts som rättegängskostnad. Ersättningen utgär enligt bestämmelser som regeringen meddelar. Dessa finns ntttnerai inkassokostnadskungörelsen. Ersättning utgar f. n. med högst 55 kr. i fraga om krav som avses i 5 & inkassolagen och med 45 kr. i fräga om amorteringsplan som har tillkommit i samband med fordringens inkassering. En förutsättning är dock att ätgärden skäligen har varit pakallad för att ta till vara borgenärens rätt. (_)m särskilda skäl föreligger. får ersättning utgä med högre belopp. Reglerna medför inte rätt till ersättning för mindre kostnads- krävande atgärder. t. ex. enkla betalningspäminnelser (jfr prop. l97lzltlS s. 19).

h-lotsvarande bestämmelser gäller i mäl om lagsökning eller betalningsfö— reläggandc. om en inkassoätgärd har vidtagits före ansökan om sadant förfarande (15 och 23 ss lagsökningslagen samt 2 & inkasst»kostnadskungö— relsen).

Gäl/(mde räl!

l'rop. HSO/81:10 31

Den reglering som nu har berörts är som framgätt tillämplig endast om en inkasst'u'ttgärd har följts av rättegäng eller ansökan om lagsökning eller betalningsl't'u'eläggande. Det finns inte nägra direkt tillämpliga författnings— regler om ersättning för inkassokostnad i den situationen att gäldenären betalar huvudfordringen jätnte eventuell ränta innan saken har gätt sa längt som till process. (iäldenären anses emellertid även i sädant fall vara skyldig att ersätta inkassokt'mstnad. och det har förutsatts att de tidigare redovisade reglerna om ersättningens storlek m.m. i praktiken konuner att vara vägledande även i denna situation (jfr prop. [Q'/11105 s. 10). Datainspektio- nen har i sin tillsynsvcrksamhet beträffande inkassolagen ansett skyldigheten att iaktta god inkassosed innebära att inkassoföretag och andra inte bör betinga sig högre ersättning för inkassokostnad av gäldenären än vad en domstol skulle döma ut för en motsvarande inkassru'ttgärd. Nägot hinder torde dock inte fi'n"eligg:t mot att en borgenär genom avtal med gäldenären betingar sig ersättning även för sädana enkla betalningspäminnelser som borgenären inte kan fa ersättning för enligt de nyss berörda processuella reglerna. Att sända ut en sädan betalningspaminnelse faller inte under inkassolagen (se avsnitt 2.2 ovan).

3 Departementspromemorian

Här redovisas kt'utfattat förslagen i departementspromemorian. En närmare redogörelse för dem lämnas senare i anslutning till belntndlingen av de olika aktuella frågorna.

3.1. Kreditupplysningslagen

Enligt departementspromemorian bör kreditttpplysningslagens tillämp— ningsomräde (l :$) behällas i sak oföränt'lrat. Begreppet "yrkesmässigt bedriven kreditupplysningsverksamhet" föresläs emellertid bli ersatt med en tydligare beskrivning av tillämpningsomrädet. När det gäller undantaget för intern förmedling av kredituppl_vsning:u' mellan bl.a. kreditinrättningar under bankinspektionens tillsyn föresläs i promemorian att sädana finans- bolag som enligt den numera antagna lagen (19802) om finanslmlag ställs under bankinspektionens tillsyn även i ft'u'tsättningcn skall omfattas av kredittmplysningslagen och alltsä inte falla under det nämnda undantaget. Vidare föresläs ett tillägg till l s som innebär att det av bankerna gemensamt ägda kreditupplysningsft'iretaget LIpplysningsccntralcn UC AB uttryckligen likställs med annan kreditinrättning under bankinspektionens tillsyn än finansbolag.

Medan definitionen av begreppet kreditupplysning behälls oft'n'z'indrad föresläs i fräga om begreppet personupplysning en betydelsefull ändring (2 %$). Enligt förslaget skall sälunda persontnmlysning i fortsättningen innefatta varje kreditupplysning om enskild fysisk person. Detta innebär att

Delarna/neutr- pronwmm'ian

' Prop. [980/81 : 10 32

även sädana kreditupplysningar om enskilda näringsidkare och andra personer med ett väsentligt inflytande i viss näringsverksamhet som tidigare har betraktats som s. k. företagsupplysningar skall falla under de särskilda skyddsreglerna beträffande personupplysningar (7. 8. 9 och ll ss).

Bestämmelserna om tillständ till krcditupplysningsverksamhet bör enligt promemmian behällas i huvudsak oförändrade (3 och 4 st). Vissa ändringar föresläs dock. Bl. a. skall datainspektionen ges rätt att förena ett tillständ med föreskrift om skyldighet att anmäla ändring av förhallande som har haft betydelse för tillstandet (4 ä).

Nägon ändring föresläs inte i den grundläggande regeln om hur kredit-

r

upplysningsverksamhet skall bedrivas (5 s'). Däremot ft'öresläs vissa ändring- ar i de bestämmelser som närmare fyller ut denna regel. Sälunda föresläs att bestämmelsen om förbud mot hantering av viss särskilt ömtälig personlig information ((1 &) kompletteras med ett förbud även mot uppgifter om atgärder enligt viss ytterligare lagstiftning.

Bestämmelserna i 7—9 st. vilka gäller personupplysningar. skall som tidigare nämnts enligt promemt'n'iefi'irslaget fä ett vidare tillämpningsomräde och omfatta även kreditupplysningar om enskilda näringsidkare o. d.

Beträffande 7 s. som i princip fifsrbjuder uppgift i personupplysningar om en inte tillförlitligt fastställd hetalningslth'summelsc. föresläs i promemm'ian en ändring av bestämmelsen om att datainspektionen fär tnedgc undantag frän detta förbud. Ändringen innebär dels att dispensrätten läggs hos regeringen men med möjlighet att delegera den till datainspektionen. dels att förutsättningarna för att medge undantag anges närmare.

I H & föresläs den ändringen. att gränsen för hur gamla kreditupplysnings— uppgifter som fär lämnas ut i personupplysningar sänks frän fem är till tre är beträffande uppgifter i allmänhet. Främst pä grttnd av att paragralen enligt förslaget skall gälla även för kreditupplysningar om enskilda näringsidkare o. d. föreslas emellertid att femärsgränsen behälls för vissa i sammanhanget särskilt betydelsefulla uppgifter.

| fräga o1119 s. som i princip innebär att personupplysning inte fär lämnas ut till annan än den som har ett legitimt behov av upplysningen. görs i promemmian vissa uttalanden om htlr paragrafen bör tillämpas beträffande s. k. äkta make-upplysningar. dvs. personupplysningar som när en make har sökt kredit e. d. lämnas även om andra maken.

När det gäller bestämmelsen om att var och en har rätt att mot skälig avgift fä besked om innehallet i de uppgifter som finns lagrade om honom ( lt) s) föresläs ett tillägg som klargör att bestämmelsen t'anfattar även rätt till besked om att det inte finns nägra uppgifter lagrade. Den föreslagna ändringen motsvarar det tillägg som genom en tidigare författningsändring (SFS l()79:33»l) har gjorts i lt) & datalagen.

Bestämmelsen i llä om rätt till s. k. persouupplysningskopia fär som tidigare har berörts enligt förslaget ett utvidgat tillämpningsomräde.

Därjämte föresläs i promemorian ett par andra viktiga ändringar i

I.)epurtcmelits- promemorian

.u '_u

Prop. msn/81:10

paragrafen. För det första föresläs sälunda att. till skillnad fran vad som nu gäller enligt lagen. besked i frntsättningen skall lämnas även om för vems räkning pet'st'mupplysningen har begärts. Bl. a. underlättas härigentjun legitimitetskrmtrollen enligt 9 & Vidare föresläs vissa regler sotn gäller den situationen att det som ett led i en perstmupplysning har lämnats uppgifter även om en annan person. som t. ex. vid en äkta make-upplysning.

Bestämmelserna om rättelse av oriktiga eller missvisande uppgifter i kreditunlvsnin yar och register (lZ &) bör enligt n'omemorian behällas i . ll . £— - . _ huvudsak oförändrade. l promemorian görs emellertid vissa uttalanden om deras tillämpning.

l bestämmelserna om överlätelse och upplätelse av register i kreditupp- lysningsverksamhet och om hantering av sådant register när en kreditupp- lysningsverksamhct upphör ( l3 s*) föresläs ett tillägg. Detta innebär" att den som bedriver verksamheten skall göra anmälan till datainspektionen även när ett register skall kasseras och att inspektit'men dä fär föreskriva hur man skall förfara med registret.

Reglerna om datainspektionens tillsyn över kreditttpplysningsverksambet (IS—lx åå) föresläs stä kvar utan väsentlig ändring. [ syfte att underlätta inspektirmens tillsyn över kreditupplysningsverksamhet som bedrivs genom utgivande av tryckt skrift föresläs emellertid en ny bestämmelse i 16 's. Enligt denna skall den som bedriver sädan verksamhet inom en vecka efter utgivandet av skriften kostnadsfritt tillställa datainspektionen ett exemplar av denna.

'l bestämmelserna om straff (19 å) och fi'itverkande av register (2tlå) föresläs vissa justeringar och tillägg som föranleds av olika förslag som tidigare har berörts. Däremot föresläs inte nägon ändring i bestämmelserna om skadeständ (Zl ä). vite (22 å) och talan mot datainspektionens beslut (23 å).

Lagen gäller som tidigare har framgätt även för kreditupplysningsverk- samhet som bedrivs genom offentliggörande av kreditupplysningar i tryckt skrift. För sädan verksamhet gäller emellertid vissa särskilda regler som bl. a. hänger samman med skyddet för tryckfriheten (se 3. 9. l 1 och D ss). Sedan kreditupplysningslagen kom till har genom en ändring i tryckfrihetsförord- ningen en del icke tryckta skrifter i tryckfrihetsrättsligt hänseende jämställts med tryckt skrift. Detta gäller enligt 1 kap. 55 tryckfrihetsförordningen under vissa förutsi'ittningar skrift som har mängfaldigats genom steneilering. fotokopiering eller liknande tekniskt förl'arant'le. l promemorian föresläs att dessa skrifter även enligt kreditupplysningslagen i vissa hänseenden jämställs med tryckta kreditupplysningsskrifter. Detta bör emellertid enligt prome- morian gälla endast i fräga om undantaget frän tillständsplikten (3 s*). de särskilda reglerna om rättelse (12 si) och den föreslagna nya bestämmelsen om skyldighet att leverera kreditupplysningsskrift till datainspektionen (16 å). Däremot bör enligt promemorian regeln om legitimitetskontroll vid personupplysning (9 &) och bestämmelserna om pCl"S(.)l1le)l)-"Sl'llngSkthlzt

3 Riksdctgmi [MW)./8! . ] saml. Nr 1!)

Delmrtements- prmm'morian

Prop. 1980/81 : 10 _ 34

(ll &) gälla i fräga om personupplysningar som lämnas genom sädana stenciler m. ut. som i övrigt jämställs med tryckta skrifter.

Ändringarna i kreditupplysningslagen skall enligt promemm'icft'h'slaget träda i kraft den I juli 1980.

3.2. Inkassolagen

[ promemorian föresläs att inkassolagens tillämpningsomräde (l ;) utvidgas till att omfatta även sädan inkassoverksamhet som f. n. inte faller under lagen. Undantag skall dock fortfarande gälla för enskild persons eller dödsbos verksamhet för indrivning av egen fordran som inte har uppkommit i näringsverksamhet och inte heller har ("övertagits för indrivning. Givetvis skall även exekutiv myndighets verksamhet vara undantagen. Vidare föresläs att begreppet "inkasstwcrksamhet" definieras tydligare än f. n. Syftet är bl.a. att i enlighet med önskemäl frän datainspektionen klart undanta utsändande av helt neutrala betalningspäminnelser frän tillämp- ningen av lagen.

Enligt promemorian bör man i princip behälla kravet pä tillständ av datainspektionen för yrkesmässigt bedriven inkassoverksamhet som avser indrivning av fordringar för annans räkning eller fordringar som har övertagits för indrivning (2 s). Nägra ändringar av tillständsbestämmelserna föresläs emellertid. En ändring hänger samman med att begreppet "yrkes- mässigt bedriven inkassoverksamhet" utmt.)nstras som beskrivning av lagens tillämpningstmiräde. Ändringen innebär att tillsti'tndsplikten inte skall gälla för inkz'tssoverksamhet som är av tillfällig natur och avser endast enstaka fordringar. Vidare föresläs att det nuvarande undantaget frän tillständsplik- ten för inkasstwerksamhet som bedrivs av kreditinrättning under bankin- spektionens tillsyn utformas sä attdet klart framgår att bl. a. finansbolag som avses i lagen om finansbolag skall omfattas av undantaget.

l promemorian föresläs ocksä ett par helt nya undantag från tillständs— plikten. Det ena gäller inkassm-erksamhet som utgör ett underordnat led i en annan verksamhet som bedrivs utan förvärvssyfte. Det andra nya undantaget avser s. k. koncerninkasso. dvs. inkassoverksamhet som bedrivs av ett företag för annat företag som tillhör samma koncern. l anslutning till dessa regler föresläs emellertid en särskild bestämmelse som hindrar att de nya undantagen utnyttjas för att kringgä tillständsplikten.

Bestämmelserna om meddelande av tillständ (3 &) föresläs kompletterade med en bestämmelse som —- i likhet med vad som föresläs i fräga om tillständ enligt kreditupplysningslagenger datainspektionen rätt att förena ett tillständ med föreskrift om skyldighet att anmäla ändring av förhz'tllande som har haft betydelse för tillständet.

Den grunt'lläggande regeln om att inkassoverksamhet skall bedrivas enligt god inkassosed sä att gäldenären inte vällas onödig skadae. d. (4 :$) bör enligt promemorian behällas oft'farändrad.

Beträffande bestämmelserna om utformningen av krav mot gäldenär (5 &)

I_')eparlemenr.r- promemorian

'JI

:

Prop. HSO/81:10

föresläs en del kompletteringar. Sälunda föresläs uttryckliga föreskrifter om att ett krav alltid skall innehälla bl.a. tydlig uppgift om grunden för fordringen samt anvisning om lämpligt betalningssätt. Är det fräga om en fordran som har överlätits eller pantsatts och kan gäldenären pä grund därav inte med befriande verkan betala till överlätare eller pantsättare. skall vidare tydlig upplysning om detta förhållande lämnas i kravet.

l bestämmelsen om att rättslig ätgärd inte fär vidtas förrän gäldenären har tillställts krav enligt 5 s och den i kravet angivna tidsfristen har löpt ut (o s*) föresläs inte nägon ändring. Däremot görs i promemorian uttalanden om tillämpningen av 5 och 6 åå när det gäller vissa ränteanspräk.

Enligt 7 s' gäller inte bestämmelserna om krav före rättslig ätgärd. om gäldenären uppenbarligen ft'fn'söker undandra sig att betala eller om det annars föreligger särskilda skäl. l promemtnian föreslås att bestämmelsernai 5 &? om själva utformningen av ett krav dock inte skall fä frängäs ens i en sadan situation. om ett krav ändä kommer i fräga före den rättsliga ätgärden.

[ lt) å. som reglerar ett inkassmnnbuds hantering av inkasserade medel. föresläs vissa ändringar beträffande skyldigheten att hälla sädana medel avskilda. lin ändring betingas av den föreslagna utvidgningen av lagens tillämpningsmnräde och innebär att skyldigheten att titan dröjsmäl sätta in inkasserade medel på bankräkning eller motsvarande inte skall gälla. om medlen har uppburits i inkassoverksamhet som är av tillfällig natur och avser endast enstaka fordringar. En annan ändring tar sikte pä den situationen att den som får en borgenärs uppdrag att driva in en fordran redan har ett annat. fortli'ipande uppdrag av borgenären att i väsentlig omfattning uppbära medel för dennes räkning utan skyldighet att hälla dessa medel avskilda. För sädana fall f("iresläs att parterna skall kunna träffa en skriftlig överenskommelse om undantag frän skyldigheten enligt inkassolagen att hälla inkasserade medel avskilda.

Beträffande bestämmelserna om tystnadsplikt i inkasstwerksamhet (11 %) föresläs vissa ändringar som hänger samman med de föreslagna ändringarna av tillständspliktens ('nnfattning. Enligt förslaget skall tilläm|mingsomra'tdet för reglerna om tystnadsplikt inte längre kopplas ihop med tillständsplikten. I stället föresläs att tystnadsplikten skall gälla för den som är eller har varit verksam i inkassoverksamhet avseende indrivning av fordringar för annans räkning eller av fordringar som har övertagits för indrivning.

F. n. finns inte i inkassolagen nägra särskilda bestämmelser om register som används i inkassoverksamhet. För personregister som förs med hjälp av ADB gäller dock datalagen. I promemorian föreslås att inkassolagen kompletteras med bestämmelser om gäldenärsregister i tillståndspliktig inkassoverksamhet. Förslaget är på denna punkt utformat i överensstäm- melse med reglerna i 135 kreditupplysningslagen . Enligt förslaget skall bestämmelserna om gäldenärsregister tas upp i en ny paragraf, 10a lå. i inkassolagen .

[ bestämmelserna om straff (17 &) föreslås en del ändringar som beror av

Delmrtemt'nls- . promwnurimz

Prop. 1980/81 : l0 36

vissa tidigare berörda förslag. Bl. a. föresläs regler om straff för brott mot de nya bestämmelserna om gäldenärsregister. Vidare föresläs. efter mönster från 20.5 kreditupplysningslagen . regler om förverkande av register.

[ ett särskilt avsnitt av promemmian behandlas. med anledning av anmärkningar av datainspektionen. fragor om förhällant'let mellan inkasso- lagen och viss annan lagstiftning. Det gäller bl. a. konkurslagen(1921 :225). 12 kap. 44 å jordalmlken och 35 % bostadsrättslagen(197lz479) samt lagen (1971 : 1 12) om förbud mot oskäliga avtalsvillkor (avtalsvillkorslagen). Nägot förslag till lagändring läggs inte fram i promermurian i anslutning härtill.

l promemorian föresläs att ändringarna i inkassolagen skall träda i kraft den 1 juli 1980.

3.3. Ersättning för inkassokostnader

[ promemorian läggs fram förslag till ny lagstiftning om en borgenärs rätt till ersättning av gäldenären för inkassokostnad. [ anslutning därtill föresläs ändringar i lagsökningslagen samt följdäm'lringar i viss annan lagstiftning. Förslagen grundas pä datainspektionens utredning den 21) juni 1978 om inkassokostnader (se avsnitt 11 men innebär flera avvikelser frän och kompletteringar av inspektionens förslag.

Enligt departementspromemorian bör de gällande bestämmelserna om rätt till ersättning för inkassokostnader som rättegängskosttmd ersättas med en civilrättslig reglering som blir direkt tillämplig även när anspräk pa ersättning för inkassokostnader framställs utom rätta. Liksom f.n. bör reglerna ha till syfte bl. a. att skydda gäldenärerna mot överdrivna anspräk pä kostnadsersättning. ] promemorian föreslås att reglerna förs samman till en särskild lag om ersättning för inkassokostnad.

Enligt l & första stycket i lagfifrrslaget gäller lagen en gäldenärs skyldighet att utge ersättning för inkassokostnad. Lagen tillämpas dock inte om ersättningsskyldigheten är särskilt reglerad (S.—$ i förslaget). Med inkasso— kostnad förstäs enligt 1 & andra stycket borgenärens kostnad för krav och andra förlu'tllandevis enklare åtgärder som har syftat till att förmä gäldenären att betala en förfallen skuld. Den fi'ircslagna definitionen av inkassokostnad innebär att lagen kommer att reglera även rätten till ersättning dä en faktura eller annan neutral betalningspaminnelse sänds ut efter förfallodagen.

[ 2 & anges vilka inkassokostnader som skall vara ersättningsgilla. Förslaget anknyter här till de nuvaramle bestämmelserna i inkassokostmtds- kungörelsen. Gäldenären skall sälunda ersätta inkassokostmul som avser krav rörande en skuld. om kravbrev som har utformats enligt 5 % inkassolagen har tillställts gäldenären. Han skall vidare ersätta inkassokost— nad som avser upprättande i samräd med honom av fullständig plan för amortering av äterstäende del av en skuld. om planen har satts upp skriftligt och tillställts honom. Som en allmän fi:")rutsättning för ersättningsskyldighet gäller enligt förslaget att kostnaden skall ha varit skäligen päkallad för att ta

Departmzcnm- promemorian

Prop. 1980/81 : 10 37

till vara borgenärens rätt.

I fräga om ersättningsbeloppens storlek föreslas att regeringen skall utfärda en särskild förordning. [ lagförslagets 3 & har därför tagits upp en bestämmelse om att ersättning som avses i 2 s' utges mcd skäligt belopp enligt vad regeringen närmare förskriver. l 3 äföresläs vidare en bestämmelse som innebär att ränta inte skall utgä pä fordran pä ersättning för inkassokost- nad.

I 435 första stycket i lagfi'irslaget fastsläs att gäldenären inte skall vara skyldig att utge ersättning för annan inkassokostnad än som avses i 2 s. Detta innebär bl. a. att gäldenären inte är skyldig att ersätta kostnader för neutrala betalningspäminnelscr efter förfallodagen.

Lagen föresläs bli tvingande till gäldenärens förmän (4 & andra stycket i lagförslaget). Avtal som utvidgar gäldenärens skyldighet att utge ersättning för inkassokostnad utöver vad som följer av den förslagna lagen skall sälunda vara ogiltigt. Detta skall enligt promemorian gälla oavsett när avtalet har träffats och även om betalning har erlagts enligt avtalet. Enligt promemorian bör gäldenären emellertid inom ramen för en process kunna pä ett bindande sätt disponera över sin skyldighet att utge ersättning för inkassokostnad. Han bör alltsä genom förlikningsavtal eller processuellt medgivande kunna ta pä sig en längre gäende ersättningskyldighet än den som följer av den föreslagna lagen. Mäl rörande ersättning för inkassokostmtder bör med andra ord vara dispositiva. Enligt prtnnemorian bör denna princip dock inte upprätthållas fullt ut i mål som handläggs enligt lagsökningslagen.

När det gäller Iagsökningslagen föresläs till en början sadana ändringar att en borgenär får möjlighet att i samband med lagsökning för en fordran som har föranlett inkassokostnad lagsöka gäldenären ocksä för ersättning för denna kostnad. även om kostnadsanspri'iket inte grundar sig pä ett skriftligt fördringsbevis.

Enligt promenu'n'ian kan det godtas att domstolens skyldighet att självmant pröva anspråk pä ersättning för inkassokostnad i princip bortfaller i vanlig rättegäng. Vid lagsökning och betalningsföreläggande framstär detta emellertid enligt promemorian som en alltför ofördelaktig följd av den föreslagna civilrättsliga regleringen. Detta sammanhänger framför allt med att i summarisk process gäldenärcns blotta passivitet leder till utslag eller slutbevis i enlighet med borgenärens ansökan. utan materiell prövning frän domstolens sida. Här finns det sälunda särskilt stor risk för att gäldenären belastas med en alltför stor ersättningsskyldighet. om officialprövningen bortfaller. I promemorian föresläs därför att man i lagsökningslagen för in bestämmelser som ger domstolen i princip samma möjligheter som i dag att självmant pröva ett anspråk på ersättning för inkassokostnad som framställs i summarisk process. De föreslagna bestämmelserna innebär i huvudsak att lagsöknings- och betalningsföreläggandeinstituten skall hällas öppna endast för anspräk på sådan ersättning för inkassokostnad som kan utgä enligt den föreslagna särskilda lagen och de verkställighetsföreskrifter som regeringen

Departemenls- promemorian

' Prop. l98t)/81:10 3s

meddelar i anslutning till denna. Anspräk pä inkassokostrmdsersättrring som gär däruti'iver skall enligt de föreslagna ändringarna i lagsökningslagen avvisas av domstolen redan i ett inledande skede av förfararulet.

Enligt förslaget till lag om ersättning för inkassokostnad är gäldenären. som tidigare har berörts. skyldig att utge ersättning för krav endast om han har tillställts ett skriftligt krav som har utformats pä det sätt som anges i 5 & inkasst'rlagen. Detsamma gäller redan i dag enligt inkassokostnadskungörcl- sen. Enligt pri'nnemorian bör emellertid domstolarnas kontroll av kravbre— vens utformning skärpas. sä att bcstämmelserrur i 5 55 inkassolagen kan slä igenom ordentligt. I promemorian föreslas därför att man i lagsi'jkningslagen för in bestämmelser som älägger en borgenär att. när han ansöker om lagsökning eller betalningsförclz'iggande för kravkostnad. till ansökningen foga en avskrift av kravbrevet. Motsvarande skall enligt promemorieförsla- get gälla orn borgenären gör anspräk pä ersättning för att ha upprättat en amorteringsplan.

1 övrigt föreslt'is i promemorian en del mindre justeringar i lagsökningsla- gen. vilka föranleds av de. fifrreslagna nya reglerna om ersättning för inkassokostnad. Vidare föresläs ft'rljdärulringar i 18 kap. 8 & rättegängsbal— ken och i 8.5 lagen (197-118) om rättegängen i tvisternäl om mindre värden.

I promemorian föresläs att den nya lagen omcrsättning för inkassokostnad samt ändringarna i lagsökningslagen m. m. skall träda i kraft den 1 juli 1980.

Hänvisningar till S3-3

4 Allmän motivering 4.1 Allmänna utgångspunkter

En väl fungerande kreditmarknad har stor betydelse i värt samhälle. Bäde företag och privatpersoner har ofta behov av krediterför olika ändamäl. Det är emellertid frän flera synpunkter angeläget att kreditgivningen sker under ansvar och efter sunda principer. Detta förutsätter bl. a. att kreditgivarna kan fä ett tillfredsställande underlag för sin kreditbedi'rrnning. En effektiv och vederhäftig kreditupplysningsverksamhet fyller alltsä en viktig upp- gift.

I Sverige finns f. n. f_vra rikstäckande kreditupplysningsföretag. Dessutom lämnas kreditupplysningar i varierande omfattning av olika kreditinrättning- är och en rad andra företag och t'rrganisationer. Kreditupplysningsverksam- heten bedrivs i allt större utsträckning med hjälp av ADB och liknande tekniska metoder. som medger att ett mycket stort informationsrnatcrial lagras. Det är angeläget att sä längt möjligt se till att det inte genom sädan verksamhet sprids oriktiga eller missvisande uppgifter om företag och enskilda personer och att den personliga integriteten inte heller i övrigt utsätts för ett otillbörligt inträng.

Allmänna utgångspzmktar

Prop. 1980/81 : 10 39

Kreditupplysningslagen (197311173). som reglerar den yrkesmässiga kreditupplysningsverksamheten. bygger pä en avvägning mellan ä ena sidan intresset av att denna verksamhet kan bedrivas sä effektivt som möjligt och ä andra sidan (';'rnskemälet av skydd för en privat sfär som bör vara fri frän insyn i detta sammanhang. Det senare i:")nskemälet har i lagen tillmätts särskild betydelse när det gäller enskilda personer. För dem finns speciella skyddsregler om s. k. personupplysningar. I fräga om juridiska personer samt enskilda personer som driver eller pä annat sätt har inflytande över viss näringsverksarnhet har däremot intresset av en effektiv och mer inträngande kreditupplysningsverksarnhet ansetts väga tyngre. Lagen skyddar emellertid även dessa kategorier genom generellt tillämpliga besti'rmmelser. som syftar bl. a. till att hindra spridning av särskilt ömtälig personlig information samt felaktiga eller missvisande upplysningar. Säväl enskilda som allmänna intressen tas till vara genom regler för hanteringen av kreditupplysningsre— gister samt regler om tillständsplikt och offentlig tillsyn över kreditupplys— ningsverksamheten. I den män kreditupplysningsregister förs med hjälp av ADB och avser enskilda personer. vare sig dessa är näringsidkare eller ej. gäller datalagen (1973z289) vid sidan av kreditupplysnirrgslagen.

För kreditmarknaden och näringslivet iövrigt är det viktigt att den som har beviljat en kredit kan driva in sin fordran på ett effektivt sätt. Det finns speciella inkasst.)företag som ägnar sig ät att driva in fordringar för kreditgivarnas räkning. Manga kreditgivare driver naturligtvis ocksa själva in sina fordringar. Även pä inkassoomrädet aktualiseras behovet av skydd för den personliga integriteten och andra personliga intressen. Framfi'n' allt är det angeläget att gäldenärerna inte utsätts för alltför härda eller pä annat sätt otillbörliga inkassoätgärder.

Inkassolagen(1974: 182) kom till för att tillgodose främst de nyss nämnda skyddsbehoven. Enligt lagens grundläggande regel skall all yrkesmässig inkassoverksamhet bedrivas med iakttagande av god inkassosed. Den närmare innebörden av detta begrepp fastsläs i vissa hänseenden genom särskilda bestämmelser om bl.a. förfarandet vid krav mot gäldenärer. Reglerna om god inkassosed är emellertid avsedda att ta till vara inte bara gäldenärernas intressen utan även borgenärernas anspräk pä bl. a. korrekt hantering och redovisning av medel som har inkasscrats av ombud. I princip all yrkesmässig inkassoverksarnhet har ställts under offentlig tillsyn. För inkassoverksamhet som avser indrivning av fordringar för annans räkning c. d. gäller tillständsplikt.

lnkassoätgärder medför regelmässigt kostnader som tas ut av gäldenären. Ett viktigt intresse i detta sammanlnrng är att denne inte skall behöva belastas med onödiga eller alltför höga inkassokostnader.

Gällande fi.")rfattningsreglcr om rätten till ersättning för inkassokostnader finns i rättegängsbalken och anslutande fi'n'fattningar. Bestämmelserna innebär att borgenären har rätt att i samband med vanlig rättegäng eller

strmrnarisk process rörande en fordran kräva ut vissa inkassokostnader som

Allmänna utgångspunkter

Prop. 1980/81:10 4tl

processkostnt-td. Ett viktigt syfte med bestämmelserna är att skydda gäldenären mot överdrivna kostnadsanspräk. För den situationen att ett fordringsanspräk inte leder till process utan görs upp utom rätta finns inte någon motsvarande reglering. De processrättsliga kostnadsbestämmelserna betraktas emellertid som vägledande även i utomrättsliga sammanhang. bl. a. genom att de i praxis bildar norm för vad som utgör god inkassosed när det gäller krav pä ersättning för inkassokostnzuler.

Kreditupplysningslagen och inkassolagen . som har gällt i huvudsak oförändrade sedan den 1 juli 1974. står under tillsyn av datainspektionen. Lagarna har i förening med inspektionens tillsynsverksamhet haft avsevärd betydelse för att ästadkomma och bevara en frän olika synpunkter god standard inom kreditupplysnings- och inkassoverksamhetcn. ] stort sett har de bäda lagarna fungerat utan betydande tillämpningssvärigheter och visat sig innefatta rimliga avvägningar mellan de olika intressen som kan göra sig gällande. Även de nuvarande. processrättsliga reglerna om ersättning för inkassokostnader har visat sig fylla en viktig funktion.

Datainspektionen har i tvä promermurior. som överlämnats till justitiede- partementet. redovisat sina erfarenheter som tillsynsmyndighet. Enligt inspektionen visar dessa erfarenheter att säväl kreditupplysningslagen som inkassolagen behöver ses över i en del hänseenden. Även riksdagen har uttalat sig för en översyn av de bäda lagarna. [ anledning av ett särskilt utredningsuppdrag har datainspektionen vidare lagt fram förslag till nya regler om ersättning för inkassokostnader samt utrett frägan om ett system för längsiktig reglering av bl. a. inkassokostnadsersättningarnas storlek.

Den begärda översynen av kreditupplysningslagen och inkassolagen har verkställts inom justitiedepartementet och redovisats i departcmentsprome- morian (Ds Ju 197918) Kreditupplysning och inkasso. Promemorian inne- häller ätskilliga förslag -till ändringar och kompletteringar av de båda lagarna.

Beträffande kreditupplysningslagen föresläs bl. a. att omfattningen av det centrala begreppet personupplysning vidgas. Förslaget innebär att kredit- upplysningar om alla enskilda personer. även näringsidkare m.fl.. skall omfattas av de särskilda skyddsreglerna för personupplysningar. Den nuvarande femärsgränsen för äldre uppgifter i perstmupplysningar skall enligt förslaget sänkas till tre är för uppgifter i allmänhet. Vidare föresläs att den som avses med en perstmupplysning alltid skall ha rätt till autrnnatiskt besked om vem som har begärt upplysningen.

l. fräga om inkassolagen föresläs bl.a. att lagens tillämpningsomräde utvidgas sä att lagen kommer att gälla för all inkass(_n-'er'ksamhet utom enskilda personers och dödsbons indrivning av egna. rent privata fordringar. Samtidigt föresläs en inskränkning av tillständsplikten enligt lagen. Fran kravet på tillständ undantas sälunda enligt förslaget s. k. kcmeerninkasso samt viss inkassoverksamhet som bedrivs utan förvärvssyfte. t.ex. av kommuner. fackföreningar och en del andra organisationer. Vidare föresläs

Allmänna utgångspzulkter

Prop. msn/81:10 41

kompletteringar av bestämmelserna om krav i inkassoverksamhet samt helt nya bestämmelser om gäldenärsregister i sädan verksamhet.

ldepartementspromemt'n'ian läggs ocksä fram förslag till en ny. civilrättslig reglering av rätten till ersättning för inkasst')kostnader. Förslaget innebär att en särskild lag om ersättning för inkassti)kostnad skall träda i stället för de nuvarande processrättsliga reglerna och till skillnad frän dem vara tillämplig äVen när anspräk pä kostnadsersättning framställs utom rätta. Ersättning skall dock inte kunna tas ut för rena betalningspäminnelser. ] anslutning till de nya reglerna föresläs vissa ändringar i lagsökningslagen. litt väsentligt syfte även med de nya reglerna är att skydda gäldenären mot en alltför (nnfattande ersättningsskyldighet.

Som nyss nämndes har datainspektionen utrett frägan om en långsiktig reglering av ersättningarna för inkassokostnadcr m. m. Inspektionen har i denna del funnit att det inte är lämpligt att anknyta ersättningarnas storlek till något slags index. Inspektionen förordar därför att man som f.n. läter regeringen utfärda föreskrifter om ersättningsbeloppen. vilka vid behov kan ändras vid äterkmnmande tillfällen. linligt förslaget skall emellertid inspek- tionen i samräd med statens pris— och kartellnämml genomföra fortlöpande kostnadsundersi.')kningar och pä grundval av dessa förelägga regeringen förslag om ändringar i ersättningsbeloppen.

Vid remissbehandlingen har departementspromemorian fält ett i huvud— sak positivt mottagande. Flertalet av de förslag som gäller kreditupplysnings- lagen och inkassolagen har sålunda godtagits. Praktiskt taget alla remissin- stanser anser även att man bör införa nya regler om rätten till ersättning för inkassokostnader. De närmare förslag som departementspromemorian innehäller i dessa avseenden har dock mött viss kritik. Datainspektionens förslag beträffande en långsiktig reglering av inkassokostnadsersättningar- nas storlek biträds av de flesta remissinstanser som har yttrat sig i denna del. Från ett par häll anförs emellertid kritiska synpunkter.

När det gäller kreditupplysningslagen och inkassolagen anser jag att vad som har redovisats i departeme_ntsprt'mtemorit'm och framkommit under remissbehancllingen ger vid handen att lagarna bör revideras i en del aVseenden. Departementspromemorian utgör enligt min mening en god grund för de ändringar och kompletteringar som kan behöva göras. Pa vissa punkter finns det dock anledning att ta fasta pä den kritik som har förts fram av olika remissinstanser. :

Ifråga om kreditupplysningslagen ktmcentreras remissinstansernas intres- se främst till den föreslagna ändringen av det i lagen använda begreppet personupplysning. Beträffande sädana upplysningar innehäller lagen en rad särskilda regler som pä olika sätt begränsar rätten att lagra och lämna information. Förslaget att dessa regler skall gälla även för enskilda personer som är ni'iringsidkare avstyrks av ätskilliga remissinstanser. som anser att den nuvarande gränsdragningen mellan personupplysningar och s. k. företags- upplysningar bör behällas oförändrad. Enligt min mening har förslaget

Allmänna utgångsptmkler

Prop. HSO/81:10 42

visserligen bl. a. den fördelen att enskilda näringsidkare fär ett nägot bättre skydd än f. n. mot missvisande uppgifter om betalningsförsummelser. Det skulle emellertid föra för längt att pä det sätt som har l'i'ircslagits likställa enskilda näringsidkare med vanliga privatpersoner. Som jag i ett senare avsnitt skall gä närmare in pä bör gränsen mellan företagsupplysningar och personupplysningar även i fortsättningen dras pa i princip samma sätt som nu. En del av fördelarna med förslaget bör dock kunna tas till vara genom smärre ändringar i lagen. Detta äterkommer jag till i det följande.

I övrigt bör enligt min mening de föreslagna ändringarna i kreditupplys— ningslagen i hut-'udsak genomft'iras. Det gäller bl. a. förslaget att den som avses med en persrmupplysning alltid skall fä besked om vem som har begärt upplysningen. Vissa justeringar i förhällande till promemorieförslaget följer emellertid av den ständpunkt jag nyss redovisade i fraga om gränsdragningen mellan perstmupplysningar och s. k. företagsupplysningar. Även pä en del andra punkter bör promemrn'ieförslaget jämkas lned hänsyn till de päpekan- den som har gjorts under remissbehandlingen och till att ny lagstiftning ltar införts på andra omräden. Jag äterkommer senare till dessa fragor.

Vad promemorieförslaget innehäller beträffande inkassolagen bör i allt väsentligt genomfi'iras. Detta gäller bl.a. förslaget om att utvidga lagens tillämpningsomräde men att ä- andra sidan göra en viss inskränkning i tillständsplikten för att bedriva inkasscwerksamhet. len praktiskt viktig fräga anser jag emellertid. i likhet med en del remissinstanser. att prtnnemorie- förslaget bör frängäs. Det gäller gränsdragningen mellan sädana betalnings- päminnelser som inte bör omfattas av lagen och sädana krav för vilka lagen bör gälla. Enligt förslaget skall en betalningspäminnelse. för att falla utanför lagen. inte fä innehälla nägon mer eller mindre bestämd frist för betalningen. En sädan gränsdragning kan enligt min mening i vissa fall medföra praktiska olägenheter. Jag anser därför att man bör välja en annan lösning. Detta äterkommer jag till i ett senare avnsitt. (')cksä beträffande de föreslagna bestämmelserna om hur ett krav skall vara utformat kan det med hänsyn till den remisskritik som har framkommit på denna punkt finnas anledning att avvika nägot frän promemorieförslaget. Förslaget hör även i övrigt justeras i en del avseenden.

Beträffande förslaget till ny lagstiftning om rätten till ersättning för inkassokostnader har domstolsverket framhållit att man bör avvakta resultatet av det arbete som pägär inom rättegängsutredningen (Ju 1977106) innan slutlig ställning tas till förslaget. För min del anser jag emellertid att det inte finns anledning att dröja med de nya reglerna tills rättegängsutredning- ens omfattande arbete har slutförts. lnnehället i de fi.")reslagna reglerna har i huvudsak godtagits under remissbehandlingen. Ocksä enligt min mening är förslaget väl ägnat att läggas till grund för ny lagstiftning pä omrädet. Med hänsyn till vad nägra remissinstanser har framhällit bör emellertid förslaget krnnpletteras med regler om viss rätt till ersättning även för kostnaden för enkla betalningspäminnelser. (')cksä en del andra justeringar kan behöva

Allmänna Ingångspzmkrer

Prop. 1980/81 : 10 43

göras. Vidare bör de föreslagna ändringarna i lagsökningslagen. vilka pä nägon punkt har mött kritik. inte genomföras fullt ut. .lag äterkommer till dessa frågor i samband med den närmare behandlingen av förslaget i det följande.

Vad slutligen gäller datainspektionens förslag beträffande en langsiktig reglering av storleken av ersättningarna för inkassokostnader delar jag inspektionens bedömning att ersättningsbeloppen inte bör anknytas till nägot slags index. .lag äterkommer även till denna fräga i ett senare avsnitt.

4.2. Kreditupplysningslagen 4.2.1 Tfllr'i/n/rningmnmit-ler

Kreditupplysningslagens tillämpningsomräde beskrivs f. n. i l s* pä sä sätt att lagen gäller "yrkesmässigt bedriven kreditupplysningsverksamhet". med vissa närmare angivna undantag.

Enligt departementspromemorian bör lagens tillämpningsomräde. bl. a. med hänsyn till synpunkter som har förts fram av datainspektionen. anges mera konkret titan att man. för den skull gör nägon ändring i sak. I prt'nnemorian föresläs därför att bestämmelsen i l & utformas sä att lagen gäller dels kreditupplysningsverksamhet som innebär att nägon annat än i enstaka fall lämnar kreditupplysningar mot ersättning eller som ett led i näringsverksamhet. (le/s ocksä annan kreditupplysningsverksamhet. om den är av större omfattning.

Förslaget har godtagits av praktiskt taget samtliga remissinstanser. Datainspektionen framhäller att den föreslagna lagtexten tillsammans med de särskilda undantagen synes uttt'fnnlmtmle redovisa det avsedda tillämpningsomrädet. F.nligt inspektionen mäste detta anses vara ett väsentligt rättssäkerhetsanspräk. Samtidigt kan förslaget underlätta inspek- tionens tillsynsverksamhet. Saväl datainspektionen som hovrätten över Skäne och Blekinge anser emellertid att det bör prövas om lagtexten kan göras enklare.

Oeksä jag anser att kreditupplysningslagens tillämpningsomräde bör anges tydligare än f. n.. huvudsakligen i enlighet med motivens beskrivning av vad som avses med yrkesmässigt bedriven kreditupplysningsverksamhet (se prop. 19732155 s. 136). Samtidigt är det dock angeläget att lagtexten inte tyngs med alltför omfattande beskrivningar. linligt min mening är det tillräckligt att ange att lagen gäller kredituppl_vsningsverksamhet som bedrivs i förvärvs 'yfte eller som i annat fall är av större omfattning.

Fran tillämpningen av kreditupplysningslagen undantas f. n. genom en uttrycklig regel intern förmedling av upplysningar mellan kreditinrättningar. i den män det är fräga om Sveriges riksbank. Sveriges investeringslmnk A B

eller kreditinrättning under bankinspektionens tillsyn.

Kreditupplysnings- lagen

Prop. HSO/81:10 44

l praxis har denna undantagsregel ansetts omfatta även det av affärsban- kerna. Sparbankernas bank och Sveriges föreningsbankers förbtind gemen- samt ägda kret'litupplysningsföretaget Upplysningscentralen UC AB. som enligt sin av regeringen fastställda bolagsordning stär under bankinspektio- nens tillsyn. UC ombesörjer ntiinera huvuddelen av bankernas interna kreditupplysningsft'ftrmedling inert bedriver även extern kreditupplysnings- verksamhet i förhällant'le till företag m. fl. titanft'ftr banksektorn. För den externa verksamheten. som faller under kredittipplysningslagen. har UC erhällit datainspektionens tillständ enligt denna lag.

1 departementsproinemorian framhälls att det i sak synes vara välgrundat att läta den bankinterna kreditupplysningsvcrksamhet som bedrivs av UC omfattas av iint'lantagsregeln för intern förmedling av upplysningar mellan kreditinrättningar under bankinspektionens tillsyn. För att detta skall framgä tydligt ft'.'iresläs att undantagsregeln kompletteras med en bestämmelse. som innebär att med en sädan kreditinrättning jämställs annat företag under inspektionens tillsyn om det har inrättats för kredittipplysningsverksamliet. Vid remissbeliandlingen har detta förslag i allmänhet lämnats titan erinran. Ocksä jag ansltiter mig till förslaget. som dock bör jämkas nägot redaktio— nellt.

1departementspromemorian föresläs vidare att undantagsregeln för intern förmedling av upplysningar mellan kreditinrättningar utformas sä att den inte omfattar finansbolag. även om de genom särskild lagstiftning ställs under bankinspektionens tillsyn.

En sädan ändring i kreditupplysningslagen föreslogs i prop. 1.978/791170 med förslag till lag om finansbolag i avvaktan pä den (översyn av kreditupplysningslagen som är akttiell i förevarande lagstiftningsärende. Pä grundval av denna proposition antog riksdagen nyligen lagen (19802) om finansbolag. Denna lag innebär att flertalet finanslmlag fr. o. m. den 1 juli 1981) ställs under bankinspektionens tillsyn. Riksdagen sköt dock tipp frägan om finansbolagens ställning i kreditiipplysningssamiiianhang till varen 1981). 1 samband med detta beslut hänvisades bl. a. till den nämnda översynen av kredittipplysningslagen (se NU 1979/8tlz23 s. 17 och rskr 19791801139).

Förslaget i departementspromeinorian att finansbolagen ocksä i fortsätt- ningen skall omfattas av kreditupplysningslagen har lämnats utan erinran av det stora flertalet remissinstanser. Till de instanser som godtar förslaget hör företrädare för säväl näringslivs— som löntagarintresseii. Datainspektionen framhäller det som angeläget att promemoriefr'irslaget pä denna punkt genomförs och erinrar därvid om den framskjutna roll som finansbolag med kontokortsverksamhct har inom konstimentkreditomrädet.

Förslaget kritiseras emellertid av fi.")reträdarna för banker och finansie- ringsföretag samt av Upplysningscentralen UC AB. l_)e hänvisar till de skäl som vid lagens tillkomst äberopades till stöd för att undanta vissa andra kreditinrättningars interna kreditupplysningsförmedling frän lagens tillämp- ningsomräde. Enligt de kritiska remissinstanserna gör sig dessa skäl nu i lika

Kreditul.>pl_vsningr— lagen

l'rop. HSO/81:10 45

hög grad gällande beträffande de finansbolag som ställs under bankinspek— tionens tillsyn. Bankinspektionen intar en liknande ständpunkt. bl. a. mot bakgrund av promemoriaiis förslag om att de särskilda infin'mationsbegrän- sande reglerna om persontipplysningar i fortsi'ittningen sktille gälla även för enskilda näringsidkare. Bankinspektionen framhäller att det utifrän de säkerhetsintressen som den har att bevaka inte finns anledning att särställa fiiianslmlagen.

Finansbolagens förening — tidigare Finansieringsföretagens förening— har i en skrivelse till justitiedepartementet den 15 april 1981) ytterligare under- strukit och utvecklat sin ständptinkt att finansbolagen i f("ii'evarant'le sammanhang bör likställas med bankerna.

Undantagsregeln beträffande intern förmedling av upplysningar mellan bl. a. kreditinrättningar under bankinspektionens tillsyn diskuterades utft'ir- ligt vid kreditupplysningslagens tillkomst. Jag fär här hänvisa i första hand till prop. 1973: 155 s. 123138. Som framgär av vad som anfördes där ansägs det frän flera synpunkter önskvärt att krcditupplysningslagen fick en sä generell tillämpning som möjligt. Anledningen till att man likväl tindantog en del kreditinrättningars främst bankernas interna kreditupplysningsförmet'l- ling frän tillämpningen av lagen var deras intresse av en friare kreditupplys- ningsverksamhet sinsemellan. Samtidigt bedömdes riskerna för integritets- kränkningar vara smä inom den krets av företag som du berördes. I detta hänseende äberopades beträffande bankerna bl. a. bestämmelserna om banksekretess. Även bankinspektionens tillsyn ansägs ha betydelse.

När det nti gäller att avgöra hur finansbolagen bör behandlas i kreditupp- lysningssammanhanget mäste självfallet betydande vikt fästas vid att kreditupplysningslagen är avsedd att ge främst enskilda personer ett gott skydd mot obehörigt inträiig i den personliga integriteten. Detta syfte kan upprätthållas endast om undantagen frän lagens tillämpning begränsas. sävida inte syftet kan tillgodoses pä annat sätt. Som jag nyss nämnde underströks ocksä vid lagens tillkomst det önskvärda i att den kunde fä en sä generell tillämpning som möjligt.

För finansbolagen däribland ätskilliga kontokortsft'iretag har kredit- upplysningslagen hittills gällt i full utsträckning. (.")in undantagsregeln för bankernas interna kredittipplysiiingsfi'irmedling fär omfatta även finansbo— lagen sktille det innebära en kraftig inskränkning av lagens nuvarande tillämpningsomräde. Som har framhällits i departementspromemorian skulle effekten då kunna bli att en betydande del av kredittipplysningsfö'irmedlingen till och frän de expanderande finansbolagen sker titan att skyt'lt'lsreglerna i kreditupplysningslagen gäller för den. 1 stor utsträckning är det här fräga om personupplysningar beträffande vilka intresset av integritetsskydd väger särskilt tungt.

Mot den diskuterade utvidgningen av iindantagskretsen talar ocksä att den skulle ktinna medföra en icke oväsentlig rubbning av konktirrensförhällan- dena inom kreditupplysningsbranschen. Vidare bör beaktas att inte alla

Kreditupplysning.?— lagen

Prop. 1980l81 : 10 40

finansbolag omfattas av den antagna lagen om finansbolag och därmed av baiikinspektionens tillsyn. Det kan hävdas att finansbolag med likartad verksamhet och likartade förutsi'ittiiingar i övrigt skall behandlas lika i krcditupplysningssämmanhang vare sig de stär under bankinspektitniens tillsyn eller inte.

Som har sagts i prop. 197958fl:159 med förslag till ändring i lagen (1974z923) om kreditpolitiska medel m. m. och i direktiven (Dir 19811124) för utredningen om kontokort mäste man ä andra sidan ocksä beakta intresset av en effektiv kredittipplysningsverksamhet. som även kan vara konsumentpo- litiskt motiverad. Om perstmupplysningsbegreppet i enlighet med prome— morieft'irslaget utvidgades till att omfatta upplysningar om enskilda närings- idkare m. fl.. skulle det fran den nu berörda synpunkten kunna fä negativa följder för bl. a. finanslu'ilagcn och deras kreditgivning till näringslivet. Som jag redan har nämnt i avsnitt '—l.1 och äterkommer till i nästa avsnitt bör emellertid prrnncmorieförslaget pä den punkten inte genomföras. Nägon försämring av finansbolagens möjligheter att tillgodose behovet av ft'iretags— upplysningar bclu'fiver alltsä inte befaras.

Även när det gäller de nuvarande pei'sonupplysningarna kan det för finansbolagen. och dä inte minst kontokoi'tsföretagen. vara av särskild betydelse för en väl fungerande kreditgivning och kreditbevakning att de kan fä utbyta mer ingäeiide informatirm om betalningsförsummelser och kret'litspärrar m. ut. än som tilläts enligt 7 ä' första stycket kredittipplysnings- lagen. Redan f. n. finns emellertid enligt paragrafens andra stycke en möjlighet till dispens frän detta l'i'ii'bud. Denna dispensmt'ijlighet bör enligt min mening behällas och utnyttjas för att tillgodose kontoktii'tsförctagens särskilda behov av informatit'msutbyte om kreditmissbruk c. d. Jag äterkom— mer till detta i ett senare avsnitt. Jag vill tillägga att den nyss nämnda kontokortsutredningen har i uppdrag bl. a. att pä grundval av sitt utred— ningsarbete närmare pröva vad som bör gälla i fräga om kt)111()lx't)1'1.Sff)rCftl- gens möjligheter att fä och utbyta information om kreditmissbruk m. m.

Med hänsyn till det sagda ansltiter jag mig. i likhet med det stora flertalet remissinstanser. till promemcn'ians ständpunkt att finansbolagen inte heller i fortsättningen bör omfattas av undantaget för intern f("irmedling av kreditupplysningar mellan banker och vissa andra kreditinrättningar. Den bestämmelse av detta innehäll som har föreslagits i prop. 1978579zl7t1 med förslag till lag om finansbolag m. m. bör därför arbetas in i 1 & kreditupp- lysningslagen tillsammans med de andra i'indringar av paragrafen som jag tidigare har f("ärordat. Behovet av en effektiv kreditupplysning hos fi nansbo- lagen bör som jag återkommer till i det [följande -— kunna tillgodoses bl. a. genom den nyss nämnda dispensmöjligheten. ätiiiiiisione i avvaktan pä koniokortstitredningens arbete.

Kredittipplysningslagen omfattar f. n. även sädan yrkesmässig kreditupp- lysningsverksamhet som bedrivs genom offentliggörande av kreditupplys— ningari tryckt eller pä annat sätt framställd skrift. Kravet pä att det skall vara

Ix'rcrlirupplyx;tings- lagen

Prop. 1980/81 : 10 47

fräga om yrkesmässigt bedriven kredittipplysningsverksamhet har emellertid ansetts innebära att lagen inte omfattar utgivandet av exempelvis dagstid- ningar eller tidskrifter som huvudsakligen innehäller allmänt informations- matcrial. även om det vid sidan därav i viss utsträckning införs information som har karaktären av kredittipplysningar (jfr prop. 1973:155 s. 136 ). Enligt promemorian bör denna begränsning i tillämpningsomi'ädct när det gäller dagstidningar e. d. komma till tydligt uttryck redan i lagtexten. En Särskild bestämmelse om detta föresläs därfifir. För min del anser jag emellertid att en sädan precisering inte är nödvändig. om man anger lagens tillämpningsomräde i enlighet med vad jag förut har förordat. Nägon särskild bestämmelse av det slag som har föreslagits i departcmentspromemorian bör alltsä inte tas tipp.

4.2.2. Bcgre/wt'r Ŕn'(/fll(pl)/_l'SIIlIlg

Med kreditupplysning avses enligt lå kreditupplysningslagcn uppgift. omdöme eller räd som lämnas till ledning för bedömning av annans kreditvärdighet eller vederhäftighet i övrigt i ekonomiskt hänseende. Beträffande den närmare innebörden härav kan hänvisas till departements- promemorian s. ö-l f (jfr prop. l973:155 s. 138 f).

1 departementspromenu'irian framhi'ills att lagens definition av vad som avses med kreditupplysning fär anses ändamälsenlig och tillräckligt klarläg- gande. Av föreskriften att uppgiften etc. skall ha lämnats "till ledning för" bedömningen av annans kreditvi'irdighet eller ekonomiska vederhäftighet i övrigt framgär enligt prrmiemorian att utlämnandet av informationen skall åtminstone delvis ha fi")ranletts av en avsikt hos utlämnaren att därmed hjälpa mottagaren att göra en sädan ki'editbedömning. Med anledning av päpekan- den från datainspektionen franiliälls att det självfallet inte blir fräga oin kreditupplysning i lagens mening. om den som lämnar ut information om nägon annans förhällanden maste göra detta direkt pa grtiiid av lag. sasom när en myndighet är skyldig att lämna ut vissa tippgifter enligt reglerna om allmänna handlingars offentlighet eller ktingöra konkursbeslut c. d.

Under remissbehandlingen har proinemoriefi'irslaget i denna del inte mött nägon erinran. Ocksä jag ansluter mig till den tolkning av begreppet kreditupplysning som har redovisats i promenuirian. Uttalandena i prome- morian pä denna punkt stämmer enligt min mening överens med vad som mäste antas ha varit avsett vid lagens tillkomst.

4.2.3 Grå)Avdrag/ringen nie/lan pl'liwJHuppl)'.Vllllllgtll'()l'llIfl.)/"('lll_g'.t'II/7/)l_1".t'lll/lg-

(H"

Genom ls)" kreditupplysningslagen bestäms innebörden av det i lagen centrala begreppet personupplysning. Med detta begrepp avses kreditupp— lysning om annan enskild person än den som är näringsidkare eller annars har

Iv'redirupplvsnings- lagt-'n

Prop. l980/8l: 10 48

sä väsentligt inflytande i viss näringsverksamhet att uppgifter om hans egna förhällanden behövs för att belysa verksamhetens ekonomiska ställning. För personttpplysningarna gäller enligt lagen flera särskilda regler som är avsedda främst att skydda den enskildes personliga integritet. Dessa regler innebär i huvudsak följande.

Enligt 7 55 fär en personupplysning inte innehalla uppgift om annan betalningsförsttmmelse än sadan sotn har fastslagits av domstol eller pa ett annat mera tillförlitligt sätt. Datainspektionen fär emellertid medge undan— tag härifrän. I praktiken har förbudet mot uppgifter om andra betalnings- försummelser sin största betydelse när det gäller s. k. ansökningsttppgifter. dvs. främst uppgifter om ansökningar om betalningsföreläggande eller lagsökning. Enligt 8 & fär en personttpplysning inte itmehälla uppgifter om äldre omständigheter eller förlu'tllanden som kan vara av betydelse vid bl. a. bedömningen av nägons kreditvärdighet. Gränsen dras här f. n. vid fetn är frän utgången av det är dä omständigheten inträffade eller förhällandet upphörde. F.nligt 9.5 får en personupplysning inte lämnas ut. om det finns anledning anta att ttpplysningcn kotnmer att användas av annan än den som har ett legitimt behov av upplysningen. När en personttpplysning lämnas ut skall enligt 11 sä den som avses med upplysningen samtidigt erhälla ett skriftligt meddelande om upplysningens innehäll (s. k. personupplysnings- kopia).

1 sin protnemoria rörande kreditupplysningslagen pätalade datainspektit.» nen vissa svärigheter som i den praktiska tillämpningen hade visat sig vara förenade med lagens gränsdragning mellan personupplysningar och s. k. företagsupplysningar. Sälunda ansägs den bristande öv'crensstämtnclsen mellan begreppet personttpplysning i kreditumalysningslagcn och begreppet pcrsonuppgift i datalagen ägnad att :"1stadkt'nnma systematiska svarighcter i datoriserade kreditupplysningsregister. Vidare angavs att det i den masshan- tering som kreditupplysningsverksamhet ofta innebär kan vara svärt att fastställa i vilka fall en fysisk person är att anse som näringsidkare c. d. Ytterligare ett problem hängde enligt inspektionen samman med att enskilda personer genom att byta __.selsättning katt falla ömsom inotn och ömsom lllilllföl' personupplysningskategorin.

Med hänsyn till vad datainspektionen salunda anfört har i departements- promemorian föreslagits en radikal ändring av vad som i kreditttpplysnings- lagen skall avses med perst')ttt|ppl_v-'sttittg. Enligt protnemorieförslaget bör med detta begrepp förstas varje kreditupplysning om en enskild person. oavsett om han är näringsidkare eller inte. Utöver de problem med den nuvarande gränsdragningen som datainspektionen har pekat pä har till stöd för förslaget äberopats den förbättring av främst integritetsskydt'let för enskilda näringsidkare m.fl. som skulle bli följden om de hänfördes till personupplysningskategorin.

Vid remissbehandlingen har promemorieförslaget pä derma punkt fätt ett blandat mottagande. Åtskilliga remissinstanser godtar förslaget utan närma-

Kreditupplysning.?- lagen

Prop. HSO/81:10 49

re kommentarer. Företrädare för banker och andra kretlitgivare. för kreditupplysningsbranschen och för näringslivet motsätter sig emellertid att förslaget genomförs. Ett grundläggande tema i deras kritik mot förslaget är att det innebär risker för en kraftig ft'årsämring av företagsupplysningsverk- samhetens effektivitet och kvalitet. Även andra remissinstanser. säsom bankinspektionen. Sveriges advokatsamfund och TCO. tar avstånd frän förslaget eller ifrågasätter dess lämplighet.

Näringslivets hållning är emellertid inte enhetlig. l'iörslaget tillstyrks sälunda av SAF och Sveriges indttstriförbtmd. Nägra andra remissinstanser som företräder näringslivet förordar att kreditupplysningar om enskilda näringsidkare m. fl. likställs med personupplysningar vid tillämpningen av en del av de särskilda perst'mupplysningsrcglerna men inte när det gäller andra.

För egen del vill jag till en början t'ramhälla att den nuvarande gränsdragningen mellan personupplysningar och s. k. f(n'etagsupplysningar har gällt alltsedan lagens tillkomst. Av vad som har anförts i datainspektio- nens promemoria rörande kreditupplysningslagcn och i departementspro- memorian framgår visserligen att gränsdragningen har vällat vissa problem i den praktiska tillämpningen. Dessa synes dock inte vara större än att de bör kunnai allt väsentligt bemästras från bl. a. kreditttpplysningsföretagens sida. Enbart gränsdragningsproblemen kan därför enligt min mening inte anses utgöra tillräcklig anledning att ändra den nuvarande bestämningen av personupplysningsbegreppet.

Från bl. a. integritetsskyddssynpunkt har promemorieförslaget icke obe— tydliga förtjänster. Dessa mäste emellertid vägas mot intresset av att ktnma få mer ingående och fullständiga kreditupplysningar rörande företag. Detta intresse mäste i allmänhet anses lika betydelsefullt vare sig företaget drivs direkt av en enskild näringsidkare eller företaget har organiserats i en annan rättslig fortn. Enligt min mening har det inte framkommit nägra missförhål— landen eller andra (:)mständigheter sotn föranleder att avvägningen mellan integritetsskyddssynpunkterna och intresset av en effektiv företagsupplys— ningsverksamhet i dag bör utfalla på ett annat sätt än vid lagens tillkomst. [ 'arje fall finns det inte anledning att göra nagon ändring när det gäller frägan om vilka slags uppgifter som bör fä förekomma i kreditupplysningar om enskilda näringsidkare m. fl. Jag är därför inte beredd att föreslä att de regler i 7 eller 8 ä' kreditupplysningslagen sotn begränsar möjligheterna att inhämta information utvidgas till att omfatta även kreditupplysningar om enskilda näringsidkare m. fl.

När det gäller bestämmelsen i 9 &. som innebär att en personupplysning inte ftir lämnas ut om det finns anledning anta att den kommer att användas av annan än den som har ett legitimt behov av upplysningen. har visserligen det stora flertalet remissinstanser godtagit att denna regel utsträcks till att gälla även kreditupplysningar om enskilda näringsidkare m. fl. Ett legitimt behov av kreclitttpj)1_v-'stiittg om personer som tillhör denna kategori kan

4 Riksdagen 19.9(1/81. [ .vaml. Nr [()

Kredituppfwnings- , lage/1

Prop. 1980/81:10 S.t)

emellertid föreligga av de mest skiftande anledningar. En legitimitetskon— troll även med avseende pä sädana kreditupplysningar skttlle sannolikt i praktiken fä begränsad betydelse. Det fittns därför en risk för att en lcgitimitetskontroll i dessa fall skttlle uppfattas som en ren fortnalitet. Detta kan i sin tttr inverka negativt pä tillämpningen av 9.5 när det gäller upplysningar om andra enskilda personer än näringsidkare m. fl. Pä grund av det nu sagda finner jag det varken päkallat eller lämpligt att utvidga tillämpningsomrädet för 9 a'.

Sammanfattningsvis innebär det sagda att den nuvarande avgränsningen av begreppet perstimupplysning i lä kreditttpplysningslagen bör behällas ofi'ärändrad och att bestämmelserna i 7—9 så även i fortsi'tttningen bör gälla enbart för kreditupplysningar om andra enskilda personer än näringsidkare m. fl.

Det är emellertid en sak att man inte i större utsträckning än f. n. bör begränsa den information som far förekomma i kreditupplysningar om enskilda näringsidkare m. fl. En fräga av väsentligen annan karaktär är om inte även denna kategori av enskilda personer bör ges en sädan rätt till samtidigt och kostnadsfritt besked om itmehället i en lämnad kreditupplys- ning som för personttpplysningarnas del följer av de nuvarande bestämmel- serna i 11 & kreditttpplysningslagen. Saväl fran integritetsskyddssynpttnkt som utifrän önskemälet att undvika oriktiga eller missvisande kreditupplys- ningar kan enligt ntitt tnening mycket vinnas, om ocksä företagare m. fl. ges liknande möjlighet att kontrollera de uppgifter som i ett kreditupplysnings- ärende har lämnats om vederlx'irande. En sädan mt'ftjlighet bör därför övervägas, Detta äterkomtner jag till i ett följande avsnitt (4.2.0).

4.2.4 Le tili/nitctskomm/l (n'/t stlfi/lmmtsvar &

Enligt () & kreditttpplysttingslagen fär en perstmupplysning inte lämnas ut. om det finns anledning anta att upplysningen kotntner att användas av annan än den som pä grund av ett ingänget eller ifrägasatt kreditavtal eller av nägon liknand— anledning har behov av upplysningen. 'aragrafen förutsätter att den som bedriver den aktttella kreditupplysningsverksatnheten kontrollerar att beställaren av en pcrsonupplysning har ett sädant legitimt behov av upplysningen. Ett ttppsätligt eller oaktsamt äsidosättande av &) ;" kan enligt 19% straffas med böter eller fängelse i högst ett är. Åsidosättandet kan dessutom leda till skadestättdsskyldighet enligt 31 s' och till sanktioner frän datainspektionens sida genom föreskrifter och i sista hand äterkallelse av tillständ enligt 17 ä.

1 departementspromemorian framhälls att L).»ä' i och för sig innebär att kreditttpplysningsföretagen skall fordra in uppgift om det ändamäl för vilket en personupplysning begärs. Enligt promemorian kan det dock inte rimligen krävas av ett kreditttpplysningsft'iretag att det frän en ofta äterkommandc och

Krc'tlimppfvsnings— Inge/1

'Jt

Prop. l980/8l110

väl känd kund infordrar uppgift om ändamälet med varje enskild personupp- lysning. Kravet på kontroll frän kreditupplysningsförctagets sida bör enligt prt'unemorian i sädana fall ofta ktttma anses uppfyllt genom att ft'aretaget avfordrar kunden en generell försäkran om att denne skall begära personupplysningar endast när det finns ett sädant behov av upplysning som avses i 9 s. Enligt vad sotn framhälls i promemorian torde den sotn bedriver kreditupplysningsverksamhet även i övrigt i betydande utsträckning vara hänvisad att lita till de uppgifter sotn beställaren av en pcrsonttpplysning lämnar rörande sitt behov av upplysningen.

Under remissbehandlingen ltar dessa uttalanden i promemorian om tillämpningen av 9 % lämnats utan erinran av det stora flertalet remissinstan- ser. Datainspektionen ser det emellertid sotn en brist i lagen att det saknas möjligheter att ingripa mot den som vilseleder ett kreditttpplysningsfi'iretag att lämna ut en personupplysning i strid mot 9s.1nspektionen uppger att flera fall av missbruk har inträffat och anser därför att den sotn begär en personupplysning mäste äläggas att lämna korrekta uppgifter om sitt behov av upplysningen. Enligt inspektionens mening är det inte oritnligt att förena en sädan förpliktelse med straffsanktion.

De upplysningar som har lämnats i samband med retnissbeltandlingen ger vid handen att förutsättningarna för tillämpningen av 9.5 och de därtill knutna san ktionsbestämmelserna i viss mätt ltar rubbats genom utvecklingen inoln kreditupplysningsbranschen. Av vad datainspektionen har anfört i sitt remissyttrande framgår sälunda att legitimitetskontrollen hos kreditupplys- ningsföretagen i praktiken sker huvudsakligen på det mer allmänna sätt som har berörts i departementspromemorian. Under inspektionens tnedverkan har utvecklats en praxis som innebär att kreditttpplysningsfi'äretagen i avtalen med sina abonnenter tar in bestämmelser om att dessa får begära personupplysningar endast under de fi:"trutsättningar som anges i .9 * kreditupplysningslagcn. Dentta utveckling har ytterligare belysts av Upplys- ningscentralen UC AB. som i sitt yttrande uppger att den helt dotninerandc delen av företagets produktion av personupplysningar levereras per träd via direktkopplade datatertninaler till besti'illarna. UC framhäller att detta innebär att ändamälsprövningen enligt 9.5 i det enskilda fallet sker ltos beställaren. Krcditupplysningsförctagets kontroll avser i själva verket beställaren och sker innan ett abonnemangsavtal träffas. Enligt UC kan företaget därjämte i efterhand ingripa mot en abonnent. om det uppdagas att denne missbrttkar abonnemanget.

Den praxis som sälunda har vuxit fratn som en följd av bl. a. utvecklingen av ADB-rutiner hos olika kreditttpplysningsft'åretag bör enligt tttin mening godtas. i all synnerhet som den genom datainspektionens godkännande har blivit fast etablerad. Det är emellertid uppenbart att det då inte är tillräckligt med det ansvar som enligt 9 och 19 se ävilar den som bedriver kreditupp- lysningsverksamhet. Ett ansvar för att de frän integritetsskyddssynpunkt viktiga reglernai 9 & inte äsidosätts mäste läggas även på den som beställer en

K redi tu p plysnin gs- lagen

'Jl I'J

Prop. 1980/81 : [0

pcrsonupplysning. Därmed kan man ocksa lösa det av datainspektionen pätaladc problemet att beställaren av en personupplysning f. n. titan päl'öljd kan vilseleda ett kreditupplysningsff'iretag att länma ut en personupplysningi strid mot os. Som inspektitmen har päpekat f("ircligger här en lucka i integritetsskyddct. eftersom inspektionen givetvis i allmänhet inte heller kan ingripa mot det företag som har utsatts för vilseledandet.

Ett ansvar för beställaren bör. som inspektionen har varit inne på. ästadkommas genom att en ny straftbestämmelse förs in i lagen. Denna bestämmelse bör innebära att beställaren döms till böter. om han genom vilseledande eller pä annat sätt uppsätligcn f("iranledcr att en personupplys- ning lämnas ut till nägon som inte har ett sadant legitimt behov av upplysningen.

4.3.5 Beställaruppgfft [ samband med permmupp/_vx/Ii/lgskupiu

Ett visst samband finns mellan 9 och 11 ååå. Enligt 11 & skall. när en persomlpplysning lämnas. den som avses med upplysningen samtidigt och kostnadsfritt ges ett skriftligt meddelande om upplysningens innehäll (s. k. personupplysningskopia). Denna bestämmelse i ll s bör i sin tur ställas samman med bestämmelsen i ltt &. Enligt denna bestämmelse har var och en även enskilda näringsidkare m. fl. samt juridiska personer rätt att mot en skälig avgift fä ett skriftligt besked av den som bedriver kreditupplysnings— verksamhet om innehället i de uppgifter som finns lagrade om honom (s. k. registerbesked).

Vid tillkomsten av krcditupplysningslagcn diskuterades ingående. om inte den som har rätt till registerbesked och pcrsonupplysningskopia ocksä borde ha rätt att samtidigt fä uppgift om vem sotn har erhallit kreditupplysning. ! det utredningsbetänkande som läg till grund för lagstiftningen l'i'äreslogs att säväl registerbesked som kreditupplysningskopior skulle innehälla uppgift om beställaren. Förslaget motiverades främst med att den enskilde själv borde få möjlighet att kontrollera att en personupplysning om honom inte hade lämnats till nägon obehörig. Rätten att i registerbesked och kreditupp- lysningskopia fä uppgift om beställaren ansags emellertid böra gälla även företag m. tl. (se SOU 1972z79 s. 88 och 93).

De nu berörda förslagen ledde dock inte till lagstiftning. ] prop(.>sitionen med förslag till kreditupplysningslagen framhöll föredragande statsrädet att den enskilde i allmänhet torde ha ett begränsat intresse av ifragzo'arande uppgifter. Om den enskilde fick veta att en presumtiv kreditgivarc hade begärt kreditupplysning om honom. ansägs det rentav i vissa fall kunna skada förhällandet mellan dem. Vid misstanke om att regeln i 9 & om legitimitets- kontroll hade äsidosatts kunde den enskilde enligt föredraganden vända sig till tillsynsmyndigheten och begära undersökning. Beträffande företagsupp- lysningskategorin innebar propositionsförslaget över huvud taget inte nägon rätt till kreditupplysningskopia utan endast en rätt att pä begäran fä

Kreditupplysning- lagen

'J | '.»)

Prop. HSO/81:10

registerbesked. l fräga om bcställaruppgift i registerbesked till företag m. Il. hänvisade föredraganden till att det inte föreslogs nägra bestämmelser om legitimitctskontroll pä fi'iretagsupplysningsomrädct. Det fanns därför enligt föredragandcn ännu mindre anledning att pä detta omräde införa en rätt att fä uppgift om vem som hade erhållit kreditupplysning. En sädan rätt skulle enligt föredragandcn ocksä kunna medföra skada inom affärslivet (sc prop. l973:155 s. lll—113). Förslagen i propositionen bifölls av riksdagen (NU 1973269. rskr 379).

Frågan om rätten att i samband med personupplysningskopia fä besked även om beställaren har därefter aktualiserats i riksdagen vid flera tillfällen. bl. a. genom motioner vid riksmötena l97of77 och l977f'78 (mot. l976!'77:52() och 19771782799). Näringsutskottet. som inhämtade datainspektioncns yttrande över den förra motionen. uttalade vid bäda tillfällena att lagen borde kompletteras i detta hänseende. Med hänvisning till den nu aktuella översynen av lagen föreslog utskottet dock inte nägon ätgärd frän riksdagens sida (NU l977:"'78:9 och 53).

I sammanhanget bör nämnas att Upplysningseentralen UC AB samt ytterligare ett större krcditupplvsningsföretag har erhällit tillständ för sin kreditupplysningsverksamhet säväl enligt datalagen som enligt kreditupplys- ningslagen. [ tillständet har datainspektionen med äberopandc av 6 %$ datalagen f('_'u'cskrivit att företagen i pcrsonupplysningskopia skall ange även Vem som har erhållit upplysningen. För UC:s del gäller detta ocksä personupplysning som lämnas i UC:s bankinterna verksamhet.

[ departementspromemorian har mot den nu angivna bakgrunden föreslagits att den som avses med en personupplysning skall ha rätt till besked inte bara om upplysningens innehäll utan även om vem som har begärt upplysningen. En bestämmelse om detta skall enligt förslaget tas in i 11 & krcditupplysningslagcn.

Detta förslag har vid remissbehandlingen tillstyrkts eller lämnats utan erinran av praktiskt taget alla remissinstanser. under förutsättning att personupplysningsbcgreppet behälls oförändrat.

För egen del ansluter jag mig till uppfattningen att det frän integritets— skyddssynpunkt är angeläget att den enskilde omedelbart och pä egen hand kan konstatera vem som har begärt en personupplysning om honom. F. n. kan den enskilde. när uppgift om beställaren inte har lämnats. visserligen fä denna uppgift via datainspektionen. som med stöd av sina tillsynsbefogen- heter enligt kreditupplysningslagen kan inhämta uppgiften frän den som lämnat personupplysningen. Detta är emellertid ett omständligt förfarande. som enligt vad datainspektionen har utvecklat i sitt tidigare nämnda yttrande till riksdagens näringsutskott (se NU |977i7819) är resurskrävande för bäde kreditupplysningsföretagen och inspektionen.

Jag förordar därför att l l & kreditupplysningslagen kompletteras med en bestämmelse som innebär att den som avses med en personupplysning skall. samtidigt som han erhåller en pcrsonupplysningskopia. lämnas skriftligt

Kreditupplysnings- lagen

Prop. 1980/81 :10 54

besked om vem sotn har begärt personupplysningen.

Det katt naturligtvis ifrågasättas. om inte ett motsvarande besked om vent som har begärt en personupplysning bör lämnas ocksä i samband nted registerbesked enligt lt) & kreditttpplysttingslagen. Ett sädan beställ-.tt'uppgift skulle kuntta avse exempelvis den senaste tolvmänadersperioden. Frägan ltar inte berörts i departementsprontemorian eller i remissyttrandena. Enligt ntitt mening är emellertid en reglering av detta slag inte erforderlig. om ntan föreskriver att uppgift om beställaren skall lämnas vid varje tillfälle dä en personttpplysning lämnas ut. Det synes f. ö. inte uteslutet att detta i praktiken kommer att leda till att även uppgifter om tidigare beställare tas in i registerbeskeden.

4.2.6 Krcdiitqtpfysningskopia till enskilda näringsidkare rn. _lf.

Förslagen i departementspromemorian innebär att alla enskilda personer. dvs. även enskilda näringsidkare och andra enskilda ttted ett mera väsentligt inflytande i viss näringsverksamhet. skall ha rätt att fä besked om inne hållet i en lämnad kreditupplysning och om vent som [tar begärt upplysningen.

Dessa förslag hänger samman med det förslag om en utvidgning av begreppet personttpplysning sotn ltar behandlats i avsnitt 4.2.3 . Som har angetts där har denna utvidgning mött stark kritik frän flera remissinstanser. bl. a. företrädare för banker och andra kreditgivare. för kreditupplysnings- branschen och för näringslivet. Dessa remissinstanser är ocksä negativt inställda till att näringsidkare m. fl. skulle få rätt till kreditupplysningskopia och till besked om vent som har begärt upplysningen. Även andra remissinstanser. säsom bankinspektionen. Sveriges advokatsatttfund och TCO. tar avstånd frän detta förslag eller ifrågasätter dess lämplighet. Ett del företrädare för näringslivet. t. ex. SAF och Sveriges industriförbund. tillstyrker dock förslaget helt eller delvis.

Datainspektionen anser för sitt del att det bör ("))-'Cl'VägltS att ge ocksä vissa juridiska personer. 1. ex. handelsbolag och mindre aktiebolag. en rätt att fä kreditupplysningskopia. Inspektionen pekar ä andra sidan pä att en utvidgning av rätten att fa en sädan kopia kan medföra problem för den s. k. löpande kreditbevakningen. Dentta bevakning innebär att en kreditupplys- ningsabonnent fortlöpande fär besked om betalningsfi.)rstuttmelser m. ni. som har registrerats pä abottnentens kunder. bl. a. enskilda närittgsidkare. Be 'akningcn är enligt inspektionett synnerligen värdefull. För att den inte skall bli alltför kostsam. om rätten till kreditupplysttingskopia utvidgas. anser inspektionen att kreditupplysnittgsföretagen i stället för att sända ut en kopia vid varje bevakningstillfälle borde kutttta lämna den företagare sotn avses med bevakningen besked om att bevakning har inletts.

För egen del vill jag till en början erinra om attjag i avsnitt 4.2..3 ltar intagit den stf'tndpunkten att de regler i 7 och 8 ss kreditupplysningslagcn som

Kreditupplysnirtgs- lagen

'Jt 'Jl

Prop. HSO/81:10

begränsar möjligheterna att inhämta information inte bör utsträckas till att omfatta även kreditupplysnittgar om enskilda näringsidkare m. fl. Som framgär av vad jag anförde där katt det etnellcrtid ifrägasättas om inte denna kategori däremot bör lta rätt att fä besked om innehället i en lämnad kreditupplysning och om vent som har begärt upplysningen.

Vad först angär frägan om rättctt att otttedelbart och kostttadsfritt fä besked om innehället i en lätttnad kreditupplysning är det enligt min ntenittg klart att en sädan rätt skulle innebära en förbättring av de här aktuella enskilda personernas integritetsskydd satttt frantför allt minskade risker för oriktiga eller tnissvisandc kreditupplysningar. Ett krcditttpplysningskopia ger ett starkt ittcitamettt till kontroll av de uppgifter sotn har lämnats i ärendet. Detta kan i sitt tur leda till att rättelse päkallas och verkställs satttt tillställs den sotn ltar fätt del av upplysningen. Uppgifterna katt naturligtvis ocksä vara av sädan art att de föranleder en hänvändclse till datainspektionen eller andra ätgärder. .lag vill erinra om att regeln i 5 i om att kreditupplys- ningsverksanthet skall bedrivas sä att den inte leder till otillbörligt inträttg i nägons personliga integritet gäller till förttti'ut även förenskilda näringsidkare m. tl. Detsamma gäller rättctt till skadeständ enligt ll & pä grund av integritetskränkning.

Redan i dag gäller att säväl enskilda näringsidkare m. fl. som juridiska personer har rätt till registerbesked enligt lll å kreditupplysnittgslagen och att enskilda näringsidkare därjämte i fi'ärekommande fall har rätt till registerbesked enligt 10% datalagen. Detttta rätt till registerbesked ger kontrol[möjligheter av liknande slag som dä en kreditupplysttittgskopia lämnas. De farhågor som har framförts under rentissbehattdlittgen föratt en rätt till besked om innehället i en lämnad kreditupplysning skttllc kunna leda till svårigheter att samla in relevanta uppgifter katt därför knappast lta fog för sig. Enbart en rätt till registerbesked är dock från itttegritctsskyddssyttputtkt inte likvärdig med en rätt till kreditupplysningskopia. som har den betydelsefulla funktionen att direkt uppfordra till en kontroll av de uppgifter som har lämnats ut. Av dessa skäl anser jag att principen bör vara att ettskilda personer som är näringsidkare c. d. skall, ttär en kreditupplysning ltar lämnats. samtidigt och kostnadsfritt tillställas ett skriftligt meddelande om de uppgifter som upplysningen innehäller.

Den nuvarande rätten till kopia av personupplysning innebär att besked skall lämnas om hela innehället i upplysttingcn. alltsä även om räd och omdömen. Dentta ordning synes inte lta tttcdfi'irt nägra olägenheter. Förhållandet katt emellertid bli ett annat när det gäller företagsupplysningar. i synnerhet om en kreditupplysning lämnas av t. ex. företagets bankförbin- delse. l sammanhanget katt erittras om att rätten till registerbesked enligt 1055 kreditupplysningslagen i och för sig inte torde innebära rätt till besked rörande räd och omdömen. även om sädana ltar registrerats. Det kan inte uteslutas att en ovillkorlig rätt för näringsidkare nt. fl. till besked inte bara om faktiska uppgifter tttan även om räd och omdömen katt fä skadliga

Krcdiluppfvsttings- lagen

Prop. 1980/81:10 So

effekter i vissa fall. Nägon allmän skyldighet att lämna besked om räd och omdömen till näringsidkare nt. fl. bör därför inte fi'treskrivas.

l fräga om meddelandets ittneltäll komnter skyldigheten att lämna kreditupplysttingskopia till enskilda näringsidkare m. fl. sälunda att överens- stämma ntcd skyldigheten att lättttta registerbesked enligt 10 & kreditupplys- ningslagett. Det bör emellertid framhällas att detta inte inskränker den skyldighet som. om kreditttpplysningsverksamhet bedrivs med hjälp av ADB. föreligger enligt lU å datalagen att lättttta besked även rörande registrerad persottuppgift som bestar av (uttdt'mte eller annan värderande upplysning (jfr oå andra stycket datalagen).

De bestämmelser om kreditttpplysningskopia till enskilda näringsidkare m. fl. sotn jag nu har fömrdat bör tas in i 11 å kreditupplysnittgslagcn. Jag kan inte finna tillräckliga skäl att. som datainspektionctt har satt i fräga. föreslä nägot ttndantag betrt't'ffande uppgifter som lämnas ittotn ramen för s. k. 'löpande kreditbevakning. Det främsta syftet med rätten till besked om de uppgifter som har lämnats i en kreditupplysning är att den som upplysttittgett avser skall sättas i tillfälle att omedelbart kontrollera de uppgifter sotn ltar lämnats om honom. Detta syfte skulle enligt tttin mening kunna förfelas. om enskilda näringsidkare vid löpande kreditbevakning endast skulle fä besked om att en sädan bevakning ltar inletts.

Som ltar framltällits av bl. a. datainspektionctt fitttts det i och för sig skäl som talar för att rätten till kreditttpplysnittgskopia utsträcks till att otnfatta även kreditupplysningar rörande ätminstone en del juridiska personer. Av kostnadsskäl och ttted hänsyn till de olika praktiska sväriglteter sotn katt uppkomma anser jag emellertid att man bör avstä fran en sädan utvidgning. De här diskuterade besti'tmmelserna bör alltsä gälla endast ettskilda f_ ;iska

personer.

Vad härefter attgär frägatt huruvida enskilda näringsidkare m. fl. bör ges rätt till besked ocksä om vetn som ltar begärt en krcditttpplysnittg syttes det vara klart att redan rätten till kreditupplysningskopia i mänga fall komttter att innebära att vederbörande kan sluta sig till vettt som har begärt upplysning— ett. Detta torde i allntänhet inte medföra nägra ttegativa effekter. Att kreditgivare och andra som avser att träda i ekonomisk förbindelse med en näringsidkare inhänttar kreditupplysning om denne mäste fratnstä som en helt naturlig ätgärd. som näringsidkare lika väl som andra har attlcdtting att räkna ntcd. Det kan etttellcrtid inte bortses frän att en rätt till bcställaruppgift pä detta område i en del fall kan medföra olägenheter. Oftast torde det dä också vara fräga om situationer där den oml'rägade inte redan pä gruttd av att han erltäller ett kreditupplysningskopia kan sluta sig till vent som har beställt upplysningen-. Jag tättker exempelvis på fall där nägon begär kreditupplys- ning ont ett företag i syfte att undersöka om det katt vara intressant att söka förvärva dess rörelse eller där ttägott som avser att söka anställning ltos ett företag själv eller genom sin fackliga (:trganisation begär upplysningar om detta. Ett skyldighet för kreditupplysnittgsfi'tretag m. fl. att ta reda pä och

K redituppl ysnin gs- lagen

Prop. 1980/81 :10 57

uppge vem som ltar begärt en kreditupplysning om näringsidkare nt. fl. kan också välla vissa problem när beställaren finns i utlandet. Till det nu anft'irda kommer att jag i ett föregaende avsnitt (4.3.3) har intagit den ständpunkten att reglerna om legitintitetskotttroll i os kreditttpplysttingslagett inte bör utsträckas till att gälla även kreditupplysningar om enskilda näringsidkare m. fl. Beträffande denna kategori fitttts därför inte samma skäl sotn dä det gäller personupplysttingartta att införa en skyldighet att lämna uppgift även om vem som har begärt en kreditupplysning. Jag föreslär säledes inte nägon bestämmelse om detta.

4.2.7 S. k. äkta make-uppfvs'ningar

Datainspektionen tog i sin promemoria rörande kreditupplysnittgslagen upp frägan om tillämpningen av bestäntmelsertta i 9 och l l ss vid s. k. äkta make-upplysningar. Inspektionen uppgav att ttär persottupplysnittg begärdes om en gift person uppgifter rutinmässigt lätttnades rörande bäda makarnas ekonomiska förhällanden. ()fta var det dock endast en av makarna som hade trätt i kontakt med t. ex. en kreditgivare. ibland tttan den andre makens Vetskap eller mot dennes vilja. Inspektionen fick redan är 1975 taställttittg till dentta praxis. som hade tillämpats alltsedan tiden före kreditupplysningsla- gens tillkomst. Inspektiotten godtog den dä, trots att den enligt ittspektiottetts mening inte helt överettsstäntde med ordalagett i 9 9. Vidare uppgav inspektionen att i nu berörda fall personupplysningskopia enligt ll & tillställdes endast den av makarna beträflant'le vilken upplystting hade begärts. Kopian innehöll även uppgifterna om den andra maken.

Enligt departemetttsprtmtemorian katt den praxis sotn sälunda har tillämpats i fräga om äkta tnakc-upplysningar inte anses förenlig med vare sig 9 eller 11 & kreditupplysningslagett. I promemorian konstateras att de uppgifter som lämnas om de ekonomiska förl'tällandena för den make som inte har omfrägats utgör en personupplysnittg avseende dentte. Av" detta följer att reglerna i 9 och l I så är tillämpliga även pä dessa uppgifter.

När det gäller tillämpningen av 9 & i hithörande fall uttalas i promemorian att den som överväger att lämna kredit till en gift person eller att annars träda iekonomisk förbindelse med en sädan person i ätskilliga fall torde fä anses lta ett legitimt behov av upplysningar ocksä om den andra maken. ('.'-ruttden för detta är bl.a. den faktiska ekonomiska gemenskap som räder i mättga äktenskap. I sammanhanget ttäntns vidare makars solidariska ansvar för vissa skulder enligt bestämmelserna om s. k. hushällst'ullmakt i 5 kap. 12 & giftermälsbalken.

I promemorian understryks emellertid att detta inte betyder att person- upplysning rörande den andra maken tttan vidare bör fä lämnas ut sä snart upplysning begärs om en gift person. Först och främst mäste krävas att den som beställer kreditupplysning faktiskt begär upplysningar om bada makar- na. Vidare bör det enligt promemorian bero av otnständigheterna i det

Kreditupplysn ing.?- lagen

Prop. 1980/81 :10 58

enskilda fallet. huruvida pä gruttd av en sädatt begäran perstmupplysning rörande andra maken skall fä lämnas ut till den som ("tt-'erväger t. ex. att lämna kredit till en gift person. litt behov av upplysningar rörande den andra maken katt sälunda inte alltid attses f("treligga. Bland faktorer som kottttner i betraktande nämns i protttetttoriatt den kreditsi'lkandes egen inkomst. den sökta kreditens storlek och arten av de uppgifter som fitttts registrerade om den andra maken.

Om makarna bor pä olika adresser. bör enligt protttetttoriatt upplysttittgari regel inte lätttttas ut om de ekonomiska förhällandena för den kreditsökattdes make. Detta motiveras ttted att nägott faktisk ekonomisk gemenskap tttellatt makarna tttera sällatt katt antas föreligga ttär de varaktigt lever atskilda. När satttmanlevnat'len mellan tttakar är hävd gäller inte heller reglerna om Itusltällsfttlltttakt.

I departetttetttspromentoriatt fratttltälls att den önskvärda ätstramningen av tidigare tillämpad praxis" inte fordrar nägon ättdrittg av 9 s. Den katt enligt j_)rontentorian ästadktmttttas genom att dataittspektiottett i sitt egenskap av tillsyttstttyttdighet utfärdar anvisningar för tillämpningen av 9 s' när det gäller upplysttittgar om den kreditsökattdes make.

Beträffande tillätnpningett av ll & vid s. k. äkta make-upplysningar släs i promemorian fast att paragrafen redan i dag innebär att meddelande enligt paragrafen mäste lämnas även till den kreditsökattdes make. eftersottt de uppgifter sont lämnas rörande dennes inkomst och andra ekonotttiska förhällanden är att betrakta som en personupplysttittg om ltottottt eller Itenne. I sattttttattltattget aktualiseras emellertid ocksä frägan om innehället i meddelande enligt 11 & ttär det i ett kreditupplysttittgsärettde sälunda ltar lämnats uppgifter om flera personer. Att en make genom en personupplys- ttittgskopia fär del även av de uppgifter som [tar lämnats om den andra ntaketts ekonomi katt ettligt prontemorian i vissa fall innebära att den senare utsätts för en integritetskränkttittg. Fij'trfarandet stär enligt protttetttoriatt ocksä i mindre god överettsstättttttelse ttted nutida sytt pä makarna i ett äktenskap som tvä självständiga individer. I promemorian fi.")resläs därför ett tillägg till Il &. Ettligt detta skall. ttär som ett led i en personupplysning uppgifter har lämnats även om en annan person. detta visserligen anges i meddelande enligt ll & jämte den andra personens namn. h'leddelandet fär emellertid ittte innehälla nägra andra uppgifter rörande den persottett ätt identitetsuppgifter och adress.

Det stora flertalet remissinstanser ltar godtagit de uttalanden och förslag som departetttentspromemorian innehäller i fräga om de s. k. äkta make- upplysttingartta. De berörs närmare endast i ett fätal yttranden.

Upplysningscentralen LK" AB uppger att företaget redan tidigare och ttted goda erfarenlteter Itar hanterat äkta make-upplysttittgarna pä ett sätt som i huvudsak överensstämttter ttted förslagett i pl't'HIICl'nOI'ILIII. UC vänder sig dock tttot uttalandena om en närmare pri'ävnittg i det ettskilda fallet av en beställares behov av persottupplysttittg även om den kreditsökattdes make.

Kreclinrpp/vsn[ngt- lagen

Prop. 1980/81 : 10 >()

En sädatt prövning skulle enligt UC medfiftra drifttttässiga nackdelar. som Kreditupp/vsniltgs— ittte uppvägs av vinster i form av ett förbättrat integritetsskydd för den lagen enskilde.

Datainspektionen uppger i sitt retttissyttrattde att ittspektiottett efter överläggningar ttted bl. a. kreditupplysttingsfi'iretagcn och företrädare för kreditgivare ltar ttätt en överenskommelse uttder Itattd om att uppgifter om den ej kreditsökattde makens ekonomi i fortsättnittgen inte skall förekomma i personupplysningar. Den enkla och praktiska lösningett är enligt datain— spektiottens mening att endast den tttake som söker kredit fär bli föremäl för personupplystting. Pä grund härav avstyrker ittspektiottett även den föreslag- na ändringen av 11 &. Finattsieringsföretagens förening redovisar i sitt yttrande ett starkt kritisk ittställttittg till den av dataittspektionen ttämttda överettskottttttelsett.

Datainspektionen har den 4 oktober 1979 utfärdat vissa föreskrifter för tillämpning av 9 och 11 st kreditupplysningslagen (dataittspektiottetts författttingssatnlittg. DIFS. 197911). I dessa föreskrifter. som skall iakttas settast fr. o. m. den 1 januari 1980. anges att personupplysnittg om en gift person inte fär itttteltälla kreditupplysningsittfortttatiott om den andra maken. Ont makarna ltar likalydande adress far uppgift däremot lämnas om den andra makens namn och personnummer. Föreligger behov av person- ttpplysnittg om bäda makarna. fär upplysning lämnas ut om var och en av dent. Iittligt föreskrifterna skall sädant behov anses föreligga ttär makarna söker kredit (eller ntotsvarande) gemensamt.

Finattsierittgsföretagens förening ltar i en skrivelse till justitiedepartemen- tet den 5 februari 1980 riktat kritik mot dessa föreskrifter. Föreningen Itar i skrivelsen fört frattt liknattde synpunkter som i sitt remissyttrande.

För egen del vill jag först fratttltälla att tillämpningen av () s* kreditupplys— ningslagen inte synes tttedföra ttägot särskilt problem. om tvä tttakar gentensatttt söker kredit eller avser att gemensamt ittgä ett annat avtal som medför ekonomiska förpliktelser för dent. liksom inte heller om den ena maken ställer sig som borgensman för den andres förpliktelser enligt ett kreditavtal c.. d. I sädana fall framgär det direkt av 9 s att det inte fitttts ttägot Itittder tttot att motparten i avtalet erltäller persottttpplysttingar om bäda makarna.

Nären gift person ensam träder i förbindelse t. ex. ttted en kreditgivare för att ansöka om en kredit för egen del uppkommer emellertid frägan i vad män det i en kreditupplysning rörande honom eller henne bör fä lämnas uppgifter även om den andra makens ekonomi. Den praxis som tidigare under manga är tillämpats ltar inttebttrit att uppgifter regelmässigt ltar lämnats även beträffande den andra tttakcns ittkomstet"m. m.. i vart fall dä makarna ltar varit sattttttanboettde. I dettna praxis synes inte tillräckligt lta beaktats att uppgifterna om den andra maken inte enbart utgör ett led i kreditupplysv ningen om den kreditsökande utatt även mäste betraktas sotn en självständig kreditupplysning avseende denttes make. I hithi'trattde fall fiftreligger alltsä.

Prop. 1980/81:10 . (ut)

som ltar fratttltällits i departetttentsprtmtemorian. i själva verket tvä Kreditupplysnings- kreditupplysnittgar. ()m tt|_t|_tlysningett beträffande den andra maken utgör 11180" en persrmupplysning. vilket i allmänhet torde vara fallet. skall säledes reglerna i 9 och 11 åå tillämpas pä den. Detta synes ttutttera allmänt erkättttas. Däremot ltar framkommit att det räder delade meningar om i vilken utsträckning t. ex. en kreditgivare katt anses lta ett sädant behov som

avses i 9 & av en personupplysning även beträffande den kreditsökattdes make. Detttta fräga har i dataittspektionetts tidigare berörda föreskrifter

lämnats öppen.

När det gäller att bedöma en gift persons förtttäga att fullgöra ett ekonomiskt ätagande kan. som ltar fratttltällits i departentetttsprotttetttorian. beskaffenheten av makarnas samlade ekonomiska situation i en del fall vara av betydelse. I mänga äktenskap räder i stor utsträckning en faktisk ekonomisk gemenskap. som innebär att makarna tillsanttttans fullgör olika ekonomiska förpliktelser även om det rättsliga ansvaret för dessa är uppdelat mellan makarna. l realiteten utgör dä makarnas totala ekonomi deras underlag för krediter och andra förpliktelser. tttedatt det katt bero pä tillfälligheter eller på överenskommelse mellan makarna vettt av dent som skall bära det rättsliga ansvaret för ett ätagande. Även för de fall där makarna tttera strikt skiljer mellan den enes oelt den attdres ekonomi kan det ttär det gäller att bedöttta den enes betalttingsförmägä vara av betydelse. om den attdre Itar en sädan ekonomisk situation att makarna kan antas i lika hög grad bidra till familjens försörjning eller om en av dettt mäste antas helt eller till större delen stå för denna". Det bör understrykas att detta är en annan sak ätt attt. ex. en kreditgivare räkttar ttted att den kreditsökattdes tttake skall träda in och faktiskt svara för den andres ätaganden. Ett sädant motiv bör givetvis inte tillmätas betydelse i detta sammanhang.

Det tttt anförda innebär att den sotn ("överväger att lämna kredit till en gift person eller att annars träda i ekonomisk förbindelse ttted en sådan person i vissa fall mäste anses ha ett legitimt behov av upplysningar ocksä om den andra tttaketts ekonomi. även om avsikten inte är att detttte skall lta det rättsliga ansvaret för den kreditsökande makens förpliktelse. Att sädana upplysttittgar läntnas kan i regel inte anses utgöra nägot otillbörligt inträttg i den andra makens personliga integritet.

>a grund av det som jag nu har sagt katt jag inte ansluta mig till den ständputtkt som datainspektionen Itar intagit i sitt remissyttrande. ttäntligett att i ett kredituplysningsärende uppgifter aldrig skttlle fä lätttttas om den av tttakarna som inte själv söker kredit e. d. Detta skulle kräva nya särskilda bestämmelser i Iagett. vilka kan leda antingen till att kreditgivare m.fl. kräver att bäda ntakarna skall stå som kredittagare eller ntotsvarattde. nägot som knappast s_vnes vara till fördel för makarna. eller till att kreditbedi'tm- ttittgett i hithörande fall kommer att vila pä ett otillfret'lsställande under- lag.

De uttalanden som departetttentsprotttemorian itttteltäller rörattde till-

Prop. HSO/81:10 (tl

lätttpningen av 9 s* i äkta make—fallen ltar som tidigare nämnts godtagits av det stora flertalet retttissinstanser och innebär även enligt tttitt tttettittg en i ltuvudsak riktig och lämplig grttttd för praxis pä omrädet.

För att en personupplystting rt'ftrande tttake till den sotn söker kredit c. (1. skall fä lämnas ut mäste sälttttda för det första alltid krävas att en uttrycklig begäran om detta framställs. [ de fall dä makarna sattttnattbor bör det vidare bero av omständigheterna i det enskilda fallet fratttför allt den kreditsö- kattdes egen inkomst och den sökta kreditens storlek om på grtntd av en sådan begäran personupplysning skall få lämnas beträffande den kreditsö- kattdes make. Exempelvis kan en kreditgivare ttär det är fräga om ettdast tnittdre krediter knappast anses lta nägot beaktansvärt behov av upplysningar även om den andra makens ekonomiska förhällanden.

Enligt mitt menittg mäste man emellertid pä detta otttrt'ide. liksotn ttär det gäller tillämpningen av 95 i övrigt. ha förstäelse för att ett kreditupplys- ttittgsföretag inte rimligen kan göra nägon ingäcnde prövning i varje ettskilt fall. [ satttntanhanget bör vidare erittras om det i avsnitt 4.2.4 berörda förhållandet att pri'ivttingett enligt 9 5 i det enskilda fallet i praktikett ofta görs av beställarett av en personupplysning. Med ltättsytt till dessa omständigheter samt till att så är straffsanktionerad synes det lämpligt att den ttätttttda prövningen fär ske med tillätttpttittg av ett eller flera mer schablonmässiga kriterier. som bör kunna fastläggas av datainspektionen nted stöd av 7,5 kreditupplysningskungörelsett (19742326). Ft't'reskrifterna torde böra utfär- das efter samråd med kreditupplysttingsft'tretag och företrädare för kredit- giv-'arsidan.

l departententsprotnetttoriatt sägs att den som överväger att träda i ekonomisk förbindelse med en gift person i regel inte katt attses lta nägot sädant legitimt behov av upplysningar rörande den andra makens ekonomi som avses i 9 & kreditttpplysttingslagett. om makarna lever atskilda. Jag attsluter mig till detttta uppfattning. som ocksä har biträtts av remissinstan— sertta. Som har framhållits i promemorian katt det i sadana fall endast mera sällan antas föreligga en sädan faktisk ekonomisk gemenskap ntellatt makarna som tidigare ltar berörts. Bestt'immelserna om s. k. hushällsfull- makt för make i 5 kap. lZ ågiftermälshalken gäller inte ttär sammanlevnaden mellan makarna är hävd. Regelmässigt torde ocksä vardera maken i den här aktuella situatiottett s tara för sitt egett försörjttittg. Om det i ett kreditupp- lysnittgsärettde beträffande en gift person framgär att makarna bor pä olika adresser. bör sälunda i enlighet ttted vad som ltar anförts i departements- promemorian ett persottupplysttittg om den andra maken lämnas ut endast om det undantagsvis kan visas att makarna trots detta lever i sädan ekonomisk gemenskap att exempelvis en kreditgivare mäste anses lta behov av en sädan upplystting.

Vad härefter angär tillämpningen av 11 & kreditupplysttingslagen i äkta make-fallen följer. som ltar konstaterats i departementsprontemoriatt. direkt av paragrafen i dess nuvarande lydelse att en persottupplysningskopia skall

K rer/ituppf vsnin g.s- lagen

Prop. 1980/81110 (13

tillställas var och ett av makarna. ont det i ett kreditupplysttingsärende ltar lämnats persottupplysttittgar rörande dent bäda.

När det gäller innehället i persottupplysttittgskopiatt attslttter jag tttig till förslaget i departetttetttsprotttentoriatt att kopian alltid skall itttteltälla upplysttittg om att uppgifter i ärendet har lämnats även rörande en annan person satttt om dettttes ttatttn. För den som exempelvis ltarsökt kredit mäste det nämligen anses vara av betydelse att fä veta att bedömningen av hans eller ltettttes kreditvärdighet katt lta gjorts ttted beaktande även av uppgifter rörattde en annan persott. En bestäntntelse av den angivna innebi'irden bör tas ttpp i ll .»5. .lag förot't'lar vidare att det i paragrafen f("trcskrivs att en persottup|.tlysnittgskopia inte fär innehälla andra uppgifter om den andra personen ätt idetttitetsttppgifter.

4.2.8 Riitta/sc tll" oriktiga eller missvisande uppgifter i Å'retlitupplysning eller register

Det katt ittträffa att en uppgift som ltar lätttttats ut i en kreditttpplysttittg eller som f(ftrekomnter i ett kreditupplysttittgsregister är oriktig eller missvisande. Uppgiften bör i sä fall rättas sa längt detta är praktiskt tttöjligt och päkallat av hänsyn bl. a. till den som uppgiften avser. Bestämmelser om detta fitttts i lZå kredituppl_x-'sttittgslagen.

Enligt 12 & första stycket skall den som bedriver kreditupplysningsverk- satttltet tttatt dröjsmäl vidta skäliga utredttittgsätgärdcr. ont det uppkommer attledtting till tttisstattke att uppgift som ltar lätttttats i en kreditupplystting uttder den settaste tolvtttättadersperiodett eller som förekommer i register i verksatttlteten är oriktig eller missvisande. Bekräftar utredningett detttta misstanke skall vissa ätgärder vidtas. förutsatt att den oriktiga eller missvisande uppgiftett inte ttppettbart sakttar betydelse frän kreditupplys— ttingssynpunkt. Detta fratttgär av 12 å andra stycket. där det sägs att oriktiga eller missvisande uppgifter som ft'trekottttttcr i register skall rättas. komplet— teras eller uteslutas ur registret. Har uppgifterna tagits in i en lämnad kreditupplysning. skall dessutom rättelse eller komplettering sä sttart det katt ske tillställas var och ett som ttttder den senaste tolvmänadersperioden ltar fritt del av uppgifterna. Haren fräga om rättelse eller liknande ätgärd tagits tipp efter framställning av den som uppgiften avser. skall dettne enligt 12 t' tredje stycket kostttadsfritt underrättas om huruvida sädatt ätgärd ltar vidtagits.

Av dataittspektiottetts promemoria l'Öl'ttnL'lC kreditupplysttingslagen fram- gär att bestämtttelsertta i 125 ltar vällat vissa problem i den praktiska tillämpningen. l departemetttsprotttetttoriatt föresläs dock inte nägon ändring av 13 å i de delar som nu ltar berörts. Däretttot görs vissa uttalanden om ltur paragrafen bör tillämpas.

Ett av de tillätttpttingsproblettt som ltar ttppkonttttit gäller frägan om vilket

Kreditupplvsnings- lagen

Prop. 1980/81:10 (w.?

underlag som den som öttskar rättelse etc. maste prestera föratt kreditupp— lysningsföretaget skall bli skyldigt att vidta tttredttittgsätgärder enligt 12.5 första stycket. l departetttentspromentorian framhälls att denne självfallet mäste äberopa nägon gruttd för ett pästäende om att en uppgift är felaktig eller missvisande. För att ttttdersökttittgsskyldigltet skall uppkomma katt det enligt prontentorian däremot inte krävas att ttägott egentlig utredning läggs frattt. eftersottt undersökttittgsskyldigltetett syftar just till att ästadkomma utredning. En attttatt sak är att den första undersökttingsätgärden katt bli exempelvis att be den registrerade förete kvitto. om ltatt pästär att ltatt betalt en viss skttld i sädan tid att en notering om betalnittgsförsutttmclsc inte borde lta gjorts.

Dessa uttalanden i departementspromemorian ltar lätttttats tttatt erinran ttttder retttissbehant'llittgen. Ocksä jag attsluter tttig till dent.

Ett attttat problem vid tillätttpttittgett av 12 & bestär i svårigheten i vissa fall att bedöttta om en uppgift är att betrakta som missvisande eller ej. l förarbetena till bestättttttelsctt uttalas till en början att en uppgift om ett skuldförhi'tllande skall rättas. om gäldenären t. ex. genom kvitto visar att skuldett ltar betalts. Vidare behandlas den situationen att nagon efter att lta gjort sig skyldig till ett betalttittgsförsuttttttelse betalar det belopp som försuntntelsett avser. Enligt förarbetena bör ttppgiftcrt om betalttittgsförsunt- ntelsen i detta fall kotttpletteras med uppgift om betalningen. Att betaltting ltar skett bör dock inte medföra att själva uppgiften om betalningsförsum- melsen utesluts. eftersont den även därefter katt lta intresse för bedötttttittgen av den registrerades betalttittgsförntäga och betalningsvattor (prop. 19732155 s. 151 f).

l dataittspektiottetts protttetttoria rörattde kreditupplysttittgslagett fram— hälls att kreditupplysnittgsfi'äretagen över huvud taget inte noterar skuldför- hällattdett som sädatta. Och sedan en betalttittgsförstttttntelsc väl ltar förekommit är det enligt promentorian i allmänhet inte av intresse frän kreditupplysttittgssyttpttttkt. huruvida betalning ltar erlagts senare. ] prome— tttoriatt sägs dock att uppgifter om en fiftrsutttntelse att betala in skatt eller arbetsgivaravgift undantagsvis katt beltöva kompletteras ttted uppgift om försenad betalttittg. eftersont restlängdföring sker även vid en obetydlig försetting och beloppett här katt vara mycket stora.

1 departetttetttsprontetttoriatt uttalas att det ofta torde vara riktigt att det från kreditupplysttittgssyttputtkt väsentliga ttted en uppgift om en fastställd betalttittgsfi'irsumtttelse är just det förhällandet att gäldenären har dröjt så länge tttcd betalttittg att försttmntelsen ltar blivit fastställd av domstol eller attnatt tttyttdigltet. Enligt departementspmmetttorian kan det dock. i ettligltet ttted vad datainspektionen har anfört. i en del fall vara motiverat med en kompletterande uppgift om betalttittg. Tillätttpttittgsproblettt av detttta art bör ettligt departemctttsprotttetttoriatt kutttta lösas genom föreskrifter eller rekomtttendatiotter frän ittspektionetts sida.

Under retttissbeltattdlittgett har dataittspektiotten pä nytt fratttltällit att en

Krall/uppl)ut'/tings- lagen

Prop. 1980/81 : 10 64

uppgift om att betalttittg ltar skett i allmänhet sakttar betydelse frän kreditupplysningssynpunkt. Om kompletterande uppgift rörande betalning noteras i vissa fall men inte i andra. där rättelse inte ltar päkallats. skulle det vidare enligt inspektionen ktttttta leda till sltttsatsett att betalning inte ltar skett i dessa senare fall. Detta katt cttligt inspektionen medföra större olägenheter ätt om komplettering inte görs i nägot fall. lttspektiottett anser emellertid att 12 & enligt förarbetena innebär att en uppgift om betalnings— försttttttttelse alltid mäste kt'tmpletteras ttted uppgifter om betalningar som därefter ltar verkställts, Enligt inspektionen bör bestättttttelsen därför ändras. '

För egen del katt jag till en början understryka vad som sägs i förarbetena om att uppgifter om ett skuldförhällande som katt lta noterats i kreditupp- lysningsregister maste anses missvisande och därft'tr skall rättas. om det visar sig att skuldett scderntera ltar betalts. Som datainspektionen har franthällit katt däremot uppgifter om en betalttingsförsummelse längt ifrätt alltid anses ntissvisande enbart därför att det belopp som betalttingsft'ftrsutttntelsett avser sä stttättittgottt betalas. Betalningen ättdrar nämligen inte det faktum att gäldenären inte ltar betalt i tid. Och ofta är det just detta som är av intresse frän kreditupplysttittgssynpunkt.

Å andra sidan katt det tänkas fall där en uppgift om betalttittgsft'.'tt'sunttttelse fratttstär som missvisande. om den inte kompletteras ttted en uppgift om senare verkställd betalning eller pä annat sätt rättäs. Ett exentpel pä detta katt vara. ttär betalning harskett kort efter förfallodagen. Ett annat exctttpel. som datainspektionen ltar dragit upp. är att betalttingsförsuntmelsctt har avsett skatt eller attttatt allmän avgift. varvid restlättgdförittg sker även om förseningen inskränker sig till bara ttägon dag. Även andra liknande fall kan naturligtvis tänkas. särskilt ttär det gäller enskilda ttärittgsidkare och andra beträffande vilka bestämntelserna i 7.5 kreditttpplysttittgslagett inte gäller. Ytterligare exempel pä att en uppgift om betalningsförsummelse pä här diskuterat sätt kan vara missvisande är ttär betalnittgsförsttttttttelsett har avsett ett sä stort belopp att det finns attledttittg räktta ttted att inte bara själva bctalningsft'ftrsumntelsen kan fä betydelse för kreditbedötrtningen utan även den ontstättdiglteten huruvida beloppet alltjätttt utestär obetalt eller ej.

Slutsatsen av vad jag nu ltar sagt är att det beror av omständigheterna i det ettskilda fallet. om en uppgift om betalttingsl'örsummelse skall anses missvisande därför att den inte ltar kontplctterats ttted uppgifter om senare verkställda betalningar. Vad som sägs i förarbetena till 1215 om ett sädatt komplettering torde enbart ta sikte pä det fallet att (.tmständiglteterna är sädana att uppgiften om en betalningsförsummelse är missvisande. Dessa ttttalattdett kan därför inte utgöra nägot hittder tttot ett sädatt tillämpning av 12 :$ som jag nyss ltar förmdat.

Nägon ättdrittg av 12 & idet hänseende som nu har diskuterats är alltsä inte nödvändig. Som ltar framhällits i departententspromemorian katt det dock vara lämpligt att datainspektionen utfärdar närmare föreskrifter eller

K redi tttp pl _vsnings- lagen

Prop. 1980/81:10 65

rekottttttendationer till ledttittg för kreditupplysnittgsföretagen m. fl. om hur 125 bör tillämpas när det gäller kotttplettering av uppgifter om betalnings- försummelser med uppgifter om verkställda betalningar.

Enligt 12 å andra stycket "gäller särskilda regler när en oriktig eller missvisande uppgift ltar tagits in i kreditupplysning som lämnas genom tryckt skrift. I ett sådant fall föreligger inte någon skyldighet att tillställa den som har fått del av uppgiften ett nteddelande om rättelse eller komplettering. Är det fråga om en periodisk skrift. skall dock rättelse-eller komplettering så snart det kan ske föras in i ett följande nummer.

1 departementsprontemorian har inte f("öreslagits nägon ändring av dessa särskilda regler om rättelseskyldigheten. Vid retttissbeltandlingen har datainspektionen emellertid ansett att det bör ("övervägas att skärpa reglerna om rättelsemeddelattde när det gäller kreditupplysning som har publicerats i en periodisk skrift. Ont t. ex. en oriktig uppgift av graverande karaktär har publicerats i en sädan skrift. kan det sälunda enligt inspektionens mening vara päkallat nted en rättelseätgärd utöver den föreskrivna skyldigheten att ittföra rättelse eller komplettering i ett följande nttmttter av skriften.

För tttin del finner jag det inte päkallat med en sådan skärpning av reglerna som datainspektionen har ifrågasatt. Skadeständsskyldigheten ettligt 21 å torde utgöra ett tillräckligt incitantettt för den som har lämnat upplysningen att i sädana fall som har nämnts av inspektionen vidta även andra rättelseätgärder. om det kan ske. Har den oriktiga uppgiften vällat skada. katt den ansvarige givetvis inte undgå skadestättdsskyldighet genom att åberopa att skadan ltar inträffat innan han ännu varit skyldig att enligt 12 å andra stycket lämna meddelande om rättelse e. d.

Vid retttissbehandlingen har fratnkontmit att ett av de i kreditupplysnings- sammanhang allvarligare problemen för bl. a. småföretagare är att de kan bli föremål för oriktiga eller missvisande uppgifter om en försutttmelse att betala skatter eller andra allmänna avgifter. Anledningen till detta ltar uppgetts vara att kreditupplysningsföt'etagen ittltättttar ttppgifter frän länsstyrelsernas restlängder innan dessa ännu har hunnit korrigeras med hänsyn till eventuellt lämnade betalningsanstånd m. m. Enbart rättelseskyldigheten enligt 1215 kan här inte anses tillfredsställande. Problemen i nu berörda och liknande fall gäller nämligen främst frågan vilket underlag sotn bör användas för registreringi kreditupplysningsverksamhet. Denna fråga katt inte lämpligen regleras direkt genom uttryckliga bestämmelser i kreditupplysningslagen. Ettligt min mening är det däremot päkallat att lagen ger ett klart stöd för att datainspektionen. i de fall då det framstår som angeläget. meddelar generella föreskrifter rörande frågor av detta slag. Detta kan åstadkommas genom ett tillägg till den allmänna bestämmelsen i 5 ä. vilket tar sikte på att motverka bl. a. registrering av oriktiga eller missvisande uppgifter i kreditupplysnings- verksamhet.

Pä grund av det nu anförda föreslår jag att det i 5 s kreditupplysningslagcn

5 Riksdagen 198018]. I sam/. Nr 10

Kreditupplysnirtgs- lagen

Prop. 1980/81 : 10 ("»(t

föreskrivs att krcditttpplysnittgsverksatttltet skall bedrivas sä att den bl. a. inte leder till att oriktiga eller missvisande uppgifter lagras eller lämnas ut.

4.2.9 U) .7 'i ler om bem/nin '.r '("irxuntmt'lscr [ )crsonu ) J/t'xninear t .. I I .

Enligt 7 .5 första stycket kreditupplysnittgslagen får en personupplysttittg inte innehålla uppgift om andra betalnittgsförsumntclser ätt sädana som ltar fastslagits genom domstols eller annan myndighets avgörande eller ätgärd eller som har lett till betalningsinställelse. konkursansökan eller ackord. Uppgifter som sälttttda inte får läntnas ut fär ittte heller lagras i kreditupp- lysningsverksatttltet. [ praktiken ltar detta förbud sitt största betydelse ttär det gäller s. k. attsökttittgsttppgifter. dvs. främst uppgifterom att nägon har blivit föremål för anst'ftkan om stämning. lagsökning eller betalttingsföreli'tggande. Förbudet gäller emellertid ocksä andra uppgifter rörande bctalningsförsum-

melser som inte ltar fastställts pä ett sådant sätt som attges i 7 & första stycket. _ Som exentpel kan ttätttnas uppgifter om inkassoätgi'trd. kreditspärr eller misskötsel i olika hänseenden av krediter.

Enligt 7 sandra stycket ltar datainspektionen rätt att medge ttndantag frän förbudet iförsta stycket. Bakgrunden till att denna dispensntöjlighet infördes var främst förhållandena inont avbetalnittgsltandeltt. där det vid lagetts tillkontst fanns en omfattande registrering av ltur kredittagare skötte sitta krediter. Ett undantagslöst förbud mot ttppgifter om betalningsförsummel— ser som inte hade fastslagits av myndighet ansägs medföra risk för en ogynnsam utveckling på detta onträde. liksom när det gällde kreditforttter som läncköp och kontokredit. På dessa områden bedömdes en dispens alltsä kutttta vara motiverad (prop. 1973:155 s. 98). '

Datainspektionen har i föreskrifter och anvisningar för tillämpningen av kreditupplysningslagett. som ltar fastställts den 15 jttli 19.74. attgctt vissa undantag från förbudet ettligt 7 9" första stycket. I huvudsak innebär dessa att uppgifter om andra betalningsförsummelser ätt sädana sotn ltar dokumente- rats pä sätt som anges i bestänttnelsett fär lagras och lätnttas ut i följande fall. nämligen (1) om betalning ltar uteblivit eller försenats vid minst tre tillfällett under de senaste tolv månaderna. eller (2) om sutnmatt av till betalning förfallna fordringar eller en enstaka fordran uppgär till lägst 1 tltlt) kr.. eller (3) om det annars är uppenbart att kredit inte katt betros den som uppgiften avser. I fråga om lagring av uppgifter av det tttt berörda slaget anges vidare i anvisningarna att. ttär uppgifter om betalttingsft'jrsummelse gallras ut enligt den nuvarande femärsregeln i Så kreditupplysningslagett. uppgifter om "yngre" betalttingsförsuntmelser fär sta kvari register även om gallringen har lett till att antalet registrerade betalnittgsförsttntmelser är färre ätt tre eller deras santntanlagda belopp understiger 1 tltltl kr.

1 departementspromemorian redovisas bl. a. att kreditttpplysningsföreta— gett i praktiken inte ltar visat nämnvärt itttresse av att utnyttja de av

K redimpp/ysnings— lagen

Prop. 1980/81 : 10 67

datainspektionen tnedgivtta undantagen frän förbudet i 7 5 första stycket. 1 promemorian uppges sälunda att det pä persottttpplysningsomrädet knappast förekontnter nägon registrering av betalttingsförstttttntelser som inte ltar fastslagits genom beslut av dotttstol eller pä ett annat liknande sätt som avses i bestämmelsen. Med ltättsyn bl. a. till den praxis som alltsä räder fittns det enligt prometnorian inte ttägott anledning att frängä eller mjuka upp det ifrägt-tvt'trande förbudet. l promemorian föresläs därför att bestämmelsen i 7 :$ första stycket behälls ofört't'ndrad. Med anledning av vissa anntärknittgar frän datainspektionens sida fratttltälls vidare i protttentorian att det inte fitttts tillräcklig anledning att utvidga förbudet i bestämmelsen till att gälla uppgift om växelprotest.

Enligt promemorian bör det. liksont f. n.. fittnas en möjlighet att föreskriva undantag frän förbudet i 7 & första stycket. Ett sädant ttttdatttag bör. nted stöd av bestå'tntmelscrna i 8 kap. 73% första stycket 3 samt 11 så regeringsformen. fä medges av regeringen eller. efter regeringens bestäm- mande. av dataittspektiottett. Enligt promemorian bör emellertid möjlighe- tett att medge undantag användas ntera restriktivt än som ltar skett genom datainspektionetts nuvarande anvisningar på denna punkt. [ promemorian föresläs att detta får kotnnta till ttttryck i lagtexten genom att det i 7 & andra stycket föreskrivs att ttttdatttag fär medges. om det behövs för att undvika att personupplysning blir uppenbart missvisande.

Vid remissbeltandlingen ltar protttentorieförslaget rörande 7s ttttder förutsättning att personupplysningshegreppet behälls oförändrat lätttttats utan erinran av praktiskt taget samtliga remissinstanser. Datainspektionen vidltäller emellertid sitt tidigare ständpunkt att uppgifter om växelprotest itttc bör få fiftrekomma i personupplysningssatttntanhattg. Justitiekanslern anslu- ter sig till dentta uppfattning.

Föregett del får jag först erinra om att ntitta förslag i avsnittet 4.2.3 innebär att bcstämntelserna i 7 $. liksont hittills. skall gälla enbart uppgifter rörande enskilda personer som inte är näringsidkare e. (l. Samtidigt vill jag emellertid framhälla att förslaget i avsnitt 4.2.6 om att även enskilda närittgsidkare m. fl. skall lta rätt till kreditupplysnittgskopia bör kuntta medföra en avsevärd förbättring av deras situation i det hänseende som här är aktuellt. Genom kreditupplysningskopian kan de nämligen pä ett ltelt annat sätt än f. n. fä sitt uppmärksamhet riktad pä eventuellt oriktiga eller missvisande uppgifter om betalningsförsttmntelser. ttted följd att de snabbt kan påkalla rättelse enligt 12 s.

1 enlighet med vad som ltar föreslagits i departemetttsprontentoriatt bör bestämmelserna i 7 5 första stycket behällas ofört'indrade. Jag attslttter ntig också till uppfattningen i promemorian att det inte fitttts tillräcklig anledning att förbjuda uppgift om växelprotest i personupplysning. Ett sädan uppgift torde betraktas som väsentlig i kreditupplysningssammanhang.

Som framhölls redan vid lagetts tillkomst skulle ett getterellt förbud mot registrering och tttläntttattde av information om betalningsförsummelse. som

K redintpplysnings- lagen

Prop. 1980/81: 10 ' (18

inte har fastslagits av myndighet. på vissa områden kuttna innebära avse lärda olägenheter för kreditgivarna och därmed för en fungerande kreditmarknad. Jag vill här erinra om den debatt som under senare tid har förts om förhållandena på kotttokortsotnradet. [ det sammanhanget ltar även rests krav på en mer ingående kreditprövning och kreditbevakning frän kreditgivarttas sida. Bl. a. nted hänsyn härtill bör. som ltar föreslagits i departetttctttspromemorian och som jag redan tidigare har berört (se avsnittet 4.2.1). en möjlighet till ttttdantag från förbudet i 7 & första stycket behällas. Härigenom kan kreditgivare m.fl. få förutsättningar att på områdett där detta tttåste bedötttas som väsentligt utbyta information om bl. a. kreditmissbruk. Som framgått är det närmast på kontokortsområdet som särskilda motiv för dispens katt anses föreligga. Jag vill i santmanhanget erinra om den kontokortsutredning som jag tidigare har ttätnttt och som bl. a. har att pröva kontokortsföretagetts behov av information om kreditmissbruk m. m.

Undantag bör i enlighet tttcd prontentorieförslagct kttttna medges av regeringen eller. efter regeringens bestämmande. av datainspektionett. Enligt min menittg bör uttdantagsmöjligheten liksom hittills hanteras med återhållsamhet och i enlighet nted de riktlinjer som angavs vid lagens tillkomst (prop. 19731155 s. 98 och 146). Detta bör i lagtexten markeras genom ett krav på att det skall finttas särskilda skäl för uttdantag.

4.2.10 Äldre uppgifter i per.s'mtttppl_t'._vningar

En kreditupplysttittg katt i många fall bli missvisande. om den inneltåller uppgifter om t. ex. betalttingsförsummelser som ligger långt tillbaka i tiden. [ sådana fall är det ett intresse både för den som erhåller upplysningen och för den sotn avses nted denna att uppgifterna inte kontmer till användning. Det kan emellertid också inträffa att äldre omständigheter ltar en viss betydelse för kreditbedömningett och att det därför är önskvärt för kreditgivaren att fä kännedom om dem.

Kreditupplysningslagen inttehåller regler som. såvitt gäller enskilda personer som tillhör personupplysningskategorin. beaktar den enskildes intresse av integritetsskydd och skydd mot missvisande upplysningar. Enligt 85 gäller sålunda att en personupplysnittg inte får innehålla uppgift om omständigheter eller fi'trhällanden som är av betydelse för bedömningen av någons vederhäftighet i ekonomiskt hänseende. om fetn är ltar förflutit från utgången av det år då omständigheterna inträffade eller förhållandena upphörde. Uppgifter som inte får lämnas ut skall efter den angivna tiden gallras ut ur register som används i krcditttpplysttittgsverksamhet. Gallringen skall göras så snart det katt ske och i vart fall innan upplysnittg lätttnas om den som ttppgiften avser.

När det gäller företagsupplysnittgar har det däremot ansetts angeläget att

K redt'mppl yxni/tgs- lagen

Prop. BSO/81:10 69

dessa kan bli så uttömmande som möjligt. Lagen in neltåller därför inte någon motsvarande begränsnittg i fråga om rätten att lämna ut äldre uppgifter i sådana kreditttpplysttingar. Vid lagens tillkomst framhölls dock att försik- tighet bör iakttas även ttär det gäller t'tnvättdningen av äldre information i företagsupplysningar (prop. l()73:155 s. 147).

I sin promentoria rt'trande kreditupplysningslagen fratnhöll datainspektio- nen att den femärsgräns sotn gällde för perst'mupplysttingarnas del var onödigt generös med hänsyn till kreditbedömningsbehovcn och att den därför borde sänkas. Enligt inspektionetts mening fantts det inte heller anlednittg att i företagsttpplysttingar tillåta uppgifter om (.tntstättdigheter och förhållanden som låg alltft'ftr långt tillbaka i tiden.

Enligt departementsprtitmemorian torde fentärstiden enligt 8 & i allmänhet vara onödigt läng. Även uppgifter om förltållz-tnden som har upphört eller omständigheter som har inträffat avse -'ärt senare än för fem år sedan måste enligt prometnoriatt ofta sakna näntnvärt intresse för bedömningen av en persons aktuella kreditvärdighet e. d. Med hänsyn ltärtill framstår det ettligt promentorian som betänkligt att. som dataittspektionett ltar upplyst. inte så fä kreditgivare synes schablonmässigt bedöma t. ett. äldre betalningsanmärk- ningar såsom lika ofördelaktiga för en kreditsökande som attmärkttingar av senare datum. Detta kan enligt promemorian medföra olika ttegativa verkningar. lprontetnorian föresläs därför att den nuvarande fetrtärsgränsen i princip ersätts med en treärsgrätts.

Enligt förslagen i promemorian skall bestämmelserna i Så gälla beträf- fattde alla enskilda personer. dvs. även näringsidkare nt. fl. Främst med hättsytt härtill föreslås i promemorian att treärsgränscn inte skall gälla uttdantagslöst. Enligt prometnorieförslaget skall sälunda alltjämt gälla en femärsgräns för uppgifter om att någon har inställt sitta betalningar. har varit försatt i konkurs eller ltar tttedgetts ackord och om att någon ltar haft inflytande över ett visst företag. | promemorian framhälls att dessa ttndatttag för bl. a. en del uppgifter av gravare karaktär i alltnänhet kontmer att aktualiseras endast beträffande den sotn är eller ltar varit näringsidkare.

Vid remissbehandlingen av departementspromentorian ltar förslaget om en sänkning av den gällande femärstiden till i princip tre är godtagits av praktiskt taget samtliga remissinstanser. förutsatt att persottttpplysningsbe- greppet behålls oförändrat. Sveriges grossistfi'ärbund och kreditmannaföre- ningarna motsätter sig dock förslaget även under den angivna förutsättning- en. Flera företrädare för banker. andra kreditgivare och kreditupplysnings- brattsclten anser att femårsgränsen bör behållas för fler uppgifter än som har föreslagits i promemorian. Samma uppfattning framförs av Sveriges ackords- ccntral. Uppgifter som härvid nänttts av olika retttissinstanser är uppgifter om utmätning. utmi-itningsförsök. vräkning och förrättning för återtagande av gods som har sålts med förbehåll om återtaganderätt. Enligt riksskatteverket bör en femärsgräns gälla för uppgifter om att någon har varit underkastad s. k. näringsft'trbud enligt vad som ltar föreslagits i prop. 1979/8tlz83 om

K redirupplysnings- lagen

Prop. 1980/81:10 70

ändring i konkurslagen (1.9211255). -

Enligt vad jag ltar förordat i avsnittet 4.2.2 skall bestämmelserna i 8.5 liksom hittills gälla enbart uppgifter rörande enskilda personer som inte är näringsidkare e. |. För enskilda persotter som är näringsidkare eller annars faller utattför perst'tnupplysningskategorin kan emellertid ftf'trslaget om att även dessa skall erhälla kreditupplysttittgskopia i viss mån innebära ett förbättrat skydd mot olägenheter på grttttd av uppgifter sotn katt vara missvisande eller irrelevanta därför att de avser äldre förhällanden. Jag får i dentta del hänvisa till vad jag har anfört ont motsvarande fräga i avsnittet 4.2.9.

När det gäller personupplysningarna delar jag den av dz'ttaittspektionen och i departementspromemorian redovisade uppfattttittgett att den femårstid som f. n. gäller enligt 8 & i allmänhet framstår som onödigt lång. Som ltar framhållits i promemorian infördes denna tidsbegränstting bl. a. för att ge den som en gång rakat i ekonomiska svårigheter en rimlig möjlighet att senare rehabilitera sig i ekonomiska sammanhang. Tidsbegränsningen är således av stor betydelse ttär det gäller att skydda den enskildes integritet. Om uppgifter rörande alltför gamla betalningsanntärknittgar e. d. tas in i ett personupplysning katt det vidare medföra. utöver personligt obehag. att den enskilde får ogrundade svårigheter att erhålla en nödvändig kredit. Rätten att i personupplysningar lämna ut uppgifter om äldre omständigheter och förhållanden bör därför inte gå längre ätt vad som norntalt mäst ' attscs nödvändigt fran kreditbedötttttittgssyttputtkt e. d. Enligt tttin mening inne- fattar den i promemorian föreslagna skärpnittgett av tidsgränsen från fem till tre är en rimlig avvägning mellan de olika intressen sotn gör sig gällande i sammanhanget.

De i departententspromemorian fi'treslagna undantagen från treårsgränsen motiverades frätttst ttted att bestämmelsernt't i 8 & enligt promemorieförslaget skulle gälla även för enskilda näringsidkare och andra enskilda personer ttted ett väsentligt inflytande över ett visst företag. ()m bestätnmelsernas nuvarande tilli'tmpningsontråde i enlighet med vad jag tidigare ltar föreslagit behålls oförändrat. är dessa undantag enligt mitt mening inte påkallade. Jag kan inte heller biträda de av olika remissinstanser framförda förslagen om andra undantag. även om en del av dessa i och för sig skulle lta större aktualitet för personupplysnittgarnas del. På personupplysningsomradet mäste nämligen den föreslagnz-t treärstiden anses generellt tillräcklig från kreditbcdöntttittgssyttputtkt e. d. Det kan nämnas att bestänttttelsernas konstruktion katt medföra att uppgift om en viss ontstättdigltct eller ett visst förhållande fär lämnas ut uttder en tid av upp till fyra är efter det att omständigheten inträffade eller f("trhällandet UpPhÖI'dC. Vidare bör påpekas att tidsfristctt för en uppgift om att någon har varit försatt i konkurs räkttas från utgången av det år då konkursen avslutades. Ont riksdagen antar det förslag rörande möjlighet att meddela s. k. näringsförbud.som har lagts fram i prop. 1979/80283 om ättdrittg i konkurslagett. kontttter på motsvarande sätt

Kredituppfvsn1/th- lagen

Prop. 1980/Sl:l() 71

tidsfristen för en uppgift om att någon ltar varit underkastad ttät'ingsförbud att räknas från utgången av det år då förbudet upphörde. Santmanfattnittgsvis föreslår jag alltså beträffande 8 ;" endast den ändring-

en, att den i paragrafen angivna tiden av fettt är sänks till tre är.

4.2. Il Övriga ändringar i kreditttpplysnittgs/ugc'tt

Som tidigare har framgätt gäller kreditupplysningslagen även för kredit- upplysnittgsverksamltet som bedrivs genom offentliggf'trande av upplysning- ar i tryckt eller på annat sätt framställd skrift. När det gäller tryckta skrifter innehäller lagctt ctttellcrtid vissa särregler. Dessa är föranledda delvis av tryckfriltctsrättsliga och delvis av praktiska hänsyn.

Kreditupplysningsverksattthet som bedrivs genom offentliggörande av upplysningar i tryckt skrift är sålunda undantagen från tillständstvånget enligt 3 ;. Detta medför att datainspektionett inte katt nted stöd av4ellet' 17 ? meddela föreskrifter för sådan verksamhet. När en personupplysttittg lämnas genom offentliggörande i tryckt skrift gäller inte bestämmelsen i Os" om legitimitetskotttroll och inte heller bestämmelsen i ll s” om personupplys- nittgskopia. Vidare fintts i l2 ;" vissa särskilda bestämmelser om rättelse av oriktig eller missvisant'le kreditupplystting som ltar lämnats genom tryckt skrift.

Sedan kreditupplysningslagett kottt till ltar genom en ändring i tryckfri- hetsft'irordningen ttägra andra typer av skrifter jämställts ttted tryckt skrift i tryckfrihetst'ättsligt hänseende. Detta gäller enligt 1 kap. 5 & tryckfriltetsft'tr- ordningen uttder vissa förutst'tttnittgar skrift som ltar tttättgfaldigats genom stencilet'ing. fotokopierittg eller likttattde tekniskt förfarande. Dessa förut- sättningar är att tttgivnittgsbevis gäller för skriften eller att denna är försedd nted beteckning som visar att den är mängl'aldigad satttt i attsltttttittg därtill tydliga uppgifter om vetn som ltar tnängfaldigat skriften och ont ort och år för mångfaldigandet.

[ departementspromentorian f("ftreslås att vissa av kreditupplysttittgslagetts särregler för tryckta skrifter genom uttryckliga bestämmelser görs tillämpliga också för det fall att kreditupplysttingsverksanthet bedrivs genom offentlig— görande av upplysningar i skrifter sotn enligt 1 kap. 5 ä tryckfrihetsförord— ningen jämställs med tryckta skrifter. Enligt promemorian bör detta dock inte gälla bestämmelserna i 9 och 11 tt” om legititnitetskontroll resp. personupplysningskopia. Dessa skulle såluttda enligt promemorieförslagct även i fortsättningen tillämpas i fråga om personupplysning som lämnas genom (.tffentliggörande i skrift som inte är tryckt.

De tttt berörda förslagen ltar lämnats utatt kotttntentarer av det stora flertalet remissinstanser. Justitiekanslern samt hovrätten över Skåne och Blekinge ifrågasätter emellertid (titt det är befogat att i nägot hänseende behandla de skrifter som avsesi 1 kap. 5 sitryckfrihetsfi'trort'lnittgen på annat sätt ätt de tryckta. Datainspektionen, sotn i och för sig godtar promemorie-

K red i rupplysn i 1th- lagen

Prop. 1980/81:10 73

förslaget. franthåller att detta i praktiken innebär att sådana skrifter som Kreditttpplysnt'ngs- avsesi ] kap. 5 fåtryckfrihetsft'ftrordningen inte katt användas för spridande av lagen personupplysningar.

För egen del vill jag först framhålla att det naturligtvis är ganska enkelt atti små upplagor framställa stenciler eller fotokopior som innehåller person- upplysningar samt förse dem med sådana uppgifter som enligt 1 kap. 5 55 tryckfrihetsförordttingen medför att de jämställs med tryckta skrifter. Den skillnad som har gjorts i prontentorieförslaget mellan å ena sidan tryckta skrifter och å andra sidan övriga här aktuella skrifter får ses mot dettna bakgrund. Det har i promemorian befarats att de särskilda skyddsreglerna i 9 och 11 5.5 kreditupplysnittgslagen skulle kuntta i alltför stor omfattning sättas ur spel genom ett systematiskt utnyttjande av ett sådant tillvägagåttgssä'ttt.

Riskerna för en sådan utveckling torde emellertid inte vara så stora. I stället bör stor hänsyn tas till att skrifter av ifrågavarande slag har ansetts böra åtnjttta samma tryckfriltetsrättsliga skydd som de tryckta skrifterna. Det måste anses stå i mindre god ('.'tverensstämmclse nted detta syttsätt att de i kreditttpplysningssantmanhang uttderkastas helt andra regler ätt de tryckta. Detta gäller i särskilt hög grad om dessa regler. såsom torde bli fallet ettligt promemorieförslaget. i praktiken hindrar att ifrågavarande skrifter används för offentliggt'ftrande av en viss typ av kreditupplysningar.

Det sagda innebär att jag inte biträder prontemorieft'trslagct på den nu aktuella punkten. Jag föreslår i stället att sådana skrifter som avses i 1 kap. 5 & tryckfrihetsförordnittgen genomgående jämställs ttted tryckta skrifter vid tillätttpttittgen av kreditupplysnittgslagen. Bestämmelser av den innebörden bör tas upp i de olika paragrafer som berörs.

I syfte att underlätta datainspektionens tillsyn över kreditupplysningsverk— samhet som bedrivs genom utgivande av tryckt eller därmed jämställd skrift föresläsi departemetttsprotttentorian ett tillägg till l6 &. Detta tillägg innebär att den som bedriver verksamheten skall inom en vecka efter utgivandet av skriftett kostttadsfritt tillställa datainspektionen ett exemplar av denna. Den som åsidosätter leverattsplikten skall enligt prontemorieförslaget ktttttta ådömas straff. Dessa förslag har allmänt godtagits vid remissbehandlittgett. Hovrätten över Skåne och Blekinge anser dock att det bör övervägas att ersätta straffsanktionen med en möjlighet för dataittspektionen att fram- tvinga lcveratts genom vitesföreläggande. För egen del attsluter jag mig till promentorieförslaget. .

I övrigt bör. huvudsakligen i enlighet nted protnentorieförslaget. göras vissa ändringar i 4 & om tillstånd till kreditupplysningsverksamhet. i 6 % om förbud mot lagring m. nt. av särskilt ömtåliga personliga uppgifter. i 10 & om rätt till registerbesked ochi 13 å om överlåtelse av register nt. m. Med hänsyn till den nyligen antagna sekretesslagen (1980: 100) bör tystnadspliktsbestäm— melseni 14 & ändras och tystnadspliktsbestämntelsen i 18 & upphävas. Vidare bör det göras vissa ändringar och tillägg i straffbestättttnelsertta i 19 å.

Prop. 1980/81:10 73

reglerna om förverkattde av register i 20 å och reglerna om vitesft'äreläggant'le Inkassolagen i 22ä. Beträffande de tttt nämnda lagättdringarna får jag hänvisa till specialmotiveringen.

4.3 Inkassolagen 4.3.1 Til/äntpningsomrtidel

Inkassolagen gäller enligt l 5 för yrkestttässigt bedriven inkassoverksam- hct. Med inkasst'tverksattthet förstäsi lagett verksamhet ttted syfte att driva in betalning för fordran. Lagen ontfattat' dock inte de exekutiva myndigheter- nas verksamhet. vilken är underkastad särskild reglering genom utsökttings- lagstiftningen.

Med inkassoverksamltet som bedrivs "yrkesmässigt" avses enligt förarbe- tctta i princip all indrivnittg som ittgär sont ett led i en viss ttät'ingsverksamhct. oavsett om indrivningett avser egna eller andras fordringar. Detta innebär att lagett omfattar inte bara de egentliga ittkassoföretagett utatt ocksä en stor del av landets övriga företag och näringsidkare. eftersont dessa vattligett i större eller tttittdre utsträckttittg driver in i vart fall egna fordringar. Under lagen faller också sådan inkassoverksantltet för attttatts räkttittg som bedrivs av branschlt'treningar och liknande företag-arorgattisatiotter satttt av banker och advokater. För att lagett skall bli tillämplig krävs dock att inkassoverksam- hetett inte är av alltför obetydlig t'ttttfattning (se prop. l974:42 s. 103 f). l datainspektiottetts praxis har lagett vidare ansetts omfatta bl. a. kommuners indrivning av fordringar i den kommunala verksamheten och arbetstagaror- ganisationers indrivning av fordringar för medlemmarnas räkning.

I sin promemoria rörande inkassolagen hävdade datainspektionen att bestämmelserna om lagetts tilläntpttingsontråde borde ändras. Den innebörd som uttrycket "yrkesmässigt bedriven inkassoverksamhet" hade getts i förarbetena överensstämde enligt inspektionen inte ttted vanligt språkbruk. där uttrycket vattligett antogs syfta på den egentliga inkassobrattscltett. Lagtexten gav därför dåligt besked om lagens ontfattttittg. vilket hade vållat onödiga problem i inspektiottens tillsynsverksantltet. Enligt inspektionen fanns det vidare sakliga skäl att utvidga lagens tillämpningsområde till att omfatta all inkassoverksantltet. lttspektiottett framhöll att de nuvarande begränsningarna av tilläntpttingsomrädet sakttar praktisk betydelse och att lagens faktiska räckvidd dessutont är större ätt det formella tillämpningsom- rådet. För att en borgenär skall lta rätt till ersättning för kravkostttad enligt inkassokostnadskungörelsett mäste ltatt näntligett iaktta bestättttttelserna om krav i 5 & inkassolagen. Vidare brttkar blanketter för kravbrev m. m.. som tillhandahålls åt näringsidkare och alltttänhetett. utfortttas sa att de uppfyller lagens attspråk. Ont lagett fick omfatta all inkassoverksamltet. skulle detta enligt inspektionen också spara all den möda som inspektionen f. tt. ntäste lägga ned på frågan om lagetts tillämplighet i olika fall.

Prop. "MO/81:10 74

[ departententspromentorian framhålls att datainspektionen ltar anfört goda skäl för att utvidga inkassolagens tillämpningsområde. Enligt prome- tttoriatt katt det te sig svårförsti'teligt för en gäldenär att ltatt ltar ett sämre skydd mot otillbörliga inkassoätgärder enbart därför att den som vidtar åtgärderna inte handlar i _vt'kestttässig ittkassoverksatttltet. Härvid pekas särskilt på det faktum att en näringsidkare som driver in egna fordringar som hör till rörelsen ibland omfattas av lagen och iblattd inte. beroende på omfattningen av ittdrivningsvcrksamltetett. Det är enligt prometttorian också mindre tillfredsställande att tillämpligheten av en regel som (len i 9 ä— enligt vilken gäldenären nted befriattdc verkan katt betala till den som har borgenärens uppdrag att driva in en fordran beror på (.tmständighcter som gäldettärett inte ltar möjlighet att iaktta. Även i detta hänseende är ju avgörande bl. a. i vilken omfattning en person eller ett företag driver in fordringar för annans räkning.

Enligt prontetnoriatt bör det dock inte konttna i fråga att utsträcka tillätttpningsomradet fullt så låttgt sotn datainspektiottett har förordat. Enskilda fy iska personers verksantltet för indrivning av egna fordringar av privat natur hör även i fortsättningen hållas utanför inkassolagen och därmed utanför bl.a. den offentliga tillsyttett från dataittspektiottens sida. Med enskild person bör enligt promemorian jämställas dödsbo. Vidare bör liksom f. n. exekutiv myndighets verksamhet enligt promemorian ttttdatttas från tillämpningen av lagctt.

All inkassoverksamhet i övrigt skall enligt vad som föreslås i pl't'HTlcmOrltm omfattas av lagen. Detta gäller för det första all verksamhet för ittdrivttittg av fordran för annans räkning. oavsett inkassoverksanthetens omfattning och oberoende av om den bedrivs i förvär ' yfte eller inte. Detsamma gäller indrivning av fordran som ltar övertagits för detta ättdatttäl och som enligt vad som påpekas i promemorian rättsligt sett utgör indrivning av egen fordran. Beträffande indrivning av egtta fordringar i övrigt föreslas i prontetttorian att lagett först och främst skall tillämpas om fordringarna ltar uppkommit i näringsverksantltct. När en näringsidkare driver in en fordran som hör till rörelsen skall näringsidkaren sålunda alltid. vare sig det är fråga om en fysisk eller en juridisk person. vara skyldig att iaktta ittkassolagetts bcstämntelser. Därutöver skall lagen enligt protnetttorieförslaget gälla alla juridiska personers— tttottt dödsbotts ittdrivttittg av egen fordran. även om den ha inte har uppkommit i näringsverksatttltet eller ltar övertagits för indrivttittg.

Vid retttissbeltandlingen har de nu berörda förslagen om ändring av lagetts tillämpnittgsomrade tillstyrkts eller lätttttats utatt erinran av praktiskt taget samtliga remissinstanser.

Även enligt tttitt mening framstår det som befogat att utvidga inkassola- gens tillämpningsonträde på det sätt som ltar föreslagits i departententspro- mentoriatt. I princip bör naturligtvis all indrivning av fordringar ske på ett sätt som inte är otillbörligt mot gält'lenären. Inte heller i övrigt katt lagetts regler i allmänhet anses oskäligt betttttgattde för den som ägttar sig at att driva in

In kassolagmt

Prop. 1980/81: 10 75

fordringar. inte ens om detta sker bara tillfälligtvis. Ett reservation bör dock göras för reglerna om tillståttd att bedriva inkassoverksatttltet. Sådant tillstånd torde inte alltid vara ni'tt'lvändigt. Detta återkotnttter jag till i nästa avsnitt.

Som ltar anförts i departetttentspromentorian skttlle det emellertid även nted dentta reservation föra för längt att låta lagett gälla för enskilda fysiska personers egen indrivning av egtta fordringar som ltör till privatlivet och som inte ltar övertagits för indrivning. Med ettskilda personer bör i detta sammanhang jämställas dödsbott, Ett ttttdatttag frän lagens tilläntpningsom- råde bör alltså göras för dessa fall.

Den förordade utvidgningen av lagett till att omfatta alla fall då någon driver in en fordran för attttatts räkning katt vidare medföra vissa olägenheter i fall då en privatperson tillfälligtvis inkasserar en fordran på uppdrag av annatt. Enligt tttin mening fittns det emellertid inte nagot att erinra mot att bestämmelserna om iakttagande av god inkassosed och om skadestättdsskyl- digltet för (')tillbörliga förfaranden mot gäldenären blir tillätttpliga i dessa situationer. Något generellt undatttag frått lagett bör därför inte ställas ttpp ttted avseettde på dessa fall. Det fintts däremot anledning se till att inte en del andra regler får ett alltför vidsträckt tillätnpttingsområde. Denna fråga ltar i olika sammanhang behandlats i departementsprotttemorian. och jag avser att beröra den närmare i anslutning till de regler där den aktttaliseras.

En särskild fråga är vad som skall attses utgöra "inkassoverksamhet” i ittkassolagetts mening. Som tidigare ltar framgått definieras begreppet ittkassoverksanthet i l s som verksamltct ttted syfte att driva in betalttittg för fordran. Enligt förarbetena innebär detttta definition ett krav på att verksamheten ltar ett inslag av ltot eller tvång. En typisk inkassoätgärd attges i förarbetena vara att sända ut ett kravbrev ttted ltot om att rättslig åtgärd kommer att' vidtas om gäldenären inte betalar frivilligt. Åtgärder som innebär en ren påminnelse om betalnittgsskyldigltet. t. ex. att sända ut en betalningsavi. faller däremot enligt l't'."trarbetena utanför begreppet inkasso- verksamhet (jfr prop. 1974:42 s. 103 ).

Datainspektionen up.gav 'i sitt promemoria rörande ittkassolagctt att inspektionen hade fått lägga tted mycket arbete på att dra en klar gräns mellan sådana krav som omfattas av ittkassolagen och sådana betalningspä- minttelser som inte gör det. 1 sitt praxis hade inspektionen ansett att ett betalningspåtttittttelse. för att falla utanft'ftr lagett. inte fick innehålla någon tidsfrist för betalning. inte etts i forttt av uttryck som "otttgi'tende" eller "snarast" c. d. 1 fall då en tidsfrist sätts ut. innefattade det nämligen enligt inspektionen ett förtäckt ltot om vidare åtgärder efter fristetts utgång. Inspektionen hade däremot ansett sig böra godta att gäldenären i en sista betalningspäminttelse upplyses om att ärendet katt kontttta att lämnas över för inkasso. lnont ittspektiotten rådde emellertid delade tnettingar om det lämpliga i dessa gränsdragningar. lttspektiottett ansåg därför att begreppet inkassovcrksatnltet borde ges en tydligare definition. t. ex. genom att det i

Inkassolagen

Prop. 1980/81 :10 76

lagtexten anges att verksamheten skall lta ett inslag av ltot eller tvåttg.

Enligt departemetttsprtjttnemorian bör datainspektionens önskemål om en klarare avgränsning av begreppet inkassoverksamltet tillgodoses i möjligaste tttån. l promemorian framhälls att det etttellertid är mindre lämpligt att grunda detttta avgränsning på termer sont"hot" eller ”tvång". eftersom dessa inte är entydiga och dessutom kan ge en felaktig bild av hur en korrekt ittkassoverksantltet bör bedrivas. lttslaget av "hot" består nämligen i allmänhet inte av annat ätt att gäldenären upplyses om att borgenären kan komttta att vidta rättsliga eller annars ltclt oantastliga åtgärder för att få betalning för sitt fordran. Enligt promentorian är det mer ändamålsenligt att utgå från det ft'ftrhållandet att en borgenär. liksom f. n.. bör ha möjlighet att ge en gäldettär ltelt neutrala betalningspåminttelser utan att det blir fråga om inkassoverksamltet i lagens mening. För att en betalttingspåminnelse skall falla utanför lagen bör den enligt promemorian inte få innehålla ttägot inslag av hot eller påtryckning mot gäldenären utöver själva på'tminnelsen om betalnittgsskyldigltet. I enlighet med vad dataittspektiotten ltar fastslagit i sitt praxis bör detta enligt prt.)mem(')rian innebära bl. a. att påminnelsen inte får innehålla någon tidsfrist för betalning. För att en klar och hanterlig gränsdragning skall kuntta upprätthållas bör härvid enligt pmmemorian gälla att påminnelsen. likaledes i enlighet nted inspektionens praxis. inte heller får innehålla att betalning skall ske "omgående" eller "snarast" c. d.

Mot den nu angivna bakgrunden föreslås i departementsprotnetttorian att begreppet inkassoverksamhet i l & definieras sa. att därmed t't'.'trstås verksamhet för indrivning av fordran genom krav eller andra åtgärder sotn ej endast innebär att gäldenären underrättas eller erinras om ft'n'dringen. Förslaget får bl. a. den effekten att det blir fråga om ett krav i den tttcttittg som avses i 5 s* inkassolagen. ont det anges att betalning av en förfallen fordran skall ske ittont en tner eller ntindre bestämd tid.

Vid remissbehattdlingett har detta förslag lämnats utan erinran av det stora flertalet remissinstanser. Datainspektionen framhåller emellertid att det kan vara lämpligt att en betalningspz'mtinnelse får innehålla en tidsfrist för betalningen utan att påminnelsen för den skull faller uttder lagen. Även Svenska sparbånksfiftrettingen anser att en betalningspäminnelse bör få innehålla i varje fall ett bestämt angiven frist för betalning tttan att den behöver omfattas av lagctt. Finansieringsft'ftretagens förening anför att en betalningspåminnelse därjämte bör få innehålla en upplysning om att ärendet kommer att överlämnas för-inkasso om betalning inte sker. En liknande ståndpunkt intas av Motorbranschens riksförbund.

För tttin del vill jag till en början framhålla att det. när en gäldenär underlåter att betala sitt skuld i rätt tid. är ett normalt tillvägagångssätt att gäldenären först påminns om sitt betalningsskyldigltet på ett enkelt sätt. På detta stadium förekommer i allmänhet inte några egetttliga pz'ttrycknittgar mot gäldenären. Betalningspåmittnelser torde i regel sändas ut av borgenä- ren själv.

Inkassolagen

Prop. HSO/81:10 77

Borgenären kan givetvis också själv agera uttder ett fortsatt indrivnings- förfarande. l regel torde gäldenären då först tillställas ett krav som förettas med påtryckningar mot honom föratt förmå honom att betala. varefter ltatt utsätts för rättsliga åtgärder c. d. (_)fta uppdrar borgenären emellertid åt ttågon annan. t. ex. ett inkassoföretag. att som ombud för honom vidta de åtgärder som fordras utöver enkla betalnittgspåminttelser. Fordringen katt också överlåtas på annan för indrivning.

Enligt min mening tttåste en borgenär eller dennes ombud. liksom f. n.. lta ett visst utrymme för att rikta enkla betalningspåminnelser mot ett gåldettär utan att detta anses utgöra inkassoverksamhet i lagetts mening. Detta syttes vara av stor praktisk betydelse. eftersotn exempelvis en näringsidkare katt vilja ombesörja betalningspåtninnelser själv samtidigt sotn ltatt ltar ett befogat intresse av att inte bli underkastad inkassolagens regelsystem nted vad detta innebär bl. a. i fråga om offentlig tillsyn över verksamheten. Det är alltså viktigt att på lämpligt sätt avgränsa ett påminnelsestadium. som bör falla utanför lagen. Det katt sägas att den nuvarande definitionen av begreppet inkassoverksamhet är alltför vag för att kuttna fylla dettna uppgift.

[ likhet med en del retttissinstattser anser jag att promemorieförslaget medför en från olika synpunkter alltför snäv begränsning av vad en betalningspåminttelse får innehålla för att den skall falla utanför lagett. De flesta borgenärer torde fitttta det naturligt att. ttär de påminner en gäldenär om hans skuld. samtidigt ange en tidsfrist för betalningen åtminstone på det sättet att betalning skall ske "omgående" eller "snarast" c. d. Som bl. a. datainspektionen ltar varit intte på fitttts det inte ttågon anledning att låta lagen omfatta betalttingspåtnittnelser som innehåller endast att betalning skall ske inom en sådan mer eller mindre bestätttd tidsfrist utatt att det anges vad som kan hända om betalningen inte erläggs i tid. Enligt min mening bör lagen bli tillämplig först då borgenären eller hans ombud hotar med en viss påföljd c. d. för underlåtenhet att betala. Det är nämligen ttär ett sådant hot kommer in i bilden som det behöver ses till att hotet inte får en sådan form eller ett sådant innehåll att det frantstår sotn otillbörligt mot gäldenären.

Som nyss nämndes ombesörjer en borgenär ofta själv betalttingspåmin- nelserna. tnedan han överlämnar åt någott annan att vidta tnera långtgående åtgärder mot gäldenären. Det synes i sådana fall vara av värde för detttte att få veta att borgenären avser att koppla in exetnpelvis ett inkassoföretag. eftersont detta regelmässigt medför extra kostnader för gäldenären. Enligt min mening bör det därför godtas att det i en betalningspz'tminnelse lämnas upplysning om att ärendet kotntner att överlämnas för inkasso. om betalning inte sker på grund av påminnelsen. Detta överensstätnmer också med den praxis som hittills har tillämpats av datainspektionen. '

Hänvisningar till PS2

Sammanfattningsvis förordar jag att lagett tillämpas endast på inkassoåt- gärder sotn innebär annan påtryckning mot gäldenären än angivande av tid för betalning eller uppgift om att fordrittgen kommer att överli'tmttas till annan för inkasso. '

Inkassolagen

Prop. HSO/81:10 78

4.3.2 Tillstånd för viss t'ttkassaverkstan/tet

Enligt 2 & inkassolagen fär yrkesmässig inkassoverksamhet i vissa fall bedrivas endast efter tillstånd av datainspektionen. Detta gäller yrkesmässig inkassoverksamhet sotn avser indrivning av fordringar för anttatts räkning eller fordringar som ltar övertagits för indrivning. Tillstånd behövs dock inte för inkassoverksamhet som bedrivs av Sveriges riksbank. Sveriges investe- ringsbattk AB. kreditinrättning under battkinspcktionens tillsyn eller advo- kat. Eftersom lagen f. n. är tillätttplig endast på yrkesmässig inkassovegk- santltet. ontfattar tillstt'm'dsplikten inte inkassoverksattthet som är av alltför obetydlig omfatttting.

Datainspektionen uppgav i sitt prometttoria rörande inkassolagen att inspektionen hade tillämpat bestämmelserna i 25 så. att all indrivning av fordringar för annans räkning eller fordrittgar som övertagits för ittdrivning bedömdes som tillståndspliktig ittkassoverksatnltet. Detta gällde dock inte om verksatttltetett var av helt obetydlig omfattning tnittdre ätt 13 ärenden per år och inte hade marknadsförts. Enligt inspektionen kunde det från olika synpunkter ifrågasättas. om det var lämpligt med en så vidsträckt tillständsplikt. I sammanhanget nämnde inspektionen att tillståndsplikten hade ansetts omfatta bl. a. kommuttkansliers indrivning av fordringar åt kommunala bolag och stiftelser satnt fackliga organisationers indrivning av medlemmars utestående löneftitrdringar. [ sådana fall kuttde enligt inspek- tiottens tttenittg tillämpningen av bestämmelserna om tillståttd framstå som byråkratisk.

På grund av datainspektionens atttnärkttingar diskuteras i departements— promemorian i vad mått tillståttdsplikten enligt ittkassolagen lätttpligett katt begränsas. llärvid slås till en början fast att kravet på tillståttd även i fortsättningen bör gälla för ittkassoverksamltet som avser ittt'lrivning av fordringar för annans räkning eller fordringar sotn ltar övertagits för indrivning och som bedrivs i f("trvärvssyfte. Detta gäller främst de egentliga inkassoföretagen. som erbjuder sitta tjänster åt allmättheten. Tillsti'tndsplik- ten för inkassoverksamhet i ft'trvänfssyfte bör etttellertid enligt promemorian inte inskränkas till att gälla bara om ittkassotjänster erbjuds åt alltttänltetett. Tillstånd bör krävas även om verksamheten betjänar endast ett på visst sätt begränsad krets av fordringsägare. I båda fallen föreligger enligt promemo- rian i princip samma bebov av skydd mot icke seriös kommersiell inkassoverksamhet. Ett inskränkning av antytt slag skulle dessutom kutttta inbjuda till försök att kringgå tillståndsplikten och även i övrigt medföra onödiga tillämpttingssvårigheter.

När det gäller inkassoverksantbet sotn bedrivs tttan förvärvssyfte bör tttan däremot enligt promemorian kttntta göra vissa undantag från bestämmelser— tta om tillståttdsplikt. såsom dessa f. n. tillämpas. Förutsättnittgartta för detta bör enligt promemorian vara att inkasscn'erksatnheten ingår sotn ctt underordnat led i en annan verksamhet. som också den bedrivs utan

In kassa/age”

Prop. l980/81:10 79

ft.")t'värvssyfte. llärigenotn klargt'ftrs att bl. a. arbetstagarorganisatiotters inkasstwerksamhet för medlemmarnas räkning skall vara undantagen från kravet på tillståttd. Det föreslagna undantaget kommer också att gälla beträffande andra intresseorganisatiotter. t. ex. branseltorgattisatiotter. sotn uttder liknande förhi'tllandett som gäller för de fackliga organisationerna bedriver ittkassox-ferksamhet för medlemmarnas räkning. Vidare klargörs genom den f("äreslagna ttndatttagsregeln att tillståndspliktett inte lteller skall gälla för en konunutt sotn genom sitt komntunkansli (.tmbest'irjer inkasso- verksamhet för t. ex. konttnuttala bolags och stiftelsers räkning.

Enligt departetttentspromemorian bör tillstandspliktcn ktttttta begränsas för ytterligare ett fall. nämligen då inkassoverksatttlteten ittottt koncerner av rationaliserittgsskäl eller andra orsaker sammanförs till ett av koncernens företag. I promemorian framhålls att det oavsett de bakomliggande motiven är uppenbart att ett sådan t'trgattisation av ittkassoverksantlteten inom en koncertt katt jätttställas ttted det fallet att de företag sotn ingår i koncernen själva ombesörjer sin ittkassoverksatnltet.

De nu berörda undantagen från kravet på tillståttd. dvs. för inkassoverk- samhet tttan f(ftrvärvssyfte och för s. k. kottcerttittkasso. skall enligt prome- moriefi'trslaget gälla även om inkassoverksamltetett i något fall ordnas så att. fordringar övertas för indrivning. Å andra sidan föreslås en tilläggsregel som är avsedd att hindra att en annars gällande tillstt'tndsplikt krittggås med utnyttjande av dessa uttdatttag. Enligt denna regel skall undantagen inte gälla. om inkassm'erksamheten avser ft'trdringar som tillkotnnter eller har övertagits från någon som inte själv hade kunnat driva in fordringarna tttatt tillstånd enligt lagett.

Från kravet på tillståttd bör man vidare enligt pt't_ttttetttot'iatt ta undan inkassoverksamltet som är av helt obetydlig omfattning. l prometnoriefiftr— slaget ltar detta uttryckts så. att tillstånd inte behövs för inkassoverksamhet som är av tillfällig natur och avser endast enstaka fordringar.

Slutligen föreslås i promemorian att ntatt behåller det nuvarande undantaget från tillståndsplikten för inkassoverksatttltet sotn bedrivs av Sveriges riksbank. Sveriges investeringsbankAB. kreditinrättning under lutnkinspcktionens tillsyn eller advokat. Undantaget för verksamhet ttnder bankinspektioncns tillsyn bör emellertid enligt promemorian utvidgas till att omfatta inte bara kredititträttnittgar utan alla företag sotn står under bankinspektionetts tillsyn. Undantaget skttlle därmed i enlighet med vad som f("irordadcsiprop. 1978579: l7tl med förslagtill lag om finansbolag. m. m. (s. 38 f och 148 f) kotttttta att omfatta bl. a. alla sådatta finansbolag sotn enligt den ttutnera antagna lagett (198013) om finansbolag ställs ttttder bankinspektionens tillsyn fr. o. nt. den 1 jttli 1980.

Vid remissbehattdlittgen har f("trslagen i departementspt'omemorian röran- de tillståndspliktens omfattning tillstyrkts eller tttatt närtttare kommentarer godtagits av det stora flertalet rentissinstanser. Dataittspektiottett anser att prontentorieft'nslaget innebär en betydligt bättre avgränsning av tillstånds-

In kassa/(igen

Prop. 1980/81 :10 att

plikten än den som gäller f. n. Inspektionen ifrågt'tsätter dock delvis undantaget för s. k. koncerninkasso. Svenska komtnunförbundet ttoterar med tillfredsställelse att tillstånd enligt förslaget inte skall behövas för en kommun sont genom sitt kommunkansli ontbesörjer inkassoverksamhet för kommunala bolags och stiftelsers räkning. TCO ser det som en önskvärd förenkling att det fastslås att tillständsplikt inte skall gälla för den ittkassoverksatttltet som tttatt fört-'i'trvssyfte bedrivs av ideella organisationer. Också TCO riktar dock viss kritik mot det föreslagna undantaget för koncerninkasso.

För tttin del vill jag till en början framhålla att inkassolagens bestättttttelser om httr inkassoverksatttltct skall bedrivas även i fortsi'tttningen skall gälla inkassoverksatnltet sotn lagen är tillätttplig på. alltså oavsett om verksamhe- ten är tillståttdspliktig eller inte. Även den sotn bedriver icke tillståttdspliktig inkassoverksatttltet är sålunda skyldig att iaktta regeln om god ittkassosed och därtill anknytande bestämmelser. Vidare omfattas också den icke tillståndspliktiga verksamheten ttted vissa begränsade ttndatttag av datainspektioncns tillsyn. Det innebär bl. a. att den sotn bedriver verksam- heten katt meddelas föreskrifter rörande verksamheten. vilka vid behov kan förenas med kraftigt verkande viten. Skyldigheten att utge skadestånd för otillbörliga ittkassoåtgärder gäller även för icke tillstt'tndspliktig verksamhet. Skillnaden mellan tillståttdspliktig och icke tillstt'tndspliktig verksamltet är därmed. som också ltar framhållits i departetnetttsprometttorian. i huvudsak att den förra skall underkastas en förltattdsgranskning genom datainspektio- ttens försorg som katt leda till att tillstånd vägras och att inspektionen vid tillständspliktig verksamhet ltar tillgång till det särskilt effektiva tvångsmed— let att dra in tillståndet.

Med hänsyn till det nu anförda är det enligt ntin mening tydligt att kravet på tillstånd för inkasst')vcrksamhet bör begränsas till fall där det framstår som särskilt angeläget med en ännu starkare offentlig kontroll över vcrksatttheten än den sotn följer av de andra reglerna om ett f(ttrtlt'tpande tillsytt. Mot detttta bakgrund synes kravet på tillstånd f. n. gå längre än som är nödvändigt och lämpligt. Som datainspektionen ltar antytt kan ett sådant krav i vissa fall ttted fog uppfattas som ett inslag av onödig byråkrati. Förslagen i departements- promemorian syftar till att i nu"")jligaste tttån undanri'äja sådana inslag.

I likhet med det stora flertalet remissinstanser anser jag att promemorie- förslaget i dettna del innebär en rimlig avvägning mellan å etta sidan intresset av en tillräckligt effektiv samhällskmttroll över etableringen inom inkasso- bransehen och å andra sidan önskemålet att undvika vad som kan uppfattas sotn obefogat krångel. Att den nuvarande.tillstå'mdsplikten för kontmersiellt bcdrivett ittkassoverksamhet maste upprättht'illas är enligt mitt mening självklart. Detta gäller både när verksamheten avser indrivning på ttppdrag av annan och ttär den avser indrivning av fordringar som ltar övertagits för indrivning. I de fall då syftet är att göra en ekonomisk vinst på inkassoverk- samhet finns det nämligen. sotn har påpekats i departetttetttspromentorian.

I " kassolagen

Prop. HSO/81:10 81

en risk för etablering av icke seriösa företag. Tillståndsplikten behövs här inte minst för att ge fordringsägarna/uppdragsgivartta en viss garattti för att deras intresse av bl. a. sakkunnig indrivning och korrekt medelsförvaltning tillgodoses. Konkurrensen mellan olika inkassoföretag som bedrivs i kommersiellt syfte kan också uttder vissa omständigheter leda till att gäldenärerna utsätts för ett tryck sotn överskrider gränsen för vad sotn katt anses tillbörligt. I enlighet ttted vad som ltar ft'ftreslagits i departementspro- memorian bör emellertid ett undantag från tillståndsplikten göras för verksattthet som är av tillfällig natur och avser endast enstaka fordringar. Detta överensstämmer ttted vad som gäller f. n.

När det gäller inkassoverksamhet för annans räktting som bedrivs tttan förvärvssyfte attsluter jag mig till den i departetttentsprotttetnoriatt uttalade uppfattningen att det knappast katt attses rimligt att t. ex. arbetstagarorga- nisationers inkassoverksamhet för medlemmarnas räkning skall vara under- kastad tillståndsplikt. Det bör därför slås fast att tillståttdplikt inte skall gälla för sådan inkassoverksanthet som vanligen bedrivs av de fackliga organisa- tionerna. Som har framhållits i departementsprometnorian synes det emellertid mindre lämpligt att blattd olika itttresseorganisationer endast de fackliga skall vara undantagna från tillståttdsplikt. Kravet på tillstånd bör kunna efterges även när det gäller andra organisationer. t. ex. branschorga- nisationer. som utan förvärvssyfte bedriver inkassoverksatnltet för medlem- mars räkning. Någon förhandsgranskning av sådatt inkassoverksamhet katt numera. sedan inkassolagen har varit i kraft i åtskilliga år och blivit väl känd. inte längre anses påkallad. I enlighet nted vad som har förordats i departementspromentorian bör ett krav på tillståttd inte heller gälla ttär en kommun genom sitt kommunkattsli driver in fordringarfi'jr (. cx. kommunala [bolags och stiftelsers räkning.

Undz'tntagsregeln för fall av det slag sotn nu har berörts har i promemo— rieförslaget utformats på ett sätt som enligt ntin mening ger ett betryggande garanti för att undantaget inte ges en alltför vidsträckt tillätttpnittg. Det skall sålunda krävas inte bara att inkassoverksamheten bedrivs utatt förvärvssyfte utan också att den utgör ett underordnat led i en annan verksamhet som även den bedrivs utatt sädant syfte. Jag ansluter mig alltså till detta förslag.

Vad härefter angår förslaget om ett undatttag från tillståndspliktett för s. k. koncerninkasso är det enligt ntin mening klart att ltithörande fall av inkassoverksamhet för attttans räkning kan från tillståndssynputtkt jämställas med det fallet att de olika företag som ingår i ett koncern själva ombesörjer sin inkassoverksamhet. De remissinstanser sotn har anfört kritiska synpunk- ter på det föreslagna undantaget för koncerninkasso synes inte heller lta något att erinra i princip mot ett sådant undantag. Vad de vänder sig mot är att inkassoverksantheten kan ordnas så. att det för gäldenären kan framstå sotn om den sköttes av ett från övriga koncerttföretag fristående inkassofö- retag. För ntin del kan jag emellertid inte fintta att dettna tttöjlighct bör tillmätas någon avgörande betydelse förfrågan om tillstånd skall fordras för

6 Riksdagen 1980/8]. ] saml. Nr [()

Inkassolagen

Prop. HSO/81:10 HZ

verksamheten. Jag vill understryka att detttta är underkastad lagetts bestätntttclscr i övrigt. bl. a. reglerna om tillsyn.

Jag föreslår alltså att något krav på tillstånd inte skall gälla för inkassoverksamhet som bedrivs av ett företag för annat företag som tillltör samma koncern.

I enlighet ttted vad som ltar föreslagits i departetttetttsprometttot'ian bör i anslutning till de nu beltattdlade reglerna om ttttdatttag från tillståndsplikten föras in en bestämmelse som hindrar att uttdt'ttttagen tttttyttjas föratt kringgå en annars gällande tillståttdsplikt. Jag återkotttnter till detta i speeialntotive- rittgen.

Jag attsluter mig till förslaget att tttatt skall behålla de ttuvarandc undantagen från tillståttdsplikten för inkassoverksamltet sotn bedrivs av Sveriges riksbank. Sveriges ittvesterittgsbattk AB. kreditinrt'ittning ttttder bankinspektionens tillsyn eller advokat. Undantaget för kreditinrättningar under bankittspektionetts tillsyn motiverades vid lagetts tillkomst ttted att dettna tillsyn kunde anses utgöra en tillräcklig garanti tttot olägenheter av kreditinrättttingarnas inkassovcrksantltet (prop. 1974143 s. 89). Jag anser det vara befogat att på detta ontråde. i enlighet ttted det av remissinstanserna godtagna förslaget i departctttetttsprotttetttoriatt. jämställa alla företag under bankittspektiottens tillsyn. Detta ittttebär att bl.a. de finansbolag som omfattas av lagett (19802) om finansbolag undantas från kravet på tillstånd.

4.3.3 Krav och rättsliga åtgärder mot gäldenären

l 4 & inkassolagen fitttts den cetttrala bestättttttelsett att ittkassoverksatttltet skall bedrivas enligt god inkassosed. Därvid skall iakttas att gäldenären inte vållas ottödig skada eller olägenhet eller utsätts för otillbörlig påtryckning eller attttatt otillbörlig inkassoätgärd. Detttta grundläggande regel komplet— teras av vissa tttera konkreta föreskrifter i 5---7 ss. De innebär i huvudsak att rättslig åtgärd normalt inte får vidtas tttot gäldettärett innan dentte ltar tillställts ett specificerat krav och ltar fått tillfälle att betala frivilligt eller framställa invändningar mot borgettäretts anspråk. 1 övrigt ltar det överlåtn- nats åt praxis främst datainspektionetts verksatttltct att utbilda ytterligare normer för hur inkassoverksamltet skall bedrivas för att stå i överensstättt- tttelse tttcd god inkassosed.

l sitt prontetttoria rörande inkassolagen uppgav dataittspektiottett att dess erfarenheter av bestämmelsen i 4 så om skyldighet att iaktta god inkassosed är positiva. 1 de flesta fall där bestämtttelsen kttttde anses lta blivit åsidosatt hade rättelse skett efter påpekande från ittspektiottett. Endast vid upprepade överträdelser och ren obstruktion hade inspektionett utnyttjat möjligheten att nted stöd av liä meddela vitessanktionerade föreskrifter.

Ettligt departementsprt'mtentoriatt bör bestämmelsen i 4 s om iakttagande

Inkassolagen

Prop. HSO/81:10 83

av god inkassosed beltållas ofört'indrad. Beträffande ett särskilt fall. som har berörts av dataittspektiottett. görs i promemt'trian ett uttalande av innebörd att det måste attses strida tttot god ittkassosed om ett gäldenär tillställs ett kravbrev utatt att gäldenären dessft'jrinnan ltar uttderrättats om eller på attttat sätt har fått klart för sig att borgenären anser sig lta en fordran tttot honom.

Uttder rentissbeltandlittgcn har dessa ttttalattdett lämnats tttatt erinran. Också jag anslttter mig till dettt.

I 5 & inkassolagett nteddelas föreskrifter om krav. Enligt dessa skall krav mot en gäldenär framställas skriftligett. Härvid skall vad som fordras i kapital. ränta och ersättning för kostnader anges var för sig. I fråga om ränta skall särskild uppgift lämnas om beloppet av ttpplupett ränta. Vidare skall beträffande såväl upplupen som tillkommande rättta särskild uppgift lämnas om räntesatsen samt om den tid och det kztpitalltelt'tpp som ligger till grttttd för ränteberäkningen. l samband ttted krav skall anges viss skälig tid ittont Vilken gäldenären ltar att betala frivilligt eller anmäla ont ltatt ltar någott ittvt'indnittg tttot kravet. Datainspektionen ltar på dentta pttttkt utfärdat attvisttingar som ittttebär att tidsfristen skall vara minst 6—8 dagar.

1 sin prontentoria rörande ittkassolagen anförde inspektionen att det i praktiken hade vållat stora svårigheter att få fram en god efterlevnad av reglerna i 5 5 om utformningen av krav tttot ett gäldettär. framför allt utanför det tillståttdspliktiga området. Reglerna hade ettligt inspektiottett inte slagit igenom ordentligt. bl.a. på grund av att domstolarna inte i tillräcklig omfattning kontrollerade kravbrevetts utformning i de fall då borgettärett i process framställde attspråk på ersättttittg för kravkostnad. Enligt inspektio- nen förekom det att kravbrev inte på ett tillfredsställande sätt angav borgenz'irens identitet eller grunden för fordrittgen.

På grund av datainspektionens anmärkningar föreslås i departementspro- memorian uttryckliga föreskrifter om att ett krav skall innehålla tydlig uppgift om borgenäretts namn och adress och om det förhållande sotn fordrittgett gruttdar sig på. Enligt förslaget skall ett krav också innehålla anvisning om läntpligt betalttittgssätt.

Vid remissbehandlingen ltar de föreslagna kompletteringarna av 5 & lämnats utan erinran av de flesta retttissittstanscrtta. Från några håll anförs dock kritik beträffande olika punkter i förslaget.

För egen del vill jag till en början erittra om tttina förslag i avsnittet 4.3.1 om avgrättsttittgen av begreppen inkassoverksatttltet och inkassoåtgärd. Av förslagett följer att det blir fråga om ett krav i den mening som avses i 5 & inkassolagen först om en betalnittgsatttttaning förenas med andra påtryck- ningar mot gäldenärett än angivande av tid för betalning eller uppgift om att fordringen katt komma att överlämnas till attttatt för inkasso. Det är alltså endast i sådana fall sotn bestämmelserna i 5 s om inneltållet i krav aktualiseras.

När ett ft'trdringsärende ltar ttått så låttgt att ett krav i den angivna

In kassolagen

Prop. l980/81:10 84

meningen utfärdas. står borgenären eller dennes ombud regelmässigt i begrepp att vidta rättsliga eller andra mer ingripande åtgärder mot gäldenären. om denne inte betalar på grund av kravet. Med hänsyn härtill är det givetvis angeläget att ett krav innehåller korrekt och lättillgänglig information som är av betydelse för att gäldenären skall kunna betala frivilligt eller anmäla invändningar mot borgenärens anspråk. Enligt min mening är det ett minimikrav att uppgift lämnas inte bara om borgenärens namn utan även om grunden f_ör fordringen. l:".n skyldighet att lämna sådana uppgifter kan inte anses oskäligt betungande. Enligt vad som har framkom- mit under remissbehandlingen kan däremot en skyldighet att lämna uppgift även om borgenärens adress vålla onödigt stora olägenheter för inkassofö— retag som använder sig av ADB. En sådan uppgift kan inte heller anses absolut nödvändig. Jag anser därför att promemorieförslaget bör frångås på denna punkt.

Jag delar uppfattningen i departementspromemorian att det år av värde om gäldenären ilsamband med kravet även får anvisning om lämpligt betalningssi'itt. Som har påpekats i Stockholms tingsrätts remissyttramle torde detta. om det sker exempelvis genom att ett inbetalningskort fogas till kravet. i åtskilliga fall kunna avvärja en obefogad underlåtenhet att betala på grund av kravet. Det är emellertid viktigt att bestämmelserna om utform- ningen av krav inte leder till vad som kan uppfattas som formalism, Jag tänker här särskilt på ett förhållande som har påpekats av hovrätten över Skåne och Blekinge. nämligen att bestämmelserna i Så får betydelse för frågan om en borgenär kan erhålla ersättning för kravkostnad eller inte. Någon ovillkorlig skyldighet att lämna uppgift om lämpligt betalningssätt bör därför inte ställas upp. Bestämmelsen bör på denna punkt i stället utformas som en rekommendation. En underlåtenhet att lämna sådana uppgifter inverkar därigenom inte på möjligheten att få kostnadsersättning. En upprepad försummelse kan emellertid föranleda datainspektionen att ingripa.

En särskild fråga som uppkommer i detta sammanhang och som har aktualiserats i riksdagen vid några tillfällen gäller köparens ställning vid s. k. factoring. Factoring innebär i allmänhet att ett finansieringsföretag (factorn) lämnar rörelsekredit åt ett försäljningsföretag mot säkerhet i det företagets fakturafordringar. vilka överläts till eller pantsätts hos factorn. Försälj- ningsföretagets kund. dvs. köparen. får normalt ett formulär med tryckt uppgift om att fordringen har överlåtits etc. och att kunden därför skall betala” till factorn. len motion till riksdagen (mot. l974:653) framhölls att en köpare kunde förbise en sådan betalningsanvisning och i stället betala till försälj- ningsföretaget. Köparen riskerar då att behö 'a betala även till factorn. om köparen kan anses ha haft åtminstone skälig anledning misstänka att försäljningsföretaget inte längre var rätt betalningsmottagare: jfr lll och 29 lis" lagen (1936181) om skuldebrev. l motionen yrkades att gällande regler skulle ses överi syfte att såvitt möjligt förbättra köparens ställning. Motionen

I I: kassa/(Igen

Prop. 1980/81:10 85

avslogs emellertid av riksdagen. sedan lagutskottet hade anfört att risken för dubbelbetalning i praktiken inte var så stor att den ensam kunde motivera den begärda ("översynen (LU 1974128).

Frågan om köparens ställning vid factoring togs åter tipp i prop. 19771781142 med förslag till lag om avbetalningsköp mellan näriiigsidkare m. fl. Något förslagtill ändrade reglerlades dock inte fram. bl. a. på grund av att det inte fanns tillräckligt underlag för att ta ställning till de delvis komplicerade och mer övergripande frågor som det här rör sig om. Föredragande statsrådet framhöll emellertid att utvecklingen på området borde följas (prop. l977/78:l42 s. 56). Dessa uttalanden godtogs av riksdagen (LU l977/78:3l) s. "20 f. rskr 372).

] departementspromemorian konstateras att den här berörda frågan uppkommer inte bara vid factoring utan över huvud taget vid all överlåtelse eller pantsättning av fordringar och att det därför finns anledning att behandla den vid ("översynen av inkassolagen. Enligt promemorian kan det bidra till att undanröja risken för en gäldenär att tvingas betala dubbelt. om 5.5 inkassolagen kompletteras med en bestämmelse som tar sikte på överlåtelse- och pantsättningsfallen. l promemorian föreslås därför att det i 5 %$ föreskrivs att ett krav mot gäldenären skall. om fordringen har överlåtits eller pantsatts och gäldenären inte kan med befriande verkan betala till överlåtaren eller pantsättaren. innehålla tydlig uppgift om detta förhållan- de.

Vid remissbehandlingen har _detta förslag i allmänhet lätttnats utan erinran. Förslaget avstyrks emellertid av Svenska inkassofi'ireningen. som anför att inkassoft'iretagen inte kan ta på sig en skyldighet att i krav lämna upplysning enligt den föreslagna bestämmelsen. eftersom det i praktiken skulle medföra att inkassoföretagen i varje enskilt ärende måste förvissa sig om huruvida fordringen är överlåten eller pantsatt. Även Finansieringsfö- retagens förening ställer sig kritisk till förslaget.

För min del anser jag att det finns goda skäl för en bestämmelse av det slag som har förordats i departementspromemorian. Jag kan inte se att en uppgiftsskyldighet enligt bestämmelsen skulle leda till nägra större olägen- heter för inkassoföretagen. Sålunda bör det vara möjligt för dem att se till att deras huvudmän lämnar de upplysningar som behövs för att denna uppgiftsskyldighet skall kunna fullgöras. lnte heller i övrigt har under remissbehandlingen framkommit några avgörande invändningar mot prome- mt')rieförslaget i denna del. Jag förordar därför att förslaget genomförs. Till vissa frågor. som har berörts av bl. a. Svenska bankföreningen och Finansieringsföretagens förening. återkommer jag i specialmotiveringen.

Enligt 6 & får rättslig åtgärd med anledning av en fordran inte vidtas förrän gäldenären har tillställts ett krav som avses i Så och den därvid angivna tidsfristen har löpt ut. Bestämmelsen i (åå reglerar endast vad som i det aktuella hänseendet utgör god inkassosed. En underlåtenhet att framställa krav före rättslig åtgärd utgör sålunda inte något formellt hinder mot

ln kassa/(Igen

Prop. 1980/81:10 86

rättegång eller exekution (prop. 1974512 s.11tl: jfr s. 72).

Genom 75 öppnas möjlighet att frångå bestämmelserna i 5 och o äs' beträffande krav före rättslig åtgärd. om gäldenären uppenbarligen söker undandra sig att betala eller om det annars föreligger särskilda skäl. Regeln i 75 är avsedd att tillämpas endast i undantagsfall (prop. län-1:42 s. 75 och 111).

Beträffande (is' föreslås i promemorian inte någon ändring. Däremot föreslås att undantagsbestämmelsen i 7 & ändras på så sätt. att den inte längre kommer att innebära någon möjlighet att frångå bestämmelserna i 5 i) om utformningen av ett krav. Den föreslagna ändringen innebär alltså att rättslig åtgärd även i fortsättningen skall i undantagsfall få vidtas utan ett f("1'iregående krav men att kravet. när ett sådant skall framställas. måste ha det innehåll som följer av 5 9".

Dessa förslag har lämnats utan erinran under remissbehandlingen. Även jag ansluter mig till dem.

4.3.4 Hantering av inkasserade medel

Enligt 10 & inkassolagen skall medel som i yrkesmässig inkassoverksamhet har inkasserats för annans räkning hållas avskilda och utan dröjsmål insättas på räkning i bank eller motsvarande. Om inte annat har avtalats. skall medlen utan dröjsmål redovisas till huvudmannen.

Bestämmelsen om att inkasserade medel skall hållas avskilda och utan dröjsmål sättas in på bankräkning e. (1. är utformad så att lagen ( 1944:181 ) om redovisningsmedel blir tillämplig på de inkasserade medlen. Enligt denna lag skall medel. som någon med redovisningsskyldighet har mottagit för annan och för sådant ändamål har innestående på bankräkning eller på annat sätt håller avskilt. vara förbehållet huvudmannen. om beloppet har avskilts utan dröjsmål. Detsamma gäller belopp som har avskilts senare. om den redovisningsskyldige inte var på obestånd när beloppet avskildes. Medel som den redovisningsskyldige har omedelbart tillgängliga för att avskiljas är också fi'irbehållna huvudmannen. om dröjsmål med avskiljandct inte föreligger.

Bestämmelsen i 10 & inkassolagen innebär inte att varje huvudmans medel måste hållas avskilda på särskild räkning för sig ( prop. 1974:42 s. 112 ). Om en bankräkning eller motsvarande är avsedd för flera huvudmäns medel. har huvudmännen enligt lagen om redm'isningsmedel lika rätt inbördes. var och en i förhållande till sin redovisningsftn'dran.

Datainspektionen framhöll i sin promemoria rörande inkassolagen att den absoluta skyldighet att hålla inkasserade medel avskilda sotn föreskrivsi lll s” inkassolagen hade vållat vissa problem. Många av de organisationer och företag som omfattas av lagens regler om tillständsplikt är enligt inspektio- nen fastighetsfi'irvaltande. Beträffande dessa hade inspektionen vid bered- ningen av tillståndsärenden uppmärksammat att det ofta förekommer s. k.

Inkassolagen

Prop. 1980/81 :10 s7

totalförvaltningsuppdrag. vilket innebär bl.a. att uppdragstagaren skall avisera och uppbära hyror. lbland hålls dessa hyresmedel inte avskilda från uppdragstagarens egna medel. lnspektionen påpekade att lll & inkassolagen i dessa fall innebär att belopp som har influtit efter ett inkassoförfart-tnde måste hanteras annorlunda än motsvarande intäkter som inflyter pa normalt sätt. Samma ft'jrhållandcn hade enligt inspektionen uppmärksammats på den kommunala sektorn.

1 departementspromemorian understryks att ett inkassoombuds skyldig— het att hälla inkasserade medel avskilda innebär en betydande trygghet för huvudmannen.-"fordringsägaren. eftersom denne genom avskiljandet får ett sakrättsligt anspråk på de inkasserade medlen. Dessa kan således inte tas i. anspråk av inkassoombudets övriga bt'n'genärer. Skyldigheten att hålla inkasserade medel avskilda bör därför enligt prt'nnemorian gälla som huvudregel även i framtiden.

[ promemorian diskuteras emellertid vad-som skall gälla. om lagens tillämpningsområde utvidgas till att omfatta fall där någon icke yrkesmässigt driver in fordran för annans räkning. Enligt promemorian] kan det ifrågasättas om lagen bör ha detta vidsträckta tillämpningsmnräde även när det gäller 10 %. Det skulle nämligen kunna medföra att en privatperson. som helt tillfälligt inkasserar en fordran för annans räkning och därvid samman- blandar de inkasserade medlen med sina egna. drabbades av ansvar för olovligt förfogande. Enligt promemorian torde det emellertid vara en allmänt omfattad åsikt att man inte bör blanda samman egna medel och medel som man innehar med skyldighet .att redovisa till annan. Några olämpliga konsekvenser av utvidgningen av tillämpningsområdet för skyl- digheten att hålla inkasserade medel avskilda behövde därför inte befa— ras.

För att lagen om redovisningsmedel skall vara tillämplig på inkasserade medel och dessa därmed vara förbehållna huvudmannen är det enligt promemorian inte nödvändigt att medlen sätts in på räkning i bank eller motsvarande. Det är tillräckligt att tnedlcn hålls avskilda på något annat godtagbart sätt (se prop. 1944181 med förslag till lag om redovisningsmedel. m. m.. 5. 33 f). 1 promemorian framhålls att det med hänsyn till detta synes onödigt att kräva att även den som mera tillfälligtvis har inkasserat medel för annans räkning ovillkorligen skall sätta in dessa på bankräkning e. d. Den skyldighet som f. n. gäller i detta avseende bör därför enligt promemorian begränsas till att gälla endast för den som bedriver inkassoverksamhet för annans räkning av någon betydenhet.

Med anledning av det problem som datainspektitmen har dragit upp föreslås i departementspromemorian att det för vissa fall öppnas en möjlighet för borgenärer att skriftligen befria inkassomnbuden såväl fran skyldigheten att hålla inkasserade medel avskilda som från skyldigheten att sätta in dem på bankräkning c. d. En sådan möjlighet bör enligt prcnnemorian finnas när den som får en borgenärs uppdrag att driva in en fordran har ett annat.

Inkassolagen

Prop. 1980/81:10 88

fortlöpande uppdrag av borgenären att i väsentlig omfattning uppbära medel för borgenärens räkning utan skyldighet att hålla dessa medel avskilda.

Vid remissbehandlingen har dessa förslag i departementspromemorian lämnats utan erinran. I fråga om möjligheten att för vissa fall skriftligen överenskrnnma om avsteg från skyldigheten att hålla inkasserade medel avskilda m. m. framhåller datainspektionen att den lösning som har fi.")reslagits synes vara väl avvägd.

Även jag anser att 10.5 bör ändras på i huvudsak det sätt som har föreslagits i departementspromemorian. Den föreslagna möjligheten att i vissa fall träffa skriftlig överenskommelse om en enklare hantering av inkasserade medel än som f. n. följer av paragrafen är ägnad att undanröja onödigt krångel. Bestämmelsen har enligt min mening getts en sådan avgränsning att några missft'irhållanden inte kan befaras uppkomma.

Som har påpekats i departementspromemorian innebär prtnnemorieför- slaget att skyldigheten att hålla inkasserade medel avskilda skall gälla även när en privatperson helt tillfälligt inkasserat" en fordran för annans räkning. varvid en underlåtenhet att iaktta denna skyldighet kan medföra ansvar för olovligt förfogande. .Jag delar uppfattningen i promemorian att denna utsträckning av tillämpningsområdet när det gäller skyldigheten enligt 10% att hålla inkasserade medel avskilda knappast behöver leda till olämpliga konsekvenser. bl. a. därför att frågan huruvida denna skyldighet har åsidosatts praktiskt taget aldrig torde få aktualitet i förhållanden mellan privatpersoner. .lag vill tillägga att en plikt till avskiljande över huvud taget inte uppkommer. om den som har inkasserat en fordran för annans räkning inte har uppdrag att vidta inkassoätgärder i lagens mening och inte heller vidtar sädana åtgärder.

4.3.5 Register i inkassoverksam/zei

Framför allt i mer omfattande inkassoverksamhet förs vissa register över olika gäldenärer och inkassoärenden m. m. För register. förteckningar eller andra anteckningar sotn förs med hjälp av ADB och som innehåller personuppgifter gäller bestämmelserna i datalagen. Sådana personregister får enligt den lagen i allmänhet inte inrättas eller föras utan tillstånd av datainspektionen. När tillstånd meddelas skall inspektionen utfärda de föreskrifter som behövs för att bl. a. skydda den personliga integriteten. Datalagen innehåller vidare bestämmelser om olika skyldigheter för den som är registeransvarig och om datainspektionens tillsyn över personregister- verksamhet.

Inkassolagen innehåller inte några särskilda bestämmelser om register som används i inkassmierksamhet. Vid lagens tillkomst bedömdes det nämligen som obehövligt att på inkassmnnrådet föra in särskilda regler om register vid sidan av datalagens bestämmelser om ADB-register (se prop. 1974:42 s. 76 ).

Inkassolagen

Prop. l980/81:10 89

[sin promemoria rörande inkassolagen uppgav datainspektionen att man i olika sammanhang hade kt'tnstaterat att inkassoverksamheten medför en omfattande registrering av uppgifter. som i orätta händer eller oriktigt använda kan medft'ftra obehörigt intrång i den personliga integriteten eller andra skadliga verkningar. Erfarenheterna hade enligt inspektionen visat att det i många fall var angeläget att kunna reglera vissa frågor avseende register också i inkassoverksamhet där registrering sker utan användande av ADB.

1 departemcntspromemorian konstateras till en början att sådana register över gäldenärer m. in. som kan förekomma i inkassoverksamhet skiljer sig från kreditupplysningsregister på så sätt att de i allmänhet utgör endast interna hjälpmedel för att inkassoverksamheten skall kunna bedrivas effektivt. 1 promemorian framhälls att det på ett flertal andra områden finns liknande register med en motsvarande funktion. vilka inte är underkastade särskild rättslig reglering annat än om de förs med hjälp av ADB. Vidare påpekas i promemorian att uppgifter om personliga förhällanden m. m. i register som används i inkassoverksamhet f. n. ingalunda lämnas oskyddade enligt inkassolagen. Härvid hänvisas till lagens bestämmelser om tystnads- plikt för den som är eller har varit verksam i inkasstwerksamhet samt till att datainspektionen i sin tillsynsverksamhet enligt lagen kan ta upp särskilt angelägna frågor om integritetsskydd i inkasstwerksamhct: jfr 3 & instruk— tionen (1973:292) för datainspektionen (ändrad senast 19771134). 1 prome— morian berörs vidare datalagstiftningskommittens överväganden beträffan— de cn framtida generell personregisterlagstiftning. vilka när promemorian utarbetades nyligen hade presenterats i kommitténs delbetänkande (SOU 1978:54) Personregister Datorer Integritet.

I departementspromemorian framhålls att det mot denna bakgrund inte synes föreligga tillräckligt starka skäl för att redan nu isolerat ta upp frågan om en mer uttömmande reglering beträffande sådana register som förekom- mer i inkassoverksamhet. Enligt promemorian möter här problem av mer allmän natur som är gemensamma för en rad olika register av hjälpmedelsty- pen och som därför bör bli föremål för en samlad bedömning i annat sammanhang.

Enligt promemorian bör emellertid vissa mera begränsande regler om register i inkassoverksamhet tas in i inkassolagen redan i samband med den nu aktuella översynen. Med hänvisning till datainspektionens anmärkningar framhålls i promemorian att risken för integritetskränkningar och liknande skadeverkningar kan vara betydande. om ett register som har upprättats i och för inkassoverksamhet kommer till användning för ett annat ändamål än det sålunda har varit avsett för. Detta kan särskilt tänkas inträffa. om sådana register fritt får överlåtas eller upplåtas till annan. En risk för obehörig spridning av registeruppgifter föreligger enligt promemorian vidare. om det inte finns tillräckliga garantier för ett ansvarsfullt förfarande med register som blir överflödiga. t. ex. i samband med att ett inkassoft'iretag läggs ned.

Inkassolagen

Prop. HSO/81:10 ut)

För att sådana onödiga skaderisker i möjligaste män skall undanröjas föresläs i departementspromemorian att det i inkassolagen förs in bestäm- melser som ger möjlighet att hindra olämpliga ("överlätelser eller upplåtelser av register. Bestämmelserna I'i'iresli'ts utformade efter mönster av 13 * kreditupplysningslagen. linligt förslaget skall det sälunda krävas medgivan- de av datainspektionen för ("överlätelse eller upplåtelse av register. Vidare föresläs bestämmelser om skyldighet att göra anmälan till inspektionen när en inkasstwerksamhet skall upphöra och om rätt för inspektionen att i sådana fall ge föreskrifter om hanteringen av register som berörs. Överträdelse av reglerna om register skall enligt förslaget kunna medföra straff och i vissa fall f("irverkande av registret. Bl.a. med hänsyn till detta föreslås att de nya bestämmelserna begränsas till att avse registeri tillständspliktig inkassm'erk— samhet. Enligt promemorian bör de ocksä. i vart fall t. v.. begränsas till att omfatta endast register över gäldenärer.

Vid rcmissbehandlingen har de nu redovisade förslagen i departements- promemorian. bortsett frän vissa påpekanden i detaljfrågor. tillstyrkts eller lämnats utan erinran.

()cksä jag anslttter mig till dessa förslag. Samtidigt vill jag nämna att datalagstiftningskommitten nyligen genom tilläggsdirektiv (Dir. l()8(l:l4) har fått i uppdrag att överväga bl. a. frågan om en generell perstmregister— lagstiftning. som på sikt skulle kunna ersätta datalagen och till skillnad från denna gälla oavsett med vilken teknik ett register lt _. Inom ramen för det uppdraget har kommitten att pröva bl. a. frågor om register i inkassoverk- samhet.

4.3.6 Allt/ru _/'nig0r rörande inkusso/agmz

[ 8 & inkassolagen finns en bestämmelse som har karaktären av en rekommendation. Enligt denna bestämmelse bör inkassoå'itgärd inte vidtas. om det föreligger sannolika skäl för att en fordran inte är lagligen grundad eller om fordringen annars framstår som obefogad. Paragrafen kan enligt förarbetena aktualiseras bl. a. om gäldenären är omyndig eller om ett avtal mäste antas vara ogiltigt på grund av svek e. d. Vid lagens tillkomst framht'jlls vidare att det är angeläget att inkassoföretagen inte medverkar till att driva in ränta efter högre räntesats än som anges i lag eller som har stöd i avtal eller sedvänja e. d.

Datainspektionen uppgav i sin promemoria rörande inkassolagen att bestämmelsen i 8 & har fått praktisk tillämpning när det gäller ränteyrkan— den. För att dessa skall få en rättsenlig utformning är det en förutsättning att exempelvis ett inkassmmbud själv behärskar reglerna om dröjsmålsränta. Enligt inspektionens erfarenhet var detta inte alltid fallet. lnspektionen framhöll att problemen med ogrundade ränteyrkanden i viss män skulle kunna lösas genom att borgenärer åläggs att-i ansökningar vid domstol ange grunden för yrkad ränta och genom att domstolarna äläggs att självmant

I " kassola gen

Prop. 1980/81:10 9l

pröva riktigheten av ränteanspräk i summarisk process.

Enligt datainspekticmen hade svärigheter vid tillämpningen av 8 & uppstätt när det gäller inkassoärenden om kontrt'tllavgift vid s. k. tomtmarksparke- ring. lnkassm'itgt'irder riktas i dessa fall i regel mot lordt'msägaren. som enligt inspektionen inte torde vara skyldig att betala avgiften i fall da han inte har fört fordonet vid tillfället. Problemet skulle enligt inspektionen kunna lösas. om fordonsägarmt genom lagstiftning äläggs betalningsansvar för sådana avgifter.

]" departementspromemorian föresläs inte nägon ändring av 8 5. Fragan om utformningen av ränteyrkanden. sa att de stär i överensstämmelse med gällande rätt. aktualiserar enligt promemru'ian i första hand spörsmalet hur man skall kunna åstadkomma bättre kunskap om rättsreglerna pä omradet. [ promemorian framhälls att datainspcktionen i sin tillsti"iiitlsp|'t"n-'iiings- och tillsynsverksamhet bör ha uppmärksamheten riktad pä att i vart fall de som i större omfattning handhar inkassoärenden har tillräcklig kompetens samt päpeka eventuella utbildningsbehov.

Vid remissbehandlingen har Stockholms tingsrätt strukit under vikten av vad som sälunda har uttalats i promeimn-ian. Tingsrätten säger sig ha gjort den erfarenheten att de som pä inkassoföretagen sysslar med ansökningar till domstol ofta har bristfälliga kunskaper om en del grundläggande rättsregler av betydelse i sammanhanget. Datainspektionen framhäller i sitt remissytt— rande att den inte anser sig ha resurser för en kartläggning av kunskapsnivän hos inkassoföretagens anställda.

För egen del ansluter jag mig till sti'int'lpunkten att det saknas anledning att ändra bestämmelsen i 8 %$. Samtidigt vill jag understryka att det är av största vikt att särskilt befattningshavarmt hos inkassofi'iretagen har tillfredsställan- de kunskaper om de rättsregler som aktualiseras i deras arbete. Som har framhällits i departementsprmnemorian är det angeläget att datainspektio- nen har sin uppmärksamhet riktad pä hithörande frägor. Självfallet kan det inte komma i fräga att inspektionen skulle söka kartlägga de närmare förhällandemt. lnspektionen kan dock. särskilt när det gäller de rena inkassoföretagen. inom ramen för tillständsprt'wnings- och tillsynsverksam- heten se till bl. a. att företagen gör tillräckliga insatser för utbildning av de anställda e. d.

När det gäller de frågor som datainspektionen i övrigt tog upp i sin promemoria om inkasst'JIagen fär jag hänvisa till vad som har anförts i departementspromemorian. I enlighet med uttalandena i den promemorian bör spörsmälet om angivande av grunden för ränteansprak i ansökningar vid domstol och om domstols prövning av sädana anspräk tas tipp i samband med en redan tidigare aktualiserad. mer (_nnfattande översyn av den summariska betalningsprocessen. Denna översyn torde. i enlighet med vad som har anförts i den i juni [979 beslutade lagrädsremisscn med förslag till handräekningslag m. m.. komma att verkställas när resultatet av rättegängs- utredningens arbete föreligger. Den av inspektionen beri'örda frägan om

Inkassolagen

Prop. 1980/8lzltl 97

betalningsansvaret för kontrollavgiftcr vid tomtmarksparkering övervägs f. n. av tomtparkeringsutredningen (K l97811tl).

Enligt 9 & inkassolagen är betalning. som gäldenären erlägger till den som har uppdrag att driva in en fordran. gällande mot borgenären. Bakgrunden till denna bestämmelse är att det ofta förekommer att en gäldenär betalar till ett inkassoföretag eller annan som har uppdrag att driva in en fordran i stället för att betala direkt till borgenären. Gäldenären skulle i sädant fall kunna tvingas att betala även till borgenären. om inkassoföretaget etc. har saknat fullmakt att uppbära betalning och dessutom har underlätit att redovisa de uppburna medlen till borgenären. Bestämmelsen i 9 & är avsedd att sä längt möjligt skydda gäldenären mot en sådan risk.

[ departementspromemorian föreslås att bestämmelsen i 9 & behälls (')föri'indrad. Till följd av förslagen i avsnittet 4.3.1 fär den visserligen ett något vidare tillämpningsomräde än f. n. Detta kan dock enligt departe- mentspromcmorian inte antas komma att medföra ('>lägenheter. Jag delar denna uppfattning. som har lämnats utan erinran av remissinstansermt. Det torde nämligen praktiskt taget undantagslöst förhålla sig sä. att den som ger nägon annan i uppdrag att driva in en fordran ocksä avser att denne skall ha rätt att ta emot betalning av gäldenären. Som har päpekats i departements- promemorian är det. för att 9 5 skall vara tillämplig. tillräckligt att den som tar emot betalningen har fätt borgenärens uppdrag att driva in fordringen och därvid eventuellt vidta inkassoätgärder i lagens mening. Det krävs sälunda inte att någon sädan ätgärd verkligen har vidtagits innan betalningen sker.

[ 11 åinkassolagen finns f. n. en bestämmelse om tystnadsplikt för den som är eller har 'arit verksam i sådan inkassoverksamhet som i dag är tillsti'indspliktig. Detta gäller inkassoverksamhet som avser indrivning av fordringar för annans räkning eller fordringar som övertagits för indrivning. under ft.")rutsättning att verksamheten bedrivs yrkesmässigt. Frän tillständs- plikten undantas f. n. verksamhet som bedrivs av Sveriges riksbank. Sveriges investeringsbank AB. kreditinrättning under lutnkinspektionens tillsyn eller advokat.

Enligt vad jag har föreslagit i avsnittet 4.3.2 bör den nuvaramle tillståndsplikten begränsas. Den tystnadsplikt som föreskrivs i ll & är emellertid av väsentlig betydelse både för fmdringsägare som anlitar inkassoombud och för gäldenärer som utsätts för inkassoätgärder och därmed kan bli tvungna att lämna ut känsliga uppgifter om sina personliga förhällanden. Den nuvarande omfattningen av tystnadsplikten bör därför inte inskränkas. Tystnadsplikten kan alltsä inte längre avgränsas med hjälp av tillständsplikten. varför ll smäste arbetas om. .lag äterkommer till detta i specialmotiveringen.

l lo s* inkassolagen finns en bestämmelse om tystnadsplikt för den som hos datainspektionen har tagit befattning med tillständs- eller tillsynsärende enligtlagen. Bestämmelsen ersätts fr. o. m. den 1 januari l98l av regler i den

Inkassolagen

Prop. 1980/81 : 10 93

nya sekretesslagen. Jag föreslär därför att 16 & inkassolagen upphävs med verkan fr. o. m. nämnda dag. '

Bestämmelser om datainspektionens tillsyn över efterlevnaden av inkas- solagen finnsi l3—lS åå. Fran inspektionens tillsyn undantas f. n. verksamhet som bedrivs av Sveriges riksbank. Sveriges investeringsbank AB. kreditin- rättning under bankinspektionens tillsyn eller advokat. Det räder alltsä f. n. parallellitet mellan de särskilda undantagen frän tillständsplikten enligt lagen och undantagen frän datainspektionens tillsyn. Som har anförts i avsnittet 4.3.2 bör undantaget frän tillständsplikt för verksamhet under bankinspek- tionens tillsyn utvidgas till att omfatta inte bara kreditinrättningar utan alla företag under bankinspektionens tillsyn. lin motsvarande utvidgning bör. i enlighet med vad som har föreslagits i departementspromemorian. göras när det gäller undantagen frän datainspektionens tillsyn enligt lagen. Detta föranleder en ändring i l3 s'. till vilken jag fär äterkomma i specialmotive- ringen.

i övrigt bör. i enlighet med promemorieförslaget. göras vissa ändringar i bestämmelserna i 3.5 om beviljande av tillständ till inkassoverksamhet. Vidare bör bestämmelserna i l7 & om straff för vissa förfaranden i strid mot lagen kompletteras med bestämmelser om straff för den som bryter bl. a. mot de nya regler som jag har föreslagit beträffande gäldenärsregister i tillständspliktig inkassoverksamhet. [ anslutning till dessa nya straffbestäm- melser bör det ocksä föras in bestämmelser som efter mönster av Ztlä kredittlpplysningslagen ger möjlighet att i vissa fall förklara ett gäldenärsre- gister förverkat. ] dessa delar fär jag hänvisa till specialmotiveringen.

4.4 Ersättning för inkassokostnader

4.4.1 Behovet av Iagrnj/lning

När en gäldenär underläter att infria sin skuld. äsamkas borgenären i allmänhet vissa kostnader för att driva in sin fordran. Pä det stadium som föregår eventuella rättsliga och exekutiva ätgärder mot gäldenären märks framför allt kostnader för krav beträffande fordringen och kostnader för de vanligt förekommande uppgörelserna om att gäldenären. när han inte kan betala hela det förfallna beloppet pä en gäng. skall erlägga detta genom avbetalningar. [ princip anses gäldenären vara skyldig att ersätta borgenären skäliga indrivningskostnader som denne gör anspräk pä.

De nuvarande författningsreglerna om en gäldenärs skyldighet att ersätta borgenärens kostnader för inkassoätgärder tar sikte enbart pä den situatio- nen att en inkassoätgärd följs av rättegäng eller ansökan om lagsökning eller betalningsföreläggande rörande den fordran som har föranlett inkassoätgär- den (luivudfordringen). Inkassokostnaden ersätts dä som rättegängskostnad i den efterföljande processen. De grundläggande bestämmelserna finns i 18 kap. 8 å andra stycket rättegängsbalken samt i lä och 32 N lagsökningslagen.

Ersättning för ink assok osmader

Prop. HSO/81:10 9-1

Närmare regler om et'sättningsskyltlighetcn har utfärdats av regeringen i inkassokostnadskttngt'jrelsen. l.".nligt kungörelsen tltgar ersättning för krav sotn avses i 5 & inkassolagen och för amorteringsplan som har tillkommit i samband med ft'trdringens inkassering. lin förutsättning är dock att ätgärden skäligen har varit päkallat! för att ta till vara borgenärens rätt. F. 11. utgör ersättningen i normala fall högst 55 kr. för krav och högst 45 kr. för antorteringsplan. ()m särskilda skäl föreligger. fär ersättning utgä med högre belopp. Reglerna medför inte rätt till ersättning för mindre kostnadskrävan- de ätgärder. t. ex. enkla betalningspäminnelser (jfr prop. l()7l:l(l5 s. It)).

i departementsprometnorian päpekas att det finns flera skäl som talar för att borgenärens rätt till ersättning för inkassokt'tstnader regleras sotn en rätt till ersättning för rättcgängskostnader. När anspräk pä ersättning för inkt-tssokostnat'ler förs till prövning av domstol sker det vanligen tillsammans med huvudfordringen. Det är dä naturligt att betrakta inkasst'tkostnaden som en med rättegängskostnad likställd utgift. som borgenären till följd av gältlenärens l't'örsumlighet har ädragit sig föratt ta till vara sin rätt (jfr prop. 197lzltl5 s. 17 samt ltt—12). Det är vidare ett framträdande syfte med de nuvarande reglerna att skydda gäldenären mpt överdrivna ersättningsan— spräk. Frän den synpunkten har man genom att behandla inkassokostnaden

:

sotn en rättegangskostnad vunnit främst den fördelen att domstolen självmant. dvs. oberoende av invändning frän gäldenärens sida. katt pröva det berättigade och skäligai kostnadsanspräket. Denna s. k. officialprt'ftvning torde vara av särskilt stor betydelse i den stttntnariska process i form av lagsökning" eller betalningsfi'ireläggant'le där mälen ofta avgörs utan att gäldenären har hört av sig. Ett annan fördel med att behandla inkassokost- naden som en rättegängskostnad är att borgenären inte katt först utverka ett domstoIsavgi'trant'le beträffande huvut'lfort'lringen för att senare äterkomma till domstolen med ett anspräk pä ersättning för inkassoätgärder som har vidtagits före det första domstt'tlsförfz'trattdet. Enligt 18 kap. 14 s* rättegängs- balken mäste nämligen yrkande om ersättning för rättegangskostnader framställas innan handläggningen av huvudsaken har avslutats.

Å andra sidan har den nuvarande regleringen av rätten till ersättning för inkassokostnad brister. i departementsprtunemt'trian pekas främst pä att det inte fintts ttägon direkt reglering av inkassokostnadcrna för fall dä ett anspräk pä ersättning för inkassokostnad framställs tttotn rätta eller förs till pt't'ivning av domstol sedan httvudfort'lringen ltar betalts. [ dessa situationer har gäldenären ansetts skyldig att ersätta borgenärens inkassokostnader pä skadeständsrättslig grund. Detta innebär att inkassokostnaderna är under— kastade olika regler i olika situationer.

[ departementsprotnemoriatt föresläs att de nuvarande bestämmelserna om rätten till ersättning för inkassokostnader ersätts av civilrättsliga regler. sotn blir tillämpliga inte bara vid process vid domstol tttan ocksä när kostnadsanspräket framställs tttotn rätta. De nya reglerna bör enligt promemorian föras samman till en särskild lag om ersättning för inkasso- kostnad.

Ersättning för inkasso/t' ().vlrtuder

Prop. 1980/81 :10 95

Protnentorieff'trslaget har i denna del lämnats tttatt erinran av praktiskt taget samtliga remissittstattscr.

Enligt tttitt mening är det inte tillfredsställattde att ett ersättttittgsanspräk av så vanligt slag som ersättning för ittkassokostttader behandlas än sotn ett anspräk pä ersättning för rättegz'lngskostnad. än sotn en civilrättslig fordran pä skadestättd. Det innebär bl. a. att olika regler kommer att gälla för en- dotttstols handläggning av inkasst>kostnatlsanspräket beroende pä om gäldenären ltar betalt ltuvudft'trtlringen eller ej. Har huvttt'lfortlrittgett betalts. kommer frägatt om ersättning för inkassokostttadett att tttgöra själva saken i processen. Ersättningsansprt'tket behandlas därmed enligt helt andra processuella regler än de sotn gäller för rättegängskostnad.

Ett annan allvarligare invänt'lning tttot den nuvarande regleringen är att det saknas direkt tillämpliga regler om själva ersättttingsskyldigheten bäde i den nyss nämnda situationen och i den sitttatiott som torde vara vanligast. ttätttligett att ersättttittgsattspräket framställs och tillgodoses tttont rätta. i sammanhanget bör ttätttttas att dataittspektiottett. enligt vad som ltar redovisats i departetnentsprt'mtentorian. har bedömt att det varje är sänds ut ttter än en miljon kravbrev i landet och att betydligt mindre ätt hälften av dessa torde följas av rättsliga ätgärder. Det ltar visserligen förutsatts att reglerna i inkassokostnadskuttgörelsett skall vara vägledande även utanför sittcgetttliga tillämpningsonträde (se prop. 1971 : 105 s. 19). i praktiken synes detta också i stor utsträckning lta blivit fallet. Det beror bl.a. pä att datainspektionen i sitt tillsynsverksatttltet enligt ittkassolagen har ansett att det inte är förettligt nted god inkassosed att en borgenär bctittgar sig högre ersättning för inkasst'tkostnader ätt en domstol katt väntas döma ut. Som ltar päpekats i departetttentsprontentoriatt är det emellertid frän principiella synpunkterföga tilltalande att tttatt för den i praktiken vanligaste situationen tttäste hjälpa sig fram genottt att hätttta ledning av bestämmelser som är avsedda för en annan situation. i viss utsträckning ltar detta förhällandc gett upphov till osäkerhet om ersättttittgsskyldigltetetts (:tntfattning.

Den nuvarande regleringen är ocksä otillfredsställattde frän konstitu- tionell synpunkt. Regeringsformens bestämmelser om nortttgivningsmakten ger knappast utrymme för att borgettärens rätt till ersättning av gäldenären för inkassokostnad i sä stor ttsträckttittg som f. n. regleras genom annan författning ätt lag. Jag vill vidare erinra om att lagrädet. ttär förslaget om den nuvarande processrättsliga rcgleringett lades fram. i sitt yttrande över förslaget framhöll att frägatt om gäldettäretts skyldighet att vid betalnings- dröjsmäl ersätta borgenären för inkassokostnad var av sädan ttatttr att den borde regleras genom bestätntttelser i civillag. Lagrädet godtog visserligen förslaget men attsäg att den processrättsliga regleringen borde betraktas som en provisorisk lösning (se prop. l*)7l:ltl5 s. 33).

Med hänsyn till det tttt anförda ansluter jag ntig till förslaget i departetttentspromentorian att de gällande bestämmelserna om rätt till ersättning för inkassokostttader bör bytas ut tttot en civilrättslig reglering.

Ersättning för inkt'tssokostrtader

Prop. l980/8l210 %

som blir direkt tillämplig även när attspräk pä ersättning för inkassokostna- der fratttställs utom rätta.

i enlighet med vad som har föreslagits i dcpartententsprontentorian bör de nya ersättnittgsbestämtttelsertta föras santtttan till en särskild lag. Ett viktigt syfte även ttted de nya reglerna är att skydda gäldenären mot en alltför betungande crsättningsskyldighet. Som frantltölls när den nuvarande. pro— cessrättsliga reglerittgen kom till mäste det nämligen anses ligga i ett skuldförhällant'lcs natur att en borgenär själv visar någon aktivitet för att fä betalttittg till stånd och själv svarar för en del av kostnaderna härför (jfr prop. 1971:l()5 s. It)). [ den ttya lagen bör därför närmare anges vilka olika kostnader som gäldenären skall vara skyldig ett ersätta satttt de närmare förutsättttingartta för crsättningsskyldiglteten. Vidare bör meddelas vissa föreskrifter om ersättnittgsbeloppens storlek.

4.4.2 Til/änn)ningsontrtit'let

Enligt departemetttsprotnentorian bör den ttya lagett om ersätttting för inkassokostnader reglera gäldenärens skyldighet att ersätta borgettäretts kostnader för alla sädana mera rutinmässiga och förhållandevis enkla ätgärder som en borgenär. sedan fordrittgett har förfallit till betalning. vidtar eller läter vidta i syfte att förmä gäldenären att betala. llär avses borgenäretts kostnader för enkla betalningspäntinnelser. för krav enligt 5 & ittkassolagett. för korrespondens och annan enklare kommunikation met gäldenären och för upprättande av amorteringsplan när det visar sig att gäldenären inte katt på en gäng betala hela den förfallna skulden.

Ett ttndatttag föresläs dock för kostnader för mer omfattande förhant'lling för biläggande av tvistefräga rörande en fordran. ] prt'nnemorian fratttltälls att frägan om gäldenärens skyldighet att ersätta borgenärens kostnader för regelrätta tvisteförhant'llittgar inte bör regleras i den här aktuella lagen: Enligt prt'ttnemt'trian är sädana förhandlingskostnat'ler visserligen inte artskilda frän sedvanliga inkassokostnader. och de är desstttom reglerade pä ett sätt som mots 'arar det som f. n. gäller för inkassokostnadertta. Vid en efterföljande rättegäng ersätts säluttda enligt 18 kap. ååå första stycket rättegängsbalken vissa förltattdlittgskostnader säsotn rt'ittegängskostnad. medan det i övrigt sakttas direkt tillätttpliga lagregler rörande en parts skyldighet att ersätta förhandlingskostnader. [ promemorian påpekas att det emellertid här rör sig om kostnader som katt ttppkomttta säväl för gäldenären sotn för borgenären i ett fordrittgsförltällande. Vidare är det fräga om kostnader vilkas storlek varierar betydligt frän fall till fall och som därför bör bli föremäl för en individualiserad bedömning. Ettligt prontcntoriatt läntpar de sig därmed inte för en reglering i förevarande sammanhang.

[ protttentoriatt framhälls vidare att skyldigheten att ersätta kostnader för rättsliga ätgärder som lagsökning. betalttingsföreläggattde. skiljeföt'farande och vanlig rättegäng är särskilt reglerad. Sädana kostnader bör därför enligt

Ersättning för inkassokostnader

Prop. 1980/81:10 97

promemorian inte ontfattas av den ttya lagen. Detsatttttta gäller frägan om ersättning för exekutiva ätgärder e. d.

Departetttetttsprometnorians överväganden och förslag i dentta del har i ltuvudsak godtagits av retttissittstattscrna. [ en del hänseenden framförs emellertid fri-itt olika häll vissa kritiska synpunkter.

För egen del attsluter jag mig i sak till promemorians förslag rörande avgränsningen av tillätttpningsrntträdet för den ttya lagen. Vad som bör regleras i detta satttmatthattg är gält'lenärens skyldighet att ersätta borgenä— rens kostnad för ätgärder sotn normalt ingär i det utomrättsliga förfarandet för indrivning av en ft'irfallen fordran och som katt anses föranlet'lt'la av gäldenärens betalttingst'lrt'ftjstnäl. Som har understrukits i promctttorian bör lagett däretttot inte ontfatta frägan om gäldenäretts skyldighet att ersätta borgettäretts kostnader för faktureringar. förltandsaviseringar eller päntin- ttelser som görs före en fordrans fi'irfallodag. Eventuella anspräk pä ersättning för sädana kostnader katt jtt inte grundas pä gäldenärens betalttingsdröjsmäl. lluruvit'la gäldenären är skyldig att ersätta kostnat'lerna beror direkt av innehället i avtalet ntellatt parterna.

De kostnader som den ttya lagctt sälunda kommer att ontfatta är i praktiken kostnaderna för enkla betalningspäminttelser satttt för krav och uppgörelser ont atttorterittgsplatter och andra rutinmässiga ätgärder i anslutning därtill. säsont sattttal och korrespondens ttted gäldenären. Av de skäl som ltar anförts i promcmtttrian bör den ttya lagett däremot inte reglera frägan om ersättttittgsskyldigltet för kostttad för mer ontfattant'le förhand- lingar för biläggande av en tvist rörande en fordran.

I enlighet nted vad som ltar fastslagits i promemorian skall den ttya lagen givetvis inte beröra skyldigheten att ersätta kostnader som avser olika rättsliga f("irfaranden. Sädana frägor är särskilt reglerade i rättegängsbalken och annan processrättslig lagstiftning. lttte lteller bör i förevarande sammanhang behandlas frägan om ersättttingsskyldighet för kostnader som avser exekutiva ätgärder. Frägatt i vad man gäldenären skall vara skyldig att ersätta sädana kostttader bör regleras inom utsökningsrätten.

Den nya civilrättsliga regleringen av rätten till ersätttting för inkassokost- nader ttt. nt. har i departemetttsprt'ttttettttitrian föreslagits bli tvingande till gäldettäretts förmän. Med attledttittg härav ltar nägra remissinstanser. som förträder kreditgivare och inkassoft'tretag. förordat att den ttya lagen generellt bcgrättsas till att gälla fall där gäldenären är en privatperson. Enligt mitt mening bör en sädatt inskränkning av tillämpningsomrädet entellertid inte kottttna i fräga. Den föreslagna lagen bör. i likltet ttted den nuvarande processrättsliga rcgleringctt. vara tillämplig oavsett om gäldenären är konsument eller näringsidkare och oberoende av parternas ställning i övrigt.

Till frägan i vad tnätt lagett ocksä bör vara tvingande till gäldenärens förmän äterkotttttter jag i det följande.

I sitt utredning om inkassokostnaderna föreslog dataittspektionett att en tty

7 Riksdagen 198018]. I sant/. Nr I!)

Ersättning för in kassok oxtnader

Prop. l980/8l : [0 %”

civilrättslig reglering pä omrädet skttllc omfatta även frägan om en gäldenärs skyldighet att utge ersättning för ett speciellt slags kostnader. ttätttligett kostnader för avisering och bokföring av betalttittg enligt en atttorterittgsplatt som har upprättats pa inkasscrittgsstadiet. Sädana kostnader omfattas inte av ittkassokostttadskungörelsett. littligt ittspektiottetts förslag skttlle gäldenären vara skyldig att utge etsätttting för dessa kostnader ttttder förutsättning att ltatt var skyldig att utge ersättning för själva upprättandet av atttorterings- planett.

I departementsprorttentorian framhälls att det visserligen fitttts en del skäl som katt tala för dataittspektionens lörslag. Å andra sidan fitttts det enligt promemorian cn uppettbat' risk för att förslaget skttlle kotttttta att medföra att aviserings- och bokföringskostnat'lcr rutinmässigt tas ut ocksa i ett stort antal fall där- borgenären annars inte skttlle fordra ersättning av gäldenären för sädatta kostnader. Främst med hänsyn till detta bör ettligt promemorian gäldettäretts skyldighet att ersätta sädana kostnader liksom hittills bero av överettskottttttelse ntellan parterna och inte regleras genom den ttya lagen.

Vid rentissbeltattdlittgett ltar promemorieförslaget i detttta del godtagits av det stora flertalet remissinstanser. Datainspektionen satttt ytterligare nagra remissinstanser. bl. a. ft'treträdare för kreditgivare. ltar emellertid vänt stg tttot prontentorieförslaget och hävdat att inspektionens förslag bör följas.

För tttin del finner jag inte skäl att ittta en annan ständpunkt ätt den som har redovisats i departententspromentorian. Som ltar päpekats i promemorian innebär en antorteringsöverenskt'tmtttelse mellan parterna pä indrivningssta- diet att nya förfallotider fastställs för den i'tterstt'tende delen av skulden. Gäldenären är givetvis pä grttttd av denna ("tverettskt'tmtttelse skyldig att betala pä de ttya förfallodagarna. oavsett om borgenären före dessa dagar aviserar honom om den fi.")restäent'le betalningen eller inte. Enligt tttitt mening bör borgenären inte genom den nu förordade lagett ges rätt till ersättning för kostnaden för avisering. om ltatt ättdä finner det lämpligt att vidta en sädan ätgärd. l fräga om gäldenärens skyldighet att i den aktuella situationen ersätta aviseringskostnaden bör i stället gälla satttttta princip som enligt det tidigare sagda gäller beträffande kostnader för förhandsaviserittg i allmänhet. Ersättningsskyldigheten bör alltsä över huvud taget inte reglerasi den nya lagen utatt helt bero av avtal mellan parterna. Detsatttttta bör gälla i fräga om de här aktuella bokföringskostnat'lertta. Dessa är enligt ntitt tttettittg inte av sädan natur att gäldenären bör förpliktas att ersätta dent säsom en av betalningsdri'äjsmälet föranledd ekottontisk skada för borgenären.

Det bör tilläggas att de diskuterade antorteringsplanerna vanligen tillkommer i ett förfarande som faller uttder ittkassolagett. Som ltar fratttltällits i departemetttsprotttentorian bör dataittspektiottett. liksom hit— tills. kunna med stöd av den lagen och dess regel om iakttagande av god inkassosed meddela vissa ant-'isningar beträffande sädatta överenskomntelser om ersättning för aviserings— och bokföringskostnader som träffas i samband med atttorteringsplanernas upprättande.

Ersättning för inkastmknstntider

Prop. 1980/81 : 10 99

4.4.3 Ersiittttingsgi/la kostttuder

Enligt inkassokostnadskungi'irelsen utgär f.n. ersättning för krav sotn avses i 5 s* inkasst'tlagen och för atnorteringplan sotn har tillkommit i samrad med gäldenären vid fordringens ittkassering och sotn gäldenären har underrättats om skriftligen. En förtttsätttting är dock att ätgärden skäligen har varit päkallad för att ta till vara borgenärens rätt.

Kungörelsen ger inte rätt till ersättning för mindre kostnadskrävattde åtgärder som t. ex. enkla betalningspäminnelser (se prop. 1971 : ltlS s. lt). jfr s. 15). Nägot hinder torde dock inte föreligga mot att en borgenär genom avtal med gäldenären betingar sig ersättning även för enkla betalningspä- tninnelser. Att sända ut en sädan betalningspäminnelse faner inte ttnder inkassolagen. Datainspektionen har därför. i sin tillsynsverksamhet beträf- fande den lagen. inte ansett sig kttnna ingripa mot avtal rörande ersättning för betalningspäminnelser.

ldepartementspromemorian föresläs att en gäldenär sotn har underlatit att i rätt tid betala en skuld skall liksom ltittills vara skyldig att ersätta borgenäretts kostnader för krav avseende skulden. Ersättningsskyldigheten bör enligt prometnorian inte i första hand ta sikte pä kostnaderna för att upprätta och sända ut det enskilda kravbrevet. Reglerna om ersättning för kravkostttad bör i stället avse hela kravlörfarandet rörande en viss förfallen fordran. En förutsättning för ersättningsskyldigltet skall dock enligt prome- morian vara att ett skriftligt krav-'brev. som har utformats pä ett sädant sätt sotn anges i Så inkassolagen. ltar tillställts gäldenären.

Enligt prometnorian bör gäldenären vidare. i likhet med vad som gäller f. n.. vara skyldig att ersätta kostnad för upprättande av amortet'ingsplan avseende den äterstäende delen av en förfallen skttld. Fi:")rutsättningar för ersättnings.'kyldighet i denna del bör enligt promemorian vara att planen ltar upprättats i samräd med gäldettären. att planen är fullständig samt att den har satts tipp skriftligt och tillställts gäldenären.

Som ett skydd mot att en gäldenär i opäkallat stor omfattning drabbas av skyldighet att ersätta kostnad för krav och amorteringsplan bör enligt promemorian ställas tipp samma allmänna förutsättning för ersättningsskyl— digheten som gäller f. n. enligt inkassokt'>sttt:'tclskttngörelsen. nämligen att kostnaden skall ha varit skäligen påkallad för att ta tillvara borgenärens rätt.

Kostnaden för andra inkassoätgärt'ler än krav och upprättande av amorterittgsplan bör enligt promemorian inte föranleda ersättningsskyldig- het för gäldenären. l promemorian framhälls att detta i praktiken främst gäller kostnaden för enkla betalttingspäminnelser som inte utgör krav i inkassolagens mening.

Vid remissbehandlingen har de nu berörda förslagen i departementspro- memorian godtagits av detlstora flertalet remissinstanser. Bl.a. Svenska

bankföreningen. Svenska sparbanksft'ireningen. Sveriges föreningsbankers

Ersättning för inkassokostnader

Prop. l980/8lzl0 ltlt)

förbund. PKbanken oclt Kooperativa förbundet anser emellertid att gäldenären bör vara skyldig att utge ersättning ocksä för kostnaden för betalningspäminttelser efter förfallodagen. om detta ltar avtalats mellan parterna. Enligt Svenska" sparbanksföt'eningen bör en rätt att avtala om ersättning för paminnelsckostttader tillkomma i vart fall banker och andra kreditinrättningar som star ttnder bankinspektionens tillsyn.

Till stöd för att gäldenären böt' vara skyldig att ersätta även päminnelse- kostnader aberopas i remissyttrandena att dessa kostnader lika väl sotn kravkostnader äsamkas borgenären till följd av gäldenäretts betalningsdröjs— ntäl. Svenska sparbattksförenittgen anför vidare att betalningsdröjsmäl är tämligen vanliga inom bankväsendet och att bankerna därför tvingas att organisera rutiner och avdela personal för ltattdläggttittg av päminnelser och annan indrivning. littligt föreningen är det inte försvarligt att kostnaderna för detta skall belasta kt'editvet'ksamhcten som helhet och därmed även de skötsamma gäldenärerna. vilket enligt föreningen mäste bli följden om bankerna hindras frän att ta ut päminnelsekostnader direkt av den försumlige gäldenären. Kooperativa förbuttdet anser att promemorieförslaget medför risk för att borgenären vid betalnittgsdröjstttäl väljer att genast sända ut ett kravbrev enligt Sä inkassolagen. vilket skulle innebära att gäldenären drabbas av den högre kravkostnaden och dessutom fär en kortare tidsfrist än eljest innan rättsliga ätgärder vidtas mot honom.

Svenska inkassofi'irenittgett anser att det i den ttya lagett bör föreskrivas en generell skyldighet för gäldenären att ersätta även andra inkassokostnader ätt kostnad för krav och upprättande av amorteringsplan. F.nligt föreningen bör det överlämnas ät datainspektiottett att i dessa andra fall närmare reglera ersättningsskyldigltetens omfattning.

För egen del vill jag till en börjatt framhälla att förutsättttingartta för gäldettärens ersättningsskyldighet och t'lettnas omfattning mäste redan av kt'tnstitutionella skäl i allt väsentligt bestämmas genom en av riksdagett beslutad författning. Det katt alltsä inte kontma i fräga att ge regleringen en sådan utfornttting sotn har antytts i Svenska inkassoföreningetts remissytt- rattde. tttatt reglerna bör tas in i den föreslagna lagett.

.lag ansluter mig till de av retnissinstanscrna godtagtta förslagett ont att en gäldenär skall. uttder de förutsättningar som närmare har angetts i prontentorieförslaget. vara skyldig att utge ersättning för kostnaderna för krav rörande ctt fi'irfallen skuld och för upprättande av atnorteringsplan beträffande äterstäende del av en sädan skuld.

Vad härefter angär frägan om en gäldettärs skyldighet att ersätta kostnaden för enkla betalningspäminnelser sotn inte utgör krav i inkassola- gens mening katt ttätnttas att man vid den nuvarande processrättsliga regleringens tillkomst utgick från att kostnaden för sädana enklare ätgärder skulle bäras av borgenären själv (se prop. 197lzltt5 s. l9. jfr s. 15). Säväl datainspektionens utredning om inkassokostnaderna som vissa av de nyss redovisade remissyttrandena ger emellertid vid handen att detta längt ifrän

Ersättning för fll/(ll.$'.f()k oxtnuder

Prop. l980/8l:10 lttl

alltid ltar blivit fallet. [ betydattde utsträckning syttes sälunda bl. a. banker genom avtal nted gäldenärerna betinga sig ersättning även för pi'tminttelse— kostttader. Enligt mitt mening ltar under retttissbehattdlittgett förts fram övertygande skäl för att en sädan möjlighet att träffa avtal om ersättttittg för enkla betalttingspäntinnelser bör bibehällas. flärvid saknas anledning att begränsa dentta möjlighet till att gälla enbart för vissa borgenärer. t. ex. företag under bankinspektionens tillsyn.

En oinskränkt rätt att pä grund av avtal kräva ut ersättning för kostnaden för enkla betalningspäminnelset' kan emellertid leda till olägenheter. I den nya lagett bör därför dras upp vissa grättser för möjligheten att träffa sädana avtal.

För att gäldettärett skall vara skyldig att ersätta päntinnelsekostnader bör enligt min mening krävas att en överenskonttttelse om detta ltar träffats mellan parterna senast i samband med den aktuella skttldens uppkomst. dvs. senast i samband ttted att parterna ingär ett avtal om kredit c. d. Genom detta krav torde i praktiken vittttas en rimlig begränsning av de fall i vilka en skyldighet att ersätta päntittnelsekostttader kotnnter att aktualiseras. För att gäldenären på grund av en sädan överenskommelse skall vara skyldig att ersätta kostnaden för en enkel betalningspäminnelse bör vidare krävas att pätttinnelsett ltar skett skriftligt. Därjämte bör för ersättttittgsskyldigltetett ställas upp samma allntäntta ft'it'utst'ittning som ettligt det tidigare anft'irda skall gälla för skyldigheten att ersätta kostttad för krav och amorterittgsplatt. nätnligett att kostnaden i det enskilda fallet skäligett ltar varit päkallad föratt ta till vara borgenärens rätt.

Sammanfattnittgsvis innebär det som jag hittills ltar anfört att gäldenären skall vara skyldig att ersätta dels borgettäretts kostnad för skriftlig betalningspäminnelse rörande förfallen skuld. om avtal därom ltar träffats senast i samband ttted skuldetts uppkomst. dels borgenärens kostnad för krav och för upprättande av amorteringsplan pä indt'ivningsstadiet. Andra ätgärder som katt syfta till att förmä gäldenären att erlägga betalning för förfallen skuld bör inte förattleda ersättningsskyldigltet. Detta bör frantgä av en bestämmelse i den föreslagna lagett.

Vid rentissbeltandlittgett har nägra remissinstanser berört frägan om en gäldenärs skyldighet att ersätta bt'trgenären även vissa kostnader för verkställighet av dontstolsavgörande t'i'irande ett ftjtrdran. Bl. a. frän battkltäll ltar sälunda f("trordats att gäldettärctt genom den fi'ireslagna lagett skulle äläggas att ersätta även kostnad för ansökan om utmätning. I enlighet med vad jag ltar anfört i föregi'ient'le avsnitt bör skyldigheten att ersätta kostnader som avser exekutiva ätgärder emellertid inte regleras i förevarande sammanhang utatt inom ramen för utsökningsrättett. Det kan nämnas att frägan huruvida det i utsöknittgslagstiftttittgett bör föras in en möjlighet till ersättning för s. k. processkostttader i verkställigltetsmäl — t. ex. kostnader för anlitande av otttbud eller för eget arbete för upprättande av ansökan om uttnätnittg e. d. har behandlats utförligt i samband med remissen till

Ersättning för inkas's'okost/[rular

Prop. 1980/81:10 102

lagrädet den lo mars 1978 av förslaget till tttsökttittgsbalk. Nägon sädan tttöjligltet ltar inte föreslagits där (se s. 761 ff).

4.4.4 Ersätt:tingsbt'ln/rpen

F. n. finns i ittkassokostttadskttngörelsen bestämmelser om storleken av de belopp sotn gäldenären är skyldig att utge i kostttadsersättttittg. Genom ändringar i kungörelsen har beloppen genom fortlöpande höjningar anpas- sats till t'ädande kostnadsläge. Efter den settaste ltöjttittgett. som trädde i kraft den 1 juli 1979 (SFS 1979:331 ). tttgärersättning-sotn tidigare ttäntnts— med högst 55 kr. i fräga om krav och ttted högst 45 kr. i fraga om amorteringsplan. Ersättningen fär dock bestämmas till högre belopp. om det föreligger särskilda skäl.

Datainspektionen har i sitt utredning om inkassokostnadertta undersökt om ersättningsbeloppett katt regleras mera längsiktigt genom att attknytas till ett ittdex c. d. Sotn strax skall beröras ytterligare ltar inspektionen dock inte funnit detta vara en frantkomlig väg. Enligt inspektionen bör det nuvarande systemet med äterkommande justerittgar av beloppen behällas (se bilaga 2). Med detta sont utgångspunkt har i departetttentspromemtn'ian lagts fram förslag rörande en reglering av ersättttingsbeloppetts storlek.

Enligt promemorian bör man. liksont tttt. i författnittg meddela bestäm— melser om de belopp som en gäldenär normalt skall vara skyldig att utge i ersättning för olika indrivttingsätgärder. Med hänsyn till behovet av t'iterkt'nnmande justeringar av beloppen är det enligt promemorian emeller- tid inte rationellt att beloppen anges i den föreslagna lagett. Denna fi:"tresli'ts innehålla en bestämmelse om att ersättningen utgät' nted skäligt belopp enligt vad regeringen närmare föreskriver. I anslutning till den bestämmelsen bör regeringen enligt promemorian genom en särskild förordning fastställa de belopp som normalt skall ktttttta utgä som ersättning för olika ätgärder.

Vid remissbehattdlittgett har promenttjtrieförslaget godtagits av praktiskt taget alla remissinstanser. Rättegängsutredttingen anser emellertid att förslaget inte är invänchtingsfritt frän konstitutitntell synpunkt. Enligt utrcdnittgen har det sälunda kttappast täckning i regeringsforntens bestäm- ntelser om ttorntgivttittgsmaktett att läta regeringen bestämma om ersätt- ningsbeloppens storlek. Nägra remissinstanser ltar fört fram synpunkter som gäller ersättningsnivän. Vidare. har i ett remissyttrande berörts den närmare utformningen av bestämmelserna om ersättningsbeloppett.

Även enligt mitt mening bör den nya regleringen av en gäldenärs skyldighet att ersätta inkassokostnat'ler utformas sä att bcstätnntelser ges om ersättningens storlek. I likhet med de remissinstanser som särskilt har yttrat sig över datainspektionens utredning om en lättgsiktig reglering av ersätt- ningsbeloppen delar jag inspekticmens uppfattning att det inte är lämpligt att införa en automatiskt verkattdc reglering av ersättningsbeloppen genom att de anknyts till ett index e. d. Vid utformningen av de aktttella bestämmel—

Ersättning för inkussokastnnder

Prop. 1980/81110 los

serna bör ntatt alltsä utgä frän att beloppen vid äterkontmande tillfällen ändras med ltänsyn till kostnadsutvecklingen. Mot den bakgrunden framstär den tippbyggnad av författningsreglerita i denna del som ltar fört'trdats i departententspromemt'trian säsom ändamälsenlig. Jag föreslär därför att deti den nya lagen tas in en bestämmelse som innebär att ersättning för de olika ersättnittgsgilla indrivningsätgärderna utgär med skäligt belopp och att det får ankomma på regeringen att meddela närmare bestätnntelser om ersättttingsbeloppetts storlek. Dessa bestämmelser fär karaktären av sädana verkstäflighetsföreskrifter till lagen sotn avses i 8 kap. 13 s första stycket 1 regeringsformen och som alltsä får meddelas av regeringen.

Den sälunda föreslagna regleringen innebär. i förening ttted vad jag ltar föreslagit i föregaende avsnitt. att den nya lagen kommer att innehälla alla grtint'lläggande förutsättningar för gäldenärens skyldighet att ersätta borge- itäreiis indrivningskostnader. medatt regeringen avses meddela endast vissa bestämmelser om ersättningsbeloppens storlek för normala fall. Denna ordning ("överensstämmer nted den sotn gäller eitligt 17 sä kottsttmentkredit- lagen (1977:981. ändrad senast 1*)7S:Soo) och ut lagett (19781599) om avbetalitingskt't'p mellan näringsidkare m. fl. (ändrad senast 19781867) i fräga om en borgenärs rätt att intäl om handräckning för ätertagande av vara tillgt'tt'lot'äkna sig ersättning för eget arbete m. m. Med anledning av vad rättegängsutt'editiitgen ltar anfört i sitt remissyttrande katt framhällas att frågan om det gruttdlagsenliga i en författningsreglering av den här ifrågavarande innebt'irt'len ingäettde belystes i samband nted tillkomsten av de bäda sistnäntnt'la lagarna (se prop, 197of'77:123 s. 132 f. 183. 357— 359 oclt 372 samtprop. 1977578: 142 s 95. 159— 163 och lätt). Det saknas skäl att i detta santmanhattg frängä den ständpunkt som dä intogs av regeringen oelt riksdagen.

Tidigare har regeringen vid nägra tillfällen besltttat om ändringar av inkassokostnadskungörelsens bestämmelser om crsättniitgsbeloppens stor- lek efter framställningar från vissa större inkassoft'ftretag. litttan beslttteit fattats ltar fratnstälfnittgartia reittissbeltattdlats.

l sitt utredning om inkasst>kostnaderiia har datainspektiotten dragit tipp huvudlinjer för ett nytt system för att efter hand pröva och vid behov justera ersättningsbeloppett. Inspektionens förslag gär i huvudsak ut pä att inspektionen i samräd med statens pris— och kartellnämnd fortlöpande genomför kostnadsttndersökningar inom ittkassobranschen och pä grundval av dessa förelägger regeringen förslag till ändringar i ersättningsbeloppen. vilka bör beslutas efter remissbehandling av förslagen. lnspektionen anser att det är tillräckligt att mer iitgäende kostitadstindersökningar genomförs vartannat är. medait man ttttder mellantiden katt nöja sig med t'jversiktliga bedömningar av kostnadsläget.

Vid t'emissbehant'lliitgeit har de rentissinstanser som yttrat sig i frägan i allntättltet ställt sig positiva till tanken pä särskilda kostnadstmdersökitingar som hjälpittedel föratt bestämma ersättningsbeloppcns storlek. Riksskatte-

E tvättning för inkassok()stnader

Prop. 1980/81:10 104

verket ifrägasätter emellertid ont tttcr ittgaettdc undersökningar beltöver genomföras så ofta som vartannat är. Svenska inkassoft'fn'cnittgett — som ltar bildats efter det att ittspektiotten lade frattt sin utredning anser att man bör kunna behålla den hittills tillämpade ordningen nted fratttstälhtittgar fran inkassobranschen men kontbittera den tttcd större kostnadsunderst'jkttittgar som genomförs nted längre tidsitttervall. Föreningen framhäller att fram- ställningar ottt justeringar av ersättningsbelt'tppen i och ttted föreningens tillkomst kommer att ktttttta underbyggas pä ett ltelt annat sätt ätt tidigare.

Ocksä jag finner det värdefullt att man som ett underlag för framtida beslut om ersättningsbeloppens storlek använder sig av regelbundet återkommande kartläggningar av kostnaderna ittottt inkassobrattsclten. I princip synes det vara ändamålsenligt att denna kartläggning görs genom kostttadsundersök— ningar som datt-tittspektionen verkställer i samräd ttted statens pris- oclt kartellnämnd. Som riksskatteverket och Svenska ittkassoförettittgctt ltar varit inne pit torde emellertid sädana mer ittgacnde kostnadsundersökningar inte behöva genotttföras sä ofta sont dataittspektiottett har förordat i sin utredttittg. Undersi'iknittgarna bör verkställas efter regeringens uppdrag i 'arje särskilt fall. varvid det fär ankomttta pä regerittgett att efter satttrad med i första hattd datainspektiottett besluta om ttttdersökttittgarttas ttärtttarc uppläggnittg. l perioderna mellan kostttadsttndersökningarna bör eventuella framställningar frän inkassobranschens sida om ändringar av ersättningsbe- loppcn kutttta bedötttas pä grundval av den settast genmttft'ftrda undersök— nittgett jämte det material som katt presenteras i samband ttted en sädatt

fratttställttittg.

4.4.5 Avtal om ersättning för t'ttkttxmkustn(tt/er Nl. tn.

Datainspektionen föreslog i sitt utredning om inkassokostttadertta att en civilrättslig reglering av gäldettäretts skyldighet att utge ersättning för sädana kostnader skulle göras tvingande till gäldettäretts förmän. Enligt inspektio- nen borde sälunda avtalsvillkor som var (:)förnti'inligarc för gäldenären än författttittgsreglertta vara utatt verkan. [ sattttttanhattget framhöll inspektio- nen att det visserligen kuttde ifrågasättas om avtalsfriheten borde beskäras även för de fall där gäldenären är f("iretagare. Enligt inspektionen fanns det emellertid flera skäl sotn talade för detta. Sålunda borde bestämmelserna göras enkla att tillämpa för myndigheter och ettskilda. Ofta katt det vara svart att avgöra om en fysisk person är att hänft'tra till närittgsidkarkategorin eller inte. Vidare befinner sig sntäfi'it'etagare inte sällan i satttttta underläge mot borgenären som konsuntcnter. F.nligt ittspektiotten syntes inte heller behovet av avtalsfrihet vara stort.

l överensstätttmclsc nted vad datainspektionen sälunda förordat ltar i departentetttsprontenttiuiatts lagförslag tagits in en bestämmelse som innebär att avtal. som utvidgar gäldenärens skyldighet att utge ersätttting för

Ersättning för inkassokostnader

Prop. 1980/81:10 . i 105

inkassokostnad utöver vad som. följer av den föreslagna lagen. skall vara ogiltigt. I anslutning till detttta bestätttntclse framhälls i protttetnorian att det är vanligt att lagregler som inskränker avtalsfriheten pä det förmögenhets— rättsliga omrädet drabbar endast avtalsvillkor sont ltar tillkotntttit pä förhand. dvs. inttatt den ifrägavarande rättigheten eller skyldigltetett ltar aktualiserats i det konkreta fallet. Sedan detta ltar skett anses däremot den 'som skyddas av ett pä sädant sätt tvingande lagregel kutttta tttcd bindande verkan avstä frän sitt rätt eller ta pä sig en längre gaende skyldighet. Enligt promemorian skulle ett avtalsförbud av dettna begränsade ittttcbörd lätt kuntta bli ett slag i luftett pä f("trevarande omräde. Den föreslagna ogiltigltetsregeltt bör därför. enligt vad som fratttltälls i promemorian. i detta satttmanhang inte ges ttägott annan tolkning än att ttgiltighctspäföljdett kan göras gällande oavsett ttär avtalet har träffats och även om bctalttittg har erlagts enligt avtalet. lttom ramen för en process bör gäldenären emellertid enligt promemorian kunna pä ett bindattde sätt disponera över sitt skyldighet att ersätta inkassokostnad. (Rält'lenären bör saledes genom förliknittgsavtal eller processuellt medgivande kutttta ta pä sig en ersättttittgsskyldigltet som gär längre ätt den som följer av den föreslagna lagen. Mal rörande ersättning för ittkassokostttad bör ttted andra ord vara dispositiva. Som skall beröras i ett följande avsttitt föresläs etttellertid i protttentoriatt att dentta scttare princip inte skall upprättltällas fullt ut i ntäl som handläggs enligt lagsökttingslagett.

Vid retttissbehattdlittgett har det stora flertalet remissinstanser godtagit de förslag och uttalanden som promemorian innehäller beträffande den föreslagna lagetts tvingande natur. Som har nämnts redan i avsnitt 4.4.2 anser emellertid nägra rentissinstanser som företräder kreditgivare och inkassofö- retag att. om bestämmelserna i den ttya lagen i enlighet ttted vad som tidigare har föreslagits skall otttfatta även fall där gäldenären är ett företag. de inte bör göras tvingande för ättttinstone dessa fall. Enligt dessa retttissinstanser bör det säluttda räda frihet för ca borgettär att genom avtal betittga sig ersättning för olika kostttader som förattlcds av gäldettärctts betalnittgsdröjs- tttäl ttär gäldenären är ett företag. Som skäl för detta anförs att skyddsin— tresset i dessa fall inte är tillräckligt starkt för att motivera ett avtalsförbud. Företagens behov av skydd tttot oskäliga avtalsvillkor om ersättningsskyl- dighct katt ettligt dessa rentissittstattser anses tlllgOdOSclt genom ntt'ftjligheten att åberopa den förntögenl_tctsrättsliga generalklattsttlett i 36 .: lagett (1915218) om avtal och andra rättshandlingar pä förtttögettltetsrättetts omräde (avtalslagen).

För egen del vill jag till en början fratnhalla att de möjligheter som f. tt. fintts att göra gällande avtal om en sädatt ersättttittgsskyldigltet för inkassokostnader sont gär utöver vad som följer av gällande författningsreg- lcr i praktiken frantstär som tätttligett begränsade. Som tidigare nämnts ltar dataittspektiottctt ansett det vara oförenligt med god ittkassosed att en

borgenär i samband ttted uppgörelse utont rätta betittgar sig högre ersättning

Ersättning för inkassokost/lader

Prop. BSO/81:10 tuo

för inkassru'ttgärder i ittkassolagctts tttettittg ätt vad en domstol katt väntas döma ut vid tillämpning av inkassokt.)stnadskungt'trelseu. ()clt ttär ett attsprak pä ersättning för ittkassokostttad i enlighet ttted den nuvarande processrätts- liga regleringen skall behandlas säsottt ett attsprak pä ersättttittg för rättegättgskostttad. aligger det domstolen att självmant pröva ersättningens storlek och omfattning i ("övrigt ittottt ramen för det kt'tstnadsyrkattde som fratttställs av borgeni'trcn. Domstolen är härvid inte bttttdett av ett medgi- vande frän gäldettäretts sida att utge viss ersättttittg och itttc heller av ett avtal rörande ersättttingsskyldigheten sont katt lta träffats pä förhand.

Ett väsentligt s_vfte även med den nya lagen om ersättning för inkasso- kostnader är. som tidigare har fratttltällits. att skydda gäldenären mot överdrivna kostnat'lsanspräk och mot en alltför betungande erst'ittningsskyl- dighet i övrigt. Det är därför klart att principen bör vara att borgenären inte skall ktttttta genom avtal betinga sig ytterligare ersättning för ätgärder som omfattas av lagett. När gäldettärctt är ett företag framträder visserligctt det ttätttttda skyddsintresset inte alltid ttted samma styrka. Åtskilliga näringsid- kare itttar emellertid en ställning som liknar den enskilde konsumentens. ()fta torde det vara just dentta kategori av näringsidkare soiit drabbas av skyldigheten att ersätta indrivningskostnader.

Som dataittspektionen ltar frantltällit i sitt utredning om ittkttsst.>kostttzttlet'- na katt det inte heller attses föreligga nägot större behov av en frihet att träffa avtal om ersättning för sädana kostnader utöver vad sotn följer av den nya lagen. De bestämmelser som jag i det förcgäende ltar förordat och den närmare reglering av ersättttittgsbeloppetts storlek sotn rcgerittgett avses utfärda syftar till att ge borgenärett skälig ersättning förde tätttligett enkla ätgärder sont det här är fräga om. lirsättningsfrägans art och betydelse är inte sädatt att ontsättningens och det ekonomiska livets intressen pä ttagot sittt kräver att f(ftrctagen ges frihet att själva reglera sitta tttellanhavanden i detttta del.

Pä grttttd av det nu attförda och med hänsyn även till vad datainspektiottett i sin utrcdttittg ltar anfört om behovet av en enkel reglering finner jag ("övervägande skäl tala för den ständpunkt som [tar intagits av inspektionen och i departcmentspromemorian. Den fi'u'cslagtta lagett bör alltsä generellt vara tvingande till gäldenärens förmän. lcttligltet ttted detta bör i lagett tas in en bestätttmelsc om att avtalsvillkor som utvidgar gäldettäretts skyldighet att tttge ersättning för kostnader utöver vad sotn följer av lagett skall vara ogiltigt.

Som ltar framhällits i depat'tementsprontemttrian bör gäldenären ittottt ramett för en process ktttttta pä ett bindande sätt disponera över sitt ersättaingsskyldighet genom ett processuellt medgivande eller ett förlik- ttittgsavtal. F.nligt tttitt mening är det da ft"")ljdriktigt att gäldenären även i övrigt katt. sedan frägan om betalning av inkassokostnader ltar aktualiserats. ttted bittdattdc verkan ta pä sig skyldigheter som gär längre ätt enligt den föreslagna lagett. Det innebär att jag inte delar uppfattningen i departe-

Ersättning för inkassokostnader

Prop. l980/8l:10 . ttt7

tttetttsprt'tmemorian att ogiltigltetspäft'tljden hör ktttttta göras gällande i detta fall. Jag vill dock understryka att borgenären inte utatt vidare katt kräva gäldenären pä större ersättning ätt sottt medges enligt lagen oclt till den anslutande föreskrifter. För att borgenären skall lta ett vit'lstri'tcktare rätt mäste han lta träffat en ('.'tverettskonttttelse om detta nted gäldenären efter det att inkassoätgärder började vidtas. Enbart den otttstättdigltetett att gäldenä- rett erlägger betalning i enlighet ttted ett anspräk pä kostttadsersättnittg som går utöver vad som medges enligt lagett bör inte leda till att en sädan övcrettskotttntelse anses lta träffats.

Mäl rörattdc ersättning för inkassokostttader c. d. som avses i den föreslagtta lagen bör alltsä i prittcip beltattdlas ettligt de processuella reglerna för dispositiva tttäl. I enlighet ttted vad som vidare ltar f(ftreslagits i protttetttoriatt bör vissa avsteg fran detta emellertid göras ttär det gäller tttäl som handläggs enligt lagsökningslagen. Hitltörattde frägor tar jag upp i ett

följande avsnitt.

4.4.6 Rätt/(t på ersättning för ittkttswkmlttttder HI. HI.

Den civilrättsliga reglering av skyldigheten att ersätta inkassokostnader sont ltar förordats i det ft'tregäende ittttebär att gäldettärett. om inte attttat föreskrivs. skall betala ränta pä kostttadsersättningett ettligt bestänttttelserna i räntelagen (19752635). De bestäntntelser som dä blir aktuella är få första och tredje styckena satttt 6 k.

I fråga om skyldigltetett att utge ränta på fordran vars förlallodag inte är bestämd i förväg gäller enligt 4 5 första stycket följattde. i den tttätt ittte attttat är avtalat eller utfäst eller särskilt föreskrivet (jfr l s*). Försittes betalnings- tiden. dvs. betalar inte gäldettärett när borgenären fordrar det. utgär ränta pä fordringen frän den dag som ittfaller en manad efter det att borgenären Itat' avsänt räkning eller pä annat sätt fordrat betalning av bestätttt belopp ttted angivande av att uttderlätettltet att betala medför skyldigltet att utge rättta. Gäldenären är dock inte skyldig att erlägga ränta förtid ittttatt räkttittgctt eller anspräket har kommit ltottottt tillhanda. Enligt 4.3 tredje stycket utgär. oavsett de redtitvisade bestäntmelserna. rättta pä förfallen fordran senast frän dagen för delgivning av ansökan om lagsökning eller betalttingsft'ireläggattde eller av stätttningi mäl ont utgivattde av betalttittg. ] fräga ont rätttatts storlek gäller enligt 6.5 räntelagen — likaledes i den män inte annat är avtalat eller utfäst eller särskilt föt'L'SkerCl — att rätttatt beräkttas ettligt det vid varje tid gällande riksbattksdiskontot med tillägg av fyra pt't_tcetttettlteter.

l sitt utredning om inkassokostttadertta ft'atttltöll datainspektionen att en tillätttpttittg av rätttelagett i fräga ottt skyldigheten att utge ränta pä ett ersättttittg för ittkassokostttad av civilrättslig ttatur ittttebär att skilda tidputtkter kommer att gälla som utgättgsputtkt för rättteheräknittgett avseende huvudfordrittgett resp. inkassokostnaden. Detta skulle ettligt

Ersättning för inkaswkus"/nader

Prop. 1980/81 :10 108

inspektionen komplicera beräkningarna och leda till (.ttttfattande ändringar i mänga kravbrevsfortttulär. Littligt ittspektiottett uppgär rätttatt pä kostnads— ersättningen i det enskilda fallet sällan till nägot belopp av betydelse. Mot denna bakgruttd föreslog inspektionen att det skulle föreskrivas att ränta inte utgär pä ersättning för inkassokostnad. Bt'trgenärens t't'ittteförlust borde enligt inspektionen kunna beaktas vid fastställandet av själva ersättningsbe- loppett.

l departetttetttsprotttemorian anförs att de skäl som dataittspektionett ltar äberopat till stöd för sitt förslag syttes bärattde. ] protttetttorian föresli'ts därför att det i den nya lagen om ersättnittg för ittkassokostnadet' ft'tt'eskrivs att rättta inte utgär pä sädan ersättning.

Vid retttissbehattdlingen ltar praktiskt taget samtliga remissinstanser lätttnat förslaget utatt erinran. Kt'toperativa förbuttdet frattthäller etttellertid att förslaget. ttted hänsyn till den ft'ftreslagtta lagetts tvittgattde ttatur. katt leda till onödiga sväriglteter i kotttoförhällandett. Förbundet syftar pä det förltällandet att parterna i ett kottttjtft'trlti'tllande. om förslaget genomförs. inte skttlle kutttta föra upp ett ittkassokostttad pä gäldenärens kottto och där rätttebelasta den pä satttttta sätt som gäller för övriga debiterittgar pä kotttot.

Enligt tttin mening är de skäl som ltar äberopats till stöd för protttemorie- förslaget i och för sig beaktansvärda. Man katt ä andra sidan inte bortse frän att förslaget katt tttedft'ftra sädatta onödiga sväriglteter sont Kooperativa förbundet har päpekat i sitt remissyttrande och som katt undgäs om räntelagen fär tillämpas. .lag ltar svärt att tro att ett tillätttpttittg av räntelagen i detta santtttanltang behöver skapa ttätttnvärda problettt. Rätttelagett är dispositiv och katt alltsa frängas genom avtal. l den män parterna inte ltar träffat särskilt avtal om räntan pä kostttadsersättnittg torde tilläntpnittgett av räntelagen i mänga fall ittttebära att ttägon ränta pa kostttadsersättttingen inte börjar löpa innan gäldenären betalar ersättttittgett. 1 andra fall torde det ofta kuttna förutsättas att borgenären ltelt avstär frän att göra gällattde ränteanspräk av den obetydliga ontfattttittg som det här blir fräga om eller att ltatt bestätttttter sitt anspräk sä att det blir ettkelt att beräkna utatt att det för den skull överstiger den rättta som borgenären enligt lagett är berättigad till.

Med ltättsytt till det anförda fitttter jag det inte tillräckligt tttotiverat att föreskriva ttägot uttdatttag frän tillämpningen av räntelagen ttär det gäller ränta på fordratt pä ersättning för ittkassokostttader. Jag fiftreslät' alltsä inte att nägon särskild bestämmelse om rättta pä sädatt fordratt tas upp i den

f("treslagtta lagett.

4.4. 7 Den processuella ln'ltztttd/ittgwt (ll' anspräk på itt/(ttvsokuvlttudcr

De förslag som jag ltar lagt fram i det fi'tregäettde ittttebär att ett fordran pä ersättning för ittkassokostttader skall behandlas som ett vanligt civilrättsligt

Ersättning för inkasso/(ost!lader

Prop. 1980/81 : 10 ltt?)

anspräk och inte sotn ett anspräk pä ersättning för rättegängskostttad satttt att tttäl rörande ersättning för sädana kostttader är av dispositiv ttatur. .lag ämttar i detta avsttitt gä närmare in pä beltattdlingett vid domstol av anspräk pä kostttadsersättttittg.

Om ett sädant anspräk framställs i ratt/ig rr'ittegäng. mäste detta i regel ske genom ansökan om stätttttittg (se 13 kap. lä rättcgi'tngsbalken). Väcker borgenären samtidigt talan om ltuvudlordringen. vilket torde bli det vattligaste. katt de bäda attspräken naturligtvis attges i santnta stämningsan- sökan. Praktiskt taget undatttagslöst torde de ocksä böra ltattdläggas i en och samma rättegäng enligt reglerttai 14 kap. rättegz'tngsbalken. llar borgenären först väckt talan endast om ltttvttdfordringen och vill han senare i samma rättegäng ocksä yrka ersättttittg för för inkassokostnad c. d.. fitttts tttöjligltet till detta enligt bestättttttelsertta ont ättdrittg av talatt i 13 kap. 3 och 4 åå rättegängsbalken. Yrkandet fär etttellertid dä inte framställas först i högre rätt.

När det gäller avgörandet i sak följer det av mälets dispositiva karaktär att domstolen principiellt är bttttden av parternas processhandlingar. Medger gäldenären ett yrkattde om en tttet' (_)mfattande kostttadsersätttting ätt som följer av den föreslagna lagett. skall domstolen sälunda döma i ettligltet ttted tttedgivattdct. Att mälet är dispositivt innebär vidare att tredskodottt katt meddelas tttot gäldenären. ont ltatt uteblir frän förhandling eller— ttär ntälet handläggs enligt lagen ( 19743) om rättegättgett i tvistetttäl om mindre värden ('Smt'tntälslagen) — ont ltatt underläter att yttra sig över käromälet. Om det begärs tredskodottt tttot gäldenären. ltar dontstolcn dock enligt 44 kap. 8 s” andra stycket rt'ittegängsbalken en viss officialprt'tvttittgsplikt. Detttta bestäm— tttelse innebär att ett borgenärs anspräk pa ersättttittg för inkassokostnader skall ogillas i den män de grunder som borgenären ltar äberopat till stöd för anspräket inte innefattar laga skäl för detta eller attspräket attttars är uppenbart ogrundat.

Att domstolens rätt och plikt till officialprt'tvning av attspräk pä ersättning för inkassokostnad säluttda i viss utsträckning bortfaller i vanlig rättegättg fär enligt tttitt mening godtas. Som har framltt'illits i pl"0|1'lCltt(')r1un torde det dock tttcra sällan kotttttta att inträffa att en gäldettär uttryckligen medger ett eventuellt yrkande om ett allför hög ersättning eller ft'trlikttingsvägen godtar ett sädattt attspräk utatt att pä attttat sätt fä kotttpensatiott för detta. Särskilt om det finns anledning anta att gäldenären har bristfälliga kunskaper beträffande de regler som gäller om hans skyldighet att ersätta inkassokost- nader bör. som Stockholms tingsrätt ltar betottat i sitt retttissyttrattde. en lämplig tttateriell processledning frän dotttstoletts sida kutttta motverka obilliga resultat. Ottt det blir aktuellt att ttteddela tredskodottt tttot gäldenären. ger den nyss ttätttttda bestätttntelsett i 4-1 kap. 8 å andra stycket rättegängsbalken gäldenären ett skydd tttot obefogade attspräk.

Som tidigare har nämnts (se avsnitt 4.4.1) ltar det ansetts att den

Ersättning för ink assokrtstnader

Prop. 1980/81:10 tttt

nuvarande regleringen av crsättttittg för ittkassokostttad sotn en ersättning för rättegängskostttad ltar dett fördelen att borgenären. när ltatt ltar väckt talan vid domstol för att fa ut huvudtk'trdt'ingen. mäste framställa sitt yrkattde om kostttadsersättttittg ittttatt handli'tggningen av det malet avslutas. Borgenären katt alltsä inte i en senare rättegäng framställa attspräket pä ersättning för inkassokostnad. Med den föreslagna regleringen av anspräk pä inkassokost- nadsersättning som ett civilrättsligt attspräk kommer ttägot rättsligt ltittder för ett sädant förfarande inte längre att föreligga. Som ltar fratttltällits i departemetttspromentorian ft'antstär emellertid f(ftrlarattdet som sä oprak- tiskt att det knappast behöver befaras bli vanligt. En ätcrhallattde faktor torde ocksä bli att borgenären löper stor risk att enligt 18 kap. 35 första stycket rättegängsbalkett fä svara för bäde sitta egtta och gäldettäretts rättegängskostttader i ett senare mäl om ersättning för inkassokostnad 0. (1.

Det är f. n. mycket vanligt att anspräk pä ersättning för ittkassokostttad handläggs i mål om lagsökning eller betalttittg.v_/'(.7't'elit'ggttttde. dvs. i den sunttttariska process som regleras i lagsökningslagen. I allmänhet är situatiottett dä sädan att attspräket skall beltattdlas som ett ptocesskostnads- anspräk. Betalttittgsföreläggattde katt dock redatt i dag ettligt 18.5 lagsök- ningslagen utverkas för fordratt pä ersättttittg för ittkassokostttad även i de fall där anspråket inte kan behandlas som ett processkostnadsansprå'tk. dvs. i praktiken dä gäldenären utatt ft'tregäettde dontstolsförfarande ltar betalt huvudfordringen men vägrat att betala ittkassokostnaden. lagsökning för inkassokostnad katt däremot f. n. ske ettdast om situationen är sädan att ersättningsanspräket skall behandlas som ett processkostnadsanspräk eller om attspräket grundar sig pä ett skriftligt ft'trdringsbevis (se 1 & lagsöknings- lagen). Det senare torde inte vara vanligt.

1 departemetttspromemorian frantltälls att ett civilrättslig reglering av rätten till ersättnittg för inkassokostnad. ttted den nuvarande utfortttttittgett av lagsökttittgsittstittttet. medför att lagsökttittg för fordran pä sädatt ersättning katt ske endast om fordringen grttttdar sig pa skriftligt fordrings- bcvis. Detta skulle emellertid enligt prt'ttttentorian vara ett alltför opraktisk ordning. eftersottt en fordran pä ersättning för ittkassokostttad fratttstär som ett biltattg till ltuvudfordrittgett. Bäda fordringarna bör därför enligt j_tt'ometttorian kutttta behandlas av domstol i ett och samma förfarande. Av den attledttittgett föresläs i promemorian till en början att lagst'tkningslagen ändras sä att det blir tttöjligt att lagsöka en gäldettär för fordratt pä ersättning för ittkassokostttad. även om detttta fordratt inte gruttdar sig pä skriftligt fordringsbevis. Enligt protttemoricförslaget bör detta entcllertid gälla endast om lagsiftkningen sker i samband ttted lagsiftkning för den fordran som ltar föranlett kostttadcn.

1 det tttt berörda hänseendet ltar prontetttorieförslaget inte mött nägon erinran fran retttissittstattset'nas sida. Även jag attslutcr mig till Körslaget. Det bör atttttärkas att det inte ittttebär nägon utvidgning av de nuvarande

Ersättning för ink(t.v.t'okostnader

Prop. 1980/81: 10 111

ntt'ftjligheterna att genom lagsökttittg kräva ut ersättning för inkassokost- ttad.

Den föreslagna civilrättsliga regleringett av rätten till ersättning för inkassokostnad c. d. medför vidare att ett sädattt ersättnittgsattspräk även i - den summariska processen alltid kotttttter att behandlas pä det sätt som gäller för själva saken i processen och inte ettligt de regler som gäller för j_trocesskostnadertta. Med den nuvarande utformningen av processen ettligt lagsökningslagett skulle detta innebära att domstolens officialprövning av de ifrägavarande ersättttingsattspräkett föll bort.

ldepartentetttsprometttorian fratttltälls att ett sädatt följd av den civilrätts- liga regleringen ltar större betydelse i den sttttttttariska processett ätt i vanlig rättegäng. 1 promemorian syftas härvid pä det fallet att gäldcttärett i processen f(ftrhäller sig passiv. Som tidigare ltar framgätt har gäldenären dä i vanlig rättegättg ett skydd tttot obefogade anspräk genom reglerna om tredskodont. ldett sutttntariska processen är det emellertid en grundläggande princip att domstolen inte ittottt ratttett för detta förfarande gär in pa ett ntatcriell prövning av det anspräk som utgör själva saken i processen. (_)ttt gäldenären sälunda i den sunttttariska processett förltäller sig passiv. vilket inte är ovanligt. följer av det nu sagda att utslag eller bevis i princip skall utfärdas i enlighet med borgettäretts ansökan.

Ft'atttför allt det fi'trhällandet att gäldettärens blotta passivitet sälunda leder till utslag eller bevis i ettligltet ttted en attsökatt ont lagst'tkning eller betalttittgsföreläggattde tttedför enligt |.tromentorian en risk för att gäldenä— ren i den suttttttariska processen belastas ttted alltför stor ersättningsskyldig— het avseende ittkassokostnader. 1 protttentoriatt framhälls att detta visserli— gen gäller redan i dag i den män lagsökttittg eller betalttingsföreläggattde sker enbart för fordran pä ittkassokostttadsersätttting. Med den föreslagna civilrättsliga regleringen av detttta ersättning skulle detsamma emellertid kotttttta att gälla över hela linjen. vilket ettligt prontemoriatt fratttstär som en ofördelaktig följd av de nya reglertta.

F.nligt prt'ttttetttt.tt'i:ttt bör ntatt tttot den attgivtta bakgrunden föra in bestå'tntmclscr i lagsökttittgslagett som ger domstolen i princip samma möjlighet som f.n. att självtttattt pröva ett anspräk pä ersättttittg för ittkassokostttad som framställs i sumntarisk process. b'löjliglteten till detttta officialprt'tvning bör härvid ettligt promemorian självfallet omfatta även de fall där ett sädan prövning inte sker nu. dvs. ttär lagsökning eller betalnittgsföreläggattde äger rum enbart för fordran pä inkassokt'tstnadset'- sättning.

Den säluttda äsyftade ordningen bör enligt promemorian lämpligen åstadkommas genom att ittstitutett lagsöknittg och betalningsföt'eläggande hälls öppna endast för anspräk pä ersättttittg för inkassokostnad som katt utgä ettligt den ttya lagett om sädan ersättning och de verkställigltetsföreskrifter som regerittgett meddelar i attslutttittg till den lagett. Anspräk pä inkasso- kostnadsersätttting som gär därutöver bör enligt protttetttorian avvisas av

Ersättning för itt/tttsmkostnader

Prop. 1980/81:10 |12

domstolen redan i ett inledande skede av förfarandet för lagsökning eller betalttittgsföreläggande.

Pä grund av dessa överväganden föresläs i departctttetttsprotttetttoriatt att lagsökningslagen ändras sä. att en ansökan om lagsökttittg eller betalnings- föreli'tggande avseende ersättttittg för ittkassokostttad skall i den delen självtttant avvisas av domstolen i den tttätt den fordrade ersättningen ("överstiger vad som katt utgä enligt den ttya lagett om ersättttittg för ittkassokostttad.

Vid rentissbeltandlingen ltar dessa överväganden och förslag i departe- tnentsprotttemoriatt i princip godtagits av sattttliga remissinstanser. Rätte- gängsutrednittgen tillstyrker att protttentorieförslaget genontförs som en lösning av provisorisk karaktär.

Ocksä jag anser att dontstolartta även i fortsättningen bör lta rätt och plikt att självmant pröva anspräk pä ersättttittg för ittkassokostttad c. d. ittottt ratttett för lagsöknittgs- och betalttittgsföreläggattdeprocessen. Den reglering för att ästadkotttttta en sädan ordning som ltar föreslagits i departetttents- prometttorian ittttefattar enligt tttitt tttettittg en praktisk lösning. Den fordrar inte nägra större ingrepp i lagst'tkningslagcn och rubbar inte heller nämnvärt de nuvarande förutsättttingartta för den suttttttariska processen. Ft'ägan om dennas framtida utformning övervägs f. n. av rättegängsutredttittgett. Som utredningen ltar fratttltällit katt det bli aktuellt att pä nytt ta upp de här diskuterade frägortta ttär utredningen har presenterat sina förslag. 1 avvaktan pä detta bör den i promemorian föreslagna lösningen gettotttföras i sak.

Som tidigare ltar framgätt innebär ntitt förslag till en tty lag om ersättning för inkassokostnader m. m.. i likhet med prttmemttrieft'trslagct. att gäldenä- ren skall vara skyldig att utge ersättning för krav ettdast om han ltar tillställts ett skriftligt krav som ltar utformats pä det sätt som anges i 5 & ittkassolagett. Vidare skall gäldenären vara skyldig att utge ersättttittg för atttot'teringsplan endast om den uppfyller vissa närntare angivna anspräk.

l departementsprotttetttoriatt fratttltälls att det av dataittspcktiottetts utredning om inkassokostttadertta framgär att domstolspraxis f. n. är växlande när det gäller säväl kontrollen'av att kravbrev har avsättts som kontrollen av att kravbrcvet uppfyller de anspräk som ställs enligt Sä ittkassolagett. för att tttatt skall fä ett ordentligt genomslag av bestämmel- serna ottt kravbrevs utformning bör ettligt prontentt'trian reglcrtta för detttta kontroll skärpas. 1 protttetttoriatt föresläs därför att ett borgenär som attsökcr om lagsökttittg eller betalttittgsföreläggattde för att fä ut ersättning för kravkostnad skall vara skyldig att i samband ttted '.msökningen ge in avskrift av det kravbrev som ltatt gruttdar sitt ersättttingsanspräk pä. Motsvarande föresläs gälla. om borgettärett gör attspräk pä ersättttittg för upprättande av en amorteringsplan.

Pä den nu berörda punkten har protttemorieförslaget vid remissbehand- littgett fätt ett blandat tttottagattde. Det godtas visserligctt av flertalet remissinstanser tttatt närmare kommentarer. Vidare tillstyrks förslaget av

Ersättning för inkussnkostnader

Prop. l980/81:10 113

datainspektionen. som framhäller att det skulle tttedföra en effektiv tillsyn över praxis i fräga om utformningen av bl. a. kravbrev.

Förslaget avstyrks dock av flera remissinstanser. bl. a. av de domstolar som ltar yttrat sig. Dessa betonar framför allt att förslaget skulle leda till en inte godtagbar ökning av dontstolarttas arbetsbörda. Stockholms tittgsrätt uppger att tttatt där uttder är 1978 behandlade ungefär 4000th tttäl om lagsökning och betalttingsföreläggandc och att det i nästan alla dessa mäl förekom anspräk pä ersättning för inkassokostnad. Tingsrätten framhåller att protttemorieförslaget vid ett sädan frekvens skulle ittttebära hantering ittotn domstolen av ytterligare omkring 80 Utlt) handlingar. Vidare beräknar tingsrätten att man för delgivningsändamäl skulle nödgas framställa omkring 5 flöt) kopior av kravbrev. Granskningen av kravbrevctt och annat merarbete skulle enligt tingsrättens mening ofrättkotttligen leda till beltov av personal- förstärkttingar. [ satttntattltattget uppger tingsrätten vidare att ntan numerai princip kräver att borgenären i lagsöknings- och betalttingsföreläggandemä- len uppger datum för inkassoätgärden och framställer pästäendc om att kravbrev ltar utformats ettligt 5 inkassolagen. Finns det attledtting anta att så inte varit fallet. begär tingsrätten in kopia av kravbrevct för granskning. Enligt tingsrättens mening bör domstolarna inte äläggas ttägon kontrollskyl- dighet som gär längre än sä. Satttma ständpunkt intas av bl. a. ltovrätten över Skåne och Blekinge. Svenska battkförettittgett. Sveriges föreningsbankcrs förbuttd. PKbanken och Svenska inkassotl'trettingcn.

Även rättegångsutredningen understryker att den i promemorian föreslag- na skyldigheten att ge in avskrift av kravbrev rn. m. skulle bli arbetskrävande för både domstolar och parter. Enligt utredningen bör den inskränkas till att gälla endast i fall där indrivningsätgärden har vidtagits av någon som inte står under datainspektionens tillsyn enligt inkassolagen. dock inte om det är fråga om en battk eller en advokat. En annan remissinstans förordar att den föreslagna skyldigheten inte skall gälla för inkassoföretag som har fått tillstånd till inkassoverksamhet enligt inkassolagen.

För egen del vill jag understryka att det är angeläget att bl. a. inkassolagens regler om krav noggrant iakttas och att en gäldenär inte åläggs skyldighet att utge ersättning för ovederhäftiga eller på annat sätt bristfälliga indrivningsätgärder. Promemorians förslag om skyldighet att i samband med ansökan om lagsökning eller betalningsft'treläggande ge in avskrift av kravbrev m. m. skulle givetvis innebära en effektivare kontroll ätt den som rimligen kan åstadkommas inom ramen för datainspektionens tillsynsverk- samhet enligt inkassolagen. Det kan dock antas att det stora flertalet kravbrev och atttorteringsplaner som föranleder ersättninganspräk skulle kontnta att uppfylla de fordringar som den här aktuella lagstiftningen ställer. I allmänhet torde indrivningsåtgärderna ha vidtagits av inkassoföretag. banker. advokater eller andra som är yrkesmässigt verksamma inom området. Även i övrigt torde indrivningsätgärderna ofta i efterltand ha kontrollerats av ett yrkesmässigt verksamt ombud innan ansökan om

8 Riksdagen [980119]. ] sam/. Nr I!)

Ersättning för inkassokostnader

Prop. l980/8l1l0 [14

lagsökning eller betalningsföreläggande görs. Mot den bakgrunden är det enligt mitt mening inte försvarligt att införa ett så resurskrävande kontroll- system som promemorieförslagct innebär. I och för sig vore det naturligtvis möjligt att införa ett sädant mera begränsat system som har föresprz'ikats i ett par remissyttranden. Att genom lagstiftning älägga endast vissa sökande i process särskilda förpliktelser för att de skall få sin talan upptagen till prövning är dock enligt min mening inte nagon tillfredsställande lösning.

Sammanfattningsvis anser jag att man inte hör införa en skyldighet för borgenären att automatiskt ge in avskrift av kravbrev m. m. tillsammans med en ansökan om lagsökning eller betalningsföreläggande. Det far emellertid anses lämpligt att domstolarna i allmänhet iakttar en praxis som motsvarar den som har beskrivits i Stockholms tingsrätts remissyttrande. Avskrift av kravbrev e. d. som ligger till grund för ett ersättningsanspräk bör sålunda fordras in. när omständigheterna ger anledning till antagande att indrivnings- atgärden inte har utförts på sådant sätt att borgcni'iren enligt de tidigare föreslagna reglerna är berättigad till kostnadsersättning.

Näranspräk pä ersättning för inkassokostnader m. m. ienlighet med de nu diskuterade förslagen skall behandlas enligt de regler som gäller för själva saken i processen måste man beakta den situationen att gäldenären framställer invändning mot anspråket.

Såvitt gäller mäl om hetalningsföreläggande behövs i detta hänseende inte några nya bestämmelser. Om gäldenären på rätt sätt och inom rätt tid bestrider en ansökan om betalningsföreläggande för kostnadsersättning. följer det av 26.5 lagsökningslagen att målet i den delen skall som tvistigt hänskjutas till rättegäng. om borgenären begär det.

Beträffande lagsökningsmäl föresläs i departcmentspromemorian att målet. om gäldenären gör en invändning mot ett anspräk pä ersättning för inkassokostnad e. d.. skall behandlas enligt de regler sotn f. n. finns i lla" andra stycket lagsökningslagen. Detta innebär att attspräket skall som tvistigt hänskjutas till rättegäng. om gäldenären har visat sannolika skäl för invändningen eller lmt'genärens rätt till betalning annars far anses oklar. Förslaget har i allmänhet godtagits av remissinstanserna och bör enligt min mening följas.

Den föreslagna nytt regleringen av gäldenärers skyldighet att utge ersättning för inkassokostnader m.m. föranleder vissa följda-llt[rl-HKH!" i annan lagstiftning. I enlighet med vad som har föreslagits i departements- promemorian bör sälunda lS kap. 8 s andra stycket rättegängsbalken upphävas. Vidare bör vissa jttstcringar göras i smämälslagen. .lag äterkom- mer till detta i specialmotiveringen.

Ersättning för inkassokostnnder

Prop. 1980/81:10 115

4.4.8 Behandlingen av inkasso/costaader vid återtagande utt/igt konstnnent- kredit/ngen ()(/I lagen om avltetalningsköp nte/lan näringsidkare m. fl.

Datainspektionen tog i sin utredning om inkassokostnaderna upp frågan om behandlingen av fordringar på ersättning för sådana kostnader i samband med återtagande av vara enligt konsttmentkreditlagen och lagen om avbetalningsköp mellan näringsidkare m. 11.

När en vara som har sålts på kredit med förbehåll om återtaganderätt för kreditgivaren (säljaren) återtas. skall en avräkning göras mellan parterna. Regler om avräkningen finns fr. o. m. den 1 juli 1979 i 17 s' konsumentkre- ditlagen och *)ä lagen om twbett'tlningskifn) mellan näringsidkare m. H. De tillämpas säväl vid handräckning för återtagande som vid verkställighet av dom varigenom köparen har förpliktats att lämna tillbaka varan. Reglerna skall också tillämpas om återtagandet sker utan medverkan av myndighet (prop. 1976/771123 s. 181 och prop. 1977i781142 s. 94").

Enligt avräkningsreglermt i båda lagarna gäller att köparen tillgodoräknas varans värde vid återtagandet. Kreditgivaren (säljaren) får tillgodoräkna sig. förutom sin återstående fordran pä grttnd av köpet m. ut. enligt särskilda regler. vissa angivna kostnader för återtagandet. Detta gäller cxekutionsav- gift. skälig kostnad för transport av varan och utgift för inställelse vid förrättning för återtagande. [ mål om handräckning för återtagande får kreditgivaren (säljaren) tillgodoräkna sig även skälig ersättning för eget arbete med anledning av målet samt arvode till ombud eller biträde.

l datainspektionens utredning förordades att 17 & konsumentkrcditlagen och 9.5 lagen om avbetalningsköp mellan näringsidkare m. fl. skulle kompletteras så att kreditgivaren (säljaren) vid avräkningen fick tillgodo- räkna sig även ersättning för krav oeh eventuellt upprättande av amorterings- plan som föregått återtagandet.

Enligt departemcntspromemorian framstår den sålunda förespri'tkade kompletteringen av de båda nämnda lagarna emellertid som i stort sett överflödig. om man ser till kreditgivarens (säljarens) intresse av att i samband med ett återtagande kunna få betalt för sådana fordringar. Omdet vid avräkningen uppkommer en mellanskillnad i köparens favör. fär varan visserligen inte återtas tttan att mellanskillnaden i princip betalas ut till köparen. I promemorian framhålls emellertid att kreditgivaren (säljaren) i denna situation torde ha tämligen goda möjligheter att mot köparens anspråk kvitta en fordran på ersättning för kravkostnad c. d. Är det fråga om en fordran som har fastslagits av dontstol och är cxigibcl kan. vid ltattdräckning eller domsverkställighet för återtagande. kvittningen ske tvångsvis.

För den åtminstone hittills långt vanligare situationen att det vid avräkningen i stället uppstår en mellanskillnad till köparens nackdel. dvs. en restskuld för denne, kommer med den nuvarande regleringen att gälla att kostnad för krav e. d. även efter ett återtagande kan tas ut i vanlig ordning. Om en sådan kostnad däremot förs in under avräkningsreglerna kommer den

Prop. HSO/81:10 116

att vid tillätnpningen av konsumentkreditlagen falla under den lagens principiella förhttd mot utkrävandc av restskuld. Enligt 18 s i den lagen gäller sälunda att restskttld efter ett återtagande får krävas ut endast om varan har utsatts för betydande värdeminskning genom att köparen har vativardat varan. ( departcmentsprometnorian framhälls att när det gäller rättegångs- kostnad -— som i dag ofta ittnefattar ersättning för kravkostnad e. d. — så har i konsttmentkreditlagen intagits den ståndpunkten att en sådan kostnad inte bör (mtfattas av detta förbud. Enligt promemorian kan det också te sig egendomligt. om köparens skyldighet att efter ett återtagande ersätta t'ättegz'tngskt'tstnad skttlle vara beroende av hurttvida han har vanvt'trdat den återtagna varan eller inte. Detsamma gäller enligt promemorian i fråga om en civilrättsligt reglerad inkassokostnad.

Pä grttnd av de nu redovisade ("ix-'crvi'igant'lena föreslås i promemorian inte någon ändring i konsumentkreditlagen eller lagen om avbetalningsköp mellan vissa näringsidkare m. fl.

Vad som i denna del har anförts i promemt'n'ian har vid remissbehand— lingen lämnats utan erinran av alla remissinstanser tttotn riksskatteverket. som stöder den ståndpunkt som datainspektionen intog i sin utredning.

För egen del anslttter jag mig i den nu berörda frågan till promemorieför- slaget. Som har framhallits i departementspromemorian och som även framgår av riksskatteverkets yttrande är det inom tillämpningsområdet för lagen om avbetalningski'tp mellan näringsidkare m. fl. över huvud taget inte av någon större betydelse. om kostnaderna för krav m. m. omfattas av avräkningsreglerna i 95 i den lagen eller inte. Det synes därför onödigt att belasta dessa med nya bestämmelser om tillgt'uloräknande av sådana kostnader. Vad särskilt angår den situationen att avräkningen resulterar i en tnellanskillnad till köparens förmän biträder jag den bedötnning som har gjorts i promemorian. nämligen att säljaren torde ha tätnligcn goda möjligheter att mot köparens anspråk på mellanskillntulcn kvitta en fordran på kravkostnad e. d, Detta gäller givetvis även vid köp sotn omfattas av konsttmentkreditlagen. Även i övrigt anslttter jag mig till de skäl mot den ifrågasatta ändringen i konsumentkreditlagen sotn har anförts i promemori- an. Enligt min mening är det principiellt rikligast att endast kostnader sotn har ett mycket nära samband med själva återtagandet omfattas av avräkningsreglerna och därmed i sista hand av det förbud mot att utkräva restskuld efter ett återtagande som har ställts upp i konsumentkreditla- gett.

4.5 Ikraftträdande m. m.

De föreslagna lagändringarmt kräver en del förhcredelsearbete. Sålunda måste datainspektionen ha tid på sig att utarbeta nya föreskrifter och anvisningar för tillämpningen av kreditupplysningslagen och inkassolagen. Ställning måste också tas till frågan om behovet av undt'tntagsregler enligt 7 s

Ikraftträdande tn. m.

Prop. l980/8l:10 117

andra stycket krcditttpplysningslagen i dess nya lydelse. Vidare torde saväl kreditupplysningsförctag som inkassoföretag behöva en frist för utbildnings- insatser och nödvändiga anpassningar till de nya reglerna.

På grttnd av dessa omständigheter föreslår jag att huvuddelen av ändringarna i kreditttpplysningslagen och inkassolagen sätts i kraft den 1 jttli 1981.

Som har framgått i avsnittet 4.2.1 träder den nya lagen om finansbolag. varigenomflertaletfinansbolag ställs ttnder bankinspektionens tillsyn. i kraft redan den 1 jttli 19811. Det är angeläget att finansbolagen i avvaktan på ställningstagandet till de nu ft'ftreliggande förslagen inte förs in under undantagsregeln i l & kr'editupplysningslagen för kreditintättningar och andra företag under bankinspektionens tillsyn. Detma fråga kommer emellertid att övervägas av riksdagen innan lagen om finansbolag träder i kraft (se NU 1979581123 s. 17'. jfr prop. 1978t'79zl711 s. 149 f).

Vissa av de föreslagna ändringarna i kret'litupplysningslagcn och inkasso- lagen bör kttnna tillämpas redan före den 1 jttli 1981. 'fystttadspliktshestäm- melsct'na i 18 ;" kreditupplysningslagen och lo s' inkassolagen ersätts sålunda fr. o. m. den 1 januari 1981 av bestämmelserna i 9 kap. av sekretesslagen och bör därför upphävas med verkan fr. o. m. den dagen. Eftersom också ändringen av 1 1 55 inkassolagen har samband med den nya sekretesslagen bör även den ändringen träda i kraft den 1 januari 1981.

Jag har i det föregående förordat att reglerna om tillstånd i såväl kreditttpplysningslagen som inkassolagen kompletteras med en bestämmelse som ger datainspektioncn möjlighet att förena ett tillstånd med föreskrift om skyldighet att anmäla ändring av förhållande sotn har haft betydelse för tillståttdet. Genom särskilda övergångsbestämtnelser bör inspektionen ges rätt att meddela en sådan föreskrift även i ett tillståttdsärende som avgörs före den I juli 1981. såvitt angår tid fr. o. m. den dagen.

Till ändringarna i inkassolagen bör vidare fogas en övergångsbestämmelse som tar sikte på det fallet att ett tillstånd sotn har meddelats enligt 2 och 3 ss” inkasst'tlagen i deras nuvarande lydelse inte längre behövs på grttnd av den föreslagna inskränkningen av tillstz'indsplikten. Om datainspektionen i ett sådant fall har förenat tillståndet med en föreskrift om httr verksamheten skall bedrivas (jfr 3 & inkassolagen) bör denna föreskrift. i enlighet med vad som har föreslagits i departementsptomemorian. fortsätta att gälla till dess att datainspektionen besltttar om annat.

Även den föreslagna lagen om ersättning för inkassokostnader m. m. och de ändringar i annan lagstiftning som föranleds av den bör träda i kraft den 1 juli 1981. Äldre bestämmelser om ersättning för inkassokostnad bör dock ft')rtfat'andc tillämpas i fråga om kostnad för inkassoi'ttgärd som har vidtagits före ikraftttädandet. Till frågan om vissa övergångsbestämtnelser som hänger samman med den nya inkassokostnadslagcns tvingande natur får jag återkomma i speeialmotivcringen.

Ikrafttrr'idande m. m.

Prop. 1980/81:10 118

4.6 Resursfrågor

Vissa av de ändringar i kreditupplysningslagen och inkassolagen som jag har fi'irordat i det föregående torde medfi'ira en viss ytterligare belastning på datainspektionens resurser. Inför ikraftträdandet av lagändringarna mäste sålunda utarbetas en del nytt föreskrifter för tillämpttingen av de nya reglerna och då särskilt när det gäller ändringarna i kreditupplysningslagen. Det blir emellertid i huvudsak fråga om en temporär extra belastning. sotn bör kunna klaras inom ratnen för befintliga anslag. 1 övrigt kan naturligtvis en del av de föreslagna ändringarna. åtminstone under en tid. ge upphov till en viss ökning av tillsynsärendena. En sådan ökning torde emellertid uppvägas av att andra ändringar kan medföra en lättnad i arbetsbt'ördan. .Iag syftar här bl. a. på förslaget om att personupplysningskopior i fortsättningen alltid skall innehålla uppgift om beställaren. vilket kan bespara inspektionen det arbete som f. n. måste läggas ned med anledning av förfrågningar om detta. samt på de föreslagna förtydligandcna i fråga om inkassolagens tillämpningsområde (jfr avsnitten 4.2.5 och 4.3.1 ).

Det nu sagda innebär att datainspektionen inte på grund av de föreslagna lagändringt'trna behöver tillföras några ytterligare resttrscr.

Hänvisningar till PS3

5 Upprättade lagförslag

I enlighet med det anförda har inotn justitiedepartementet upprättats förslag till

1. lag om ändring i kreditupplysningslagen (1973:1173).

2. lag om ändring i inkassolagen (1974zl82).

3. lag om ersättning för inkassokostnader m. m..

nt.-lag om ändring i lagen (194628118) om lagsökning och betalningsförc- läggattdc (lagsökningslagen).

5. lag om ändring i rättegängsbalken. (i. lag om ändring i lagen ( 1974:8) om rättegången i tvistemål om mindre värden.

Förslagen bör fogas till protokollet i detta ärende som bilaga 4.

6 Speeialmotivering 6.1 Förslaget till lag om ändring i kreditupplysningslagen 1 51

Denna lag gäller kreditupplysningsverksamhet som bedrivs iförvit'rvssyfte eller som i annat fall är av större (mt/'atttting.

Lagen omfattar inte verksamhet som avser förmedling av kreditttppfysning- —ar mellan kreditinrättningar eller företag som har inrättats för kreditttpp/ysv ningsverksatnhct. i den mån det är fråga om Sveriges riksbank. Sveriges investeringsbank AB eller andra kreditinriittningar eller företag ttnder

I Paragrafen har fått en något annan lydelse i propositionsförslaget.

Restltzsfrågor

Kreditupplysnings- lagen ( KUL )

Prop. HSO/81:10 119

bankinspektionens tillsyn (in finansbolag som avses i lagen (19802) mn jinanslmlag.

Lagen giiller inte heller verksamhet som avser förmedling av kreditttpplys— ningar mellan företag inom samma ktmcern.

(Jfr l ä i promemorieförslaget).

Paragrafen anger kreditumwlysningslagens tiIlämpningsomräde. Frågan härom har behandlats i avsnittet 4.2. 1. Som framgär av vad sotn har sagts där är ändringarna i l ä i viss utsträckning av redaktionell natur.

Första sive/(el. Med kreditupplysningsverksamhet som bedrivs i förvärvs- syfte avses i första hand (len affärsmässigt organiserade verksamhet som förekommer hos de egentliga kredituppl_vsningsföretagen. Även annan verksamhet som innebär att kreditupplysningar lämnas mot betalning torde i regel kunna anses bedriven i förvärvssyfte. vare sig verksamheten ger en påvisbar vinst eller ej. Detta gäller naturligtvissärskilt om kreditupplysnings- vcrksamheten bedrivs i anslutning till annan näringsverksamhct.

När det gäller utlämnande av kreditupplysningar mot betalning frän företag e. d. utanför den egentliga kreditupplysningssektorn krävs f. n. att denna verksamhet. för att den skall falla under lagen. inte är av alltför obetydlig omfattning. Som exempel på kreditupplysningsförmedling som på den grunden normalt bör falla utanför lagen har nämnts sådan som förekommer hos advokat- och revisionsbvräer (prop. 1978455 s. Bo). Den begränsning sotn torde ha äsyftats är att lagen inte bör tillämpas när kreditupplysningar inom ramen för en annan verksamhet lämnas endast sporadiskt. även om det sker mot betalning. En motsvaramle begränsning liggeri det nu uppställda kravet att det skall vara fräga om en kreditupplys— ningsverksamhet som bedrivs i förvärvssyfte. Det skall dock framhällas att det nu sagda inte bör gälla. om själva kreditupplysningsverksamheten marknadsförs. l sädant fall får verksamheten nämligen. även om marknads— föringen resulterar endast i en begränsad efterfrägan. väsentligen samma karaktär som de egentliga kreditupplysningsföretagens.

F.nligt motivuttalt-tnden vid lagens tillkomst omfattar lagen. vid sidan av sådan kreditupplysningsverksamhet sotn bedrivs i förvärvssyfte. i princip all kreditupplysningsförmedling som ingår som ett led i en viss näringsverksam- het och inte är av alltför obetydlig omfattning. Som exempel har nämnts förmedling av kreditupplvsningar frän ett kontokortsföretag till de företag som är anslutna till kontokortssystemet samt ett diskonteringsföretags utlämnande av information till försaljningsföretag ("prop. 1973:155 5. 136). I den män sädant informationsutbyte fi.”)rekommer kan det ofta antas ske utan att ersättning utgär för de upplysningar som lämnas. Vidare omfattar lagen sädan kreditupplysningsservice som lämnas t. ex. av branschförcningar och liknande företagarorganisationer.

I promemorieförslagct gjordes en viss skillnad mellan de bäda nu nämnda typfallen. Om kreditupplysningar lämnades som ett led i näringsverksamhet skulle lagen sälunda enligt promemorieförslaget gälla sä snart detta skedde

I $$ KUL.

Prop. 1980/81.:10 120

annat än i enstaka fall. medan den i övrigt skulle gälla endast om krcditupplysningsverksamheten var av större omfattning. Frän praktisk synpunkt framstår det emellertid som varken päkallat eller lämpligt att låta frägan om lagens tillämplighet vara beroende av en sådan finare distinktion. l enlighet härmed anges i fi.")revarande bestämmelse att lagen gäller. fi.")rutom kreditupplysningsverksamhet som bedrivs i förvärvssyfte. annan kreditttpp- lysningsverksamhet som är av större omfattning. Nägon väsentlig ändring i förhållande till gällande rätt är inte äsyftad.

Allt utlämnande av information om olika personers eller företags ekonomiska förhållanden. betalningsvantn' e. d. kan inte betraktas sotn "kreditupplysningsverksamhct'" i lagens mening. För att en sädan verksam- het. vilken ju bl. a. kräver tillstånd av datainspektitmen. över huvud taget skall" anses föreligga bör det krävas att verksamheten har en viss grad av organisation med inriktning på att till andra förmedla ekonomisk informa- tion om personer. företag e. d. Det kan vara fråga om att Inatt för bl. a. sadant ändamål samlar in och lagrar information eller att man för ändamålet tillhandahåller utredningstjänster. Som kt'ct'lituppl_t-'s11ingsverksamhet i lagens mening kan däremot inte betraktas att t. ex. ett företag med annan verksamhet eller en hyresvärd pä förfragan lämnar ut tillgängliga uppgifter om vissa kunders eller hyresgästers betalningsvanor m. m. till andra som avser att träda i ekonomisk förbindelse med dem sotn uppgifterna avser. Ofta kan ett sådant lämnande av upplysningar vara föranlett av att den som upplysningen avser har angett utlämnaren som referens. Som framgär av det nyss anförda kan bedömningen bli en annan om upplysningarna lämnas under mer organiserade former. såsom när företag inom en bransch eller ett antal hyresvärdar har kommit överens om att utbyta informatitmer om kunder eller hyresgäster.

Med anledning av ett påpekande i datainspektionens remissyttrande hör vidare framhällas att det givetvis inte kan anses vara fräga om en kreditupplysningi lagens mening. om t. ex. ett kontokortsföretag tneddelar de försäljningsföretag som är anslutna till kontokortssystemet att ett konto har spärrats av en eller annan anledning eller om ett diskonteringsl'öretag meddelar ett försäljningsföretag att man är beredd att diskontera ett visst kontrakt. [ hithörande fall lämnas meddelandet inte i det för en kreditupp- lysning typiska syftet att tjäna till ledning för bedömning av kontohavarens eller kundens kreditvärdighet e. d. (jfr 2 %$).

Lagen omfattar. liksom hittills. kreditupplysningsvcrksamhet som bedrivs genom offentliggörande av kreditupplysningar i tryckt eller pa annat sätt framställd skrift. under förutsättning att verksamheten bedrivs i förvärvssyf- te eller i annat fall är av större omfattning. I allmänhet är det här fräga om utgivande av sädana publikationer som direkt har till syfte att förmedla kreditupplysningar. Det krävs i och för sig inte att kreditupplysningar utgör publikationens enda innehåll (jfr prop. 19731l55 s. Bö"). Som har framhållits i avsnittet 4.2.1 är det emellertid tydligt att utgivandet av dagstidningar eller

15. KUL

Prop. 1980/81:10 121

tidskrifter som huvudsakligen innehåller allmänt informatitmstmtterial inte kan anses utgöra kreditupplysningsverksamhet i lagens mening. även om det i en sådan tidning eller tidskrift förekotnmer infi'irda notiser. kungörelser c. d. som har karaktären av kreditupplysningar. Däremot kan det blir fråga om kreditupplysningsverksamhet. om utgivningen av en tidskrift som innehåller såväl allmänt informationsm'aterial som kreditupplysningar sker med väsentligt syfte just att fi.")rmedla sådana upplysningar.

.»"lnzlra.s't_v(.'kt-*t. llär upptas det sedan tidigare gällande undantaget för intern förmedling av kreditupplysningar inotn en krets som består av Sveriges riksbank. Sveriges investeringsbank AB samt banker och vissa andra kreditinrättningar under bankinspektionens tillsyn. Bestämmelsen har dock formulerats om. så att även det bankägda kreditupplysningsföretaget Upplysningseentralen UC AB hänförs till den nämnda undantagskretsen. såvitt gäller intern ft'trmedling av upplysningar mellan de olika nämnda företagen. Den nya bestämmelsen avser i och för sig även annat kreditupp— lysningsföretag än UC. under förutsättning att företaget ställs under lmnkinspektionens tillsyn. lluruvida tillsynen grundas pä författning eller. sotn i UC:s fall. på en föreskrift i en "av regeringen godkänd bolagsordning saknar betydelse. För att formellt åstadkomma tillsyn från bankinspektio— nens sida måste dock krävas ett beslut av riksdagen eller regeringen. [ sammanhanget bör understrykas att den här aktuella delen av UC:s Verksamheti huvudsak bör ses endast sotn en särskild fortn för att organisera den bankinterna kreditupplysningsförmedlingen. För UC:s externa kredit— upplysningsverksamhct gäller. som tidigare har framgått. kreditupplysnings— lagen fullt ut.

I enlighet med vad som har anlörts i avsnittet 4.2. I omfattas finansbolagen inte av undantaget i andra stycket. trots att de enligt lagen om finansbolag har Ställts under bankinspektionens tillsyn. Kreditupplysningslagen kotntner alltså även i fortsättningen. med den inskränkning som i en del fall kan följa av koncernundantaget i tredje stycket. att gälla för förmedling av kreditupp- lysningar mellan finansbolagen inbördes. mellan finansbolagen och andra kreditinrättningar under bankinspektionens tillsyn samt mellan finansbola- gen och Upplysningsccntralen UC AB.

I anslutning till frågan om finansbolagens ställning enligt kreditupplys- ningslagen har bankinspektionen i sitt remissyttrande tagit upp vissa frågor som rör banksekretessen och den liknande sekretessreglering som för finansbolagens del gäller enligt 23% lagen om finansbolag. Enligt bankin- spektionen sker av hävd mellan kreditinstitutcn ett utbyte av information som innebär att banksekretessen bryts igenom. ()m kredituppl_vsningslagen även i fortsättningen skall gälla för kreditupplysningsförtnedling till och från finansbolagen. kan det enligt inspektionen ifrågasättas i vad man detta får betydelse även för bedömningen av sekretessfri'tgt'trna. Huruvida kreditupp- lysningslagen skall tillämpas på information sotn lämnas (. es. mellan två

finansbolag eller mellan ett finansbolag och en bank är emellertid en annan

Isf/(UL

Prop. BSO/81:10 122

fråga än den huvuvida sädana företag kan utbyta viss information utan hinder av banksekretessen resp. sekretessreglcringen i lagen om finansbolag. Ställningstagandet i fråga om kreditupplysningslagens tillämplighet för finansbolagen är inte avsett att påverka en annars gällande syn på sekretessft'ågrn'na. Med anledning av vad bankinspcktioncn vidare har anfört i detta sammanhang bör framhz'illas att kredituppl_t-'snings1agen inte kan anses lägga hinder i vägen för att finansbolag registrerar och utbyter information om i vilken utsträckning en person har beviljats t. ex. ktmtokrediter.

Tredjestvc'kat. llär återfinns det alltsedan lagens tillkomst gällande undantaget för verksamhet som avser förmedling av kreditupplysningar mellan företag inotn samma koncern. Beträffande skälen för detta undantag får hänvisas till prop. 1973: 155 s. 130. I enlighet med vad som ltar anft'.'n'ts i departementspromemorian avses i bestämmelsen med koncern i första hand en sådan gemenskap mellan aktiebolag sotn anges i 1 kap. 2 s' aktiebolags- lagen (1975: 1385. ändrad senast 1978:272). 17.11 koncernft'ärhållande förelig— ger sålunda bl. a. när ett aktiebolag äger så manga aktier eller andelar i en annan juridisk person att det har mer än hälften av rösterna för samtliga aktiereller andelareller när ett aktiebolag i annat fall. på grund av aktie— eller andelsinnehav eller avtal. har ett bestämmande inflytande över en annan juridisk person och en betydande andel i resultatet av dess verksamhet. Dotterföretaget i en koncern behöver alltså inte vara ett aktiebolag. Som koncerner i kreditupplysningslagens mening bör ocksä anses företagsgrup- pcringar där moderft'iretagct utgörs av en ekonomisk ft'.'n'ening eller ett handelsbolag (jfr prop. 1973: 155 s. 137 f). Även andra fall torde böra räknas hit. såsom när moderföretaget utgörs av en enskild näringsidkare eller en stiftelse (jfr prop. 1979lxtl:l43 s. 1.4.9 f) eller när moderföretaget är en bank.

3?

Kreditupplysningsverksamhet får bedrivas endast efter tillstånd av data- inspektionen.

Tillstånd behövs ej för kreditupplysningsvcrksamhet. i den mån den bedrivs genom offentliggörande av kreditupplysning i tryckt skrift eller annan skrift som avses i I kap. 5 så tr_v('kfri/tc/s/k')mra'ningen.

(Jfr 3 & i promemorieförslaget). Bortsett från en språklig justering har paragrafen ändrats endast genom tillägget i andra stycket avseende sådana stenciler m. in. som enligt 1 kap 5 % tryckfrihetsförtn'dningen jämställs med tryckt skrift. [ den delen får hänvisas 'till avsnittet 4.2.11.

Det i andra stycket föreskrivna undantaget från tillståndsplikten innebär att datainspektionen inte kan med stöd av 4 eller 17 & meddela ft'treskrifter för kreditupplysningsverksamhet sotn bedrivs genom (:tffentliggörande av kreditupplysningari tryckt eller därmed jämställd skrift (jfr prop. 1973: 155 s.

3 ..5 KUL

Prop. HSO/81:10 123

155). Inspektionen kan däremot även lned avseende pa sadan verksamhet meddela räd och anvisningar. som kan grundas pä inspektionens tillsynsupp- gift enligt lagen. samt sadana ytterligare föreskrifter för tillämpningen av lagen som avses i 7 & krcditupplysningskungörelsen. Dessa föreskrifter bör nttmera betraktas som fi.")reskrifter om verkställighet av lagen (jfr 8 kap. 13 s' första stycket 1 och tredje stycket regeringsformen) och alltsä hällas inom den ram som gäller för sädana föreskrifter (se prop. 1973z9t) s. 31 1 ).

4s

Tillstand att bedriva krcditupplysningsverksamhet far meddelas endast om det från allmänna synpunkter finns behov av verksamheten och den kan frn/a.i- bli bedriven pa ett sakkunnigt och t'nndömesgillt sätt.

Tillstand får meddelas för en tid av högst tio är i sänder. 'I'i/lxltzntlt'l fär förenas med föreskrift om hur verksamheten skall bedrivas (N'/1()!)I_S'lx'_)'l(ll__L'/lt'l att anmäla ändring av _ft'irlnillmztlen som har haft /7('f_)'(/t'/SL' för tillståndet.

Tillstand fär ej meddelas nägon för vilken gäller inskränkning i rätten att förvärva fast egendom enligt lagen (19lozl5ö) om vissa inskränkningar i rätten att förvärva fast egendom m. m.

(Jfr 4 s i promemorieförslaget). [ enlighet med förslaget i departctnentspromemorian. som pä denna punkt i princip har godtagits av remissinstanserna. har 4 ;" kt'nnplettcrats med en bestämmelse som ger datainspektionen rätt att förena ett tillständ med f("öreskrift om skyldighet att anmäla ändring av förhällanden som har haft betydelse för tillståndet. Samtidigt har de nuvarande bestämmelsertm i första stycket av redaktionella skäl delats upp i tvä särskilda stycken. vilket medför att det nuvarande andra stycket far utgöra ett nytt tredje stycke..

Möjligheten för datainspektionen att meddela föreskrift om skyldighet att anmäla ändring av vissa förhällanden torde framfi'är allt ha betydelse när det gäller viktigare ändringar i kreditupplysningsföretags ledning och ägarkrets. Vilket eller vilka förlu'lllanden som en sadan föreskrift i det enskilda fallet skall gälla far avgöras av inspektionen i varje särskilt fall.

Äsidosättande av en föreskrift av det nu berörda slaget skall enligt 19 å i dess nya lydelse kunna medföra straffansvar. Som har framhällits i departementspromemorian ställer detta anspräk på att föreskriften utformas på ett tydligt sätt och närmare anger det eller de förht'tllanden som den avser. Det ligger i sakens natur att föreskriften bör innehälla en tidsfrist för fullgörande av anmälningsskyldigheten. Det har inte ansetts nödvändigt att i lagtexten ange dessa självklara krav pä en f("öreskrift av ifragavarandc slag. . .

Beträffande datainspektionens möjlighet att i ett tillstandsärende. som avgörs innan de här föreslagna lagändringartm träder i kraft. meddela föreskrift enligt den nya bestämmelsen i andra stycket fär hänvisas till .

övergängsbestämmelserna.

4 s*" KUL

Prop. 1980/81:10 124

55

Kreditupplysningsverksamhet skall bedrivas sä att den ej leder till otillbörligt intrång i personlig integritet genom innehållet i de upplysningar som förmedlas eller pä annat sätt eller till att oriktiga eller missvisande uppgifter lagras eller lämnas ut.

(1 departementspromemorian föreslogs inte nägon ändring av den allmänna bestämmelsen i 5 Ö).

Paragrafen har kompletterats med en regel om att kreditupplysningsverk- samhet skall bedrivas så att verksamheten inte leder till att oriktiga eller missvisande uppgifter lagras eller lämnas ut. Beträffande bakgrunden till denna nya bestämmelse far i första hand hänvisas till avsnittet 4.2.8. Som framgär av det där sagda syftar tillägget främst till att ge datainspekticmen ett uttryckligt stöd för att vid behov meddela föreskrifter bl. a. i fräga om vilket underlag som lämpligen bör användas för registrering av olika uppgifter i kreditupplysningsverksamhet. Detta kan vara päkallat när det gäller en eller flera av de källor som kreditupplysningsföretagcn utnyttjar. exempelvis restlängderna avseende skatter och avgifter.

Tillägget innebär vidare att datainspektionen kan meddela föreskrifter som avser även kreditupplysningsverksamhet beträffande juridiska perso- ner. i dcn män detta behövs för att förebygga eller hindra att oriktiga eller missvisande uppgifter om sådana rättssubjekt lagras eller lämnas ut.

1 de nämnda hänseendena kan. såvitt gäller tillstandspliktig kreditupplys- ningsverksamhet. föreskrifter meddelas med stöd av 4 s*" andra stycket och 17 &. Beträffande sådana föreskrifter gäller att äsidosättande av dem kan medföra dels de sanktioner som framgär av 17 s. dvs. nya eller ändrade föreskrifter och i sista hand äterkallelse av tillstand. dels straffansvar enligt 19 &.

Som har nämnts vid 3 & kan föreskrifter däremot inte meddelas med stöd av 4 eller 17 & för kreditupplysningsverksamhet som bedrivs genom offentliggörande av upplysningar i tryckt eller därmed jämställd skrift. Även för sådan verksamhet bör inspektionen emellertid. utöver rad och anvisning— ar. kunna med stöd av 755 kreditupplysningskungörelsen meddela vissa föreskrifter rörande tillämpningen av före 'arande paragraf. Dessa föreskrif- ter blir dock osanktionerade. '

i detta sammanhang bör nämnas att datainspektionen i sitt remissyttramle har uppgett att gäldenärer i kreditupplysningsskrifter inte alltid it'lentifieras tillräckligt tydligt. vilket kan leda till förväxlingar och därmed till skada. lnspektionen har därför ansett att det bör övervägas att i lagen fi.")reskriva eller i vart fall rekommendera att kreditupplysning som publiceras i skrift skall vara entydigt hänförd till viss fysisk eller juridisk person genom att namn eller firma kompletteras med person- eller organisatitmsnummer. Det synes lämpligt att det av inspektionen förordade tillvägagangssättet för identifikation av den som en upplysning avser iakttas sa langt detta är

5 # KUL

Prop. l980l81:10 | lx) 'Jl

möjligt. Frägan bör emellertid kunna lösas titan att särskilda regler om detta förs in i lagen. Det kan framhällas att den som äsamkas skada genom att han på grund av bristfälliga identifieringsuppgifter i en kreditupplysning förväx- las med den som upplysningen avser torde ha möjlighet att erhälla

skadeständ enligt 21 s. () 5'

Uppgift om nägons politiska eller religiösa uppfattning. ras eller hudfärg (är icke insamlas. lagras eller vidarebefordras i kreditupplysningsvcrksam- het.

Uppgift om att nägon misstänks eller har dömts för brött eller lill/' avtjänat straffeller undergätt annan paföljd för brott eller har varit föremal för ätgärd enligt barnavärdslagen ( 19nt):97). lagen ( 1954:579) om nykterhetsvärd. lagen (1956:3) om socialhjälp. lagen ( 1960293) om beredande av sluten psykiatrisk värd i vissa fall. lagen (1967:94t)) angäende omsorger om vissa psykiskt utvecklingsstörda. lagen (1964245tl) om ätgärder vid samhällsfarlig asociali- tet. lagen ”973.551” om lill/i'illigt omltämlerlagantle. lagen (197651!) mn on1ln'inderlagalide av berusade personer m. m. eller utlämtingslagen (1954: 193) får ej utan medgivande av datainspektionen insamlas. lagras eller vidarebel—ordras i kreditupplysningsverksamhet. Detsamma gäller uppgift om sjukdom. hälsotillstånd eller liknande.

Medgivande som avses i andra stycket far lämnas endast otn synnerliga skäl föreligger.

(Jfr () 35 i promemoricförslaget). [ enlighet med vad som föreslagits i departementspromemorian har uppräkningen av olika lagar i paragrafens andra stycke kompletterats. 1 övrigt har bestämmelsen 1. v. behällits oförändrad. l prop. 1979/8t):1 om socialtjå'insten har lagts fram förslag till lagändringar som innebär att vissa av de i andra stycket nämnda lagarna ersätts av andra lagar. [ den inän förslagen antas av riksdagen fär andra stycket ändras i enlighet härmed. samtidigt som förbudet mot uppgifter om ätgärder enligt de lagar som då ersätts av andra lagar givetvis bör behällas under en ("tvergängstid. 7 ä

Personupplysning fär ej innehälla uppgift om annan betalningsförsummel- se än sädan som fastslagits genom domstols eller annan myndighets avgörande eller ätgärd eller som lett till betalningsinställelse. konkursansö— kan eller ackord. Uppgift som enligt det sagda ej fär lämnas ut fär icke heller lagras.

Regeringen eller. efter regeringens bestämmande. datainspektionen får jöreskriva undantag från bestämmelserna i första stycket. om det finns särskilda skäl.

(Jfr 7ä i promemorieförslaget). l-b'rsm styrke/. ] paragrafens första stycke föresläs inte nägon ändring (se avsnittet 4.2.9). I fråga om den närmare innebörden av första stycket fär

' Andra stycket har lätt en nägot annan lydelse i propositionsförslaget.

6 och 7 5.5 KUL

Prop. 1980/81 : 10 126

hänvisas till den kortfattade redogörelsen i avsnittet 4.3.9 samt till prop. 19731155 s. 94 ff och 145 f.

Som har nämnts i avsnittet 4.3.9 har förbudet i första stycket sin största praktiska betydelse när det gäller s. k. ansökningsuppgifter. dvs. främst uppgifter om att någon har blivit föremål för ansökning om stämning. lagsökning eller betalningsft'ireläggande. lnnan en sädan ansökan har lett till ett avgörande som innebär att en betalningsförsummelse fastsläs. fär enligt första stycket uppgift om ansökningen eller den pästädda baktnnliggande betalningsförsummelsen inte lämnas ut i en personupplysning och inte heller lagras. Nägot motsvarant'le förbud mot ansökningsuppgifter gäller inte pä företagsupplysningst'nnrädct. Vid lagens tillkomst framhölls dock att det även när det gäller företag kan finnas skäl till äterhällsamhet vid använd- ningen av uppgifter om betalningsförsummelser som inte har fastslagits av myndighet.

Enligt vad som har päpckats av ett par remissinstanser har det i en del fall vållat problem för företag att ansökningsuppgifter sälunda i princip tilläts förekomma i företagsupplysningar. Det fall som främst äsyftas är att företag utsätts för ogrundade krav som är förenade med hot om ansökan om betalningsföreläggande vid utebliven betalning. linligt dessa remissinstanser -'äljer företagen dä ofta hellre att betala enligt kravet än att utsätta sig för risken att få en ansi'ikningsuppgift noterad pä sig.

Det sälunda berörda problemet är naturligtvis inte oväsentligt. även om situationen knappast kan antas vara särskilt frekvent. Uppenbarligen är det dock inte möjligt att komma ät problemet titan att förbjuda ansökningsupp- gifter även i företagsupplysningar. Skäl att pä den punkten fränga hittills gällande ordning kan inte anses föreligga. Datainspektionen bör emellertid ägna särskild uppmärksamhet ät'frägan inom ramen för tillämpningen av reglerna i 12 & om rättelse av oriktiga eller missvisande kreditupplysningar. Det torde sålunda finnas vissa mi'ijligheter för kreditupplysningsföretagen att. när rättelse päkallas. avgöra om det föreligger en sådan ogrundad ansökan som det här är fräga om. Finns det anledning misstänka att en ansökningsuppgift gäller en ogrundad ansökan. synes det sta i överensstäm- melse med det förut berörda uttalandet om äterhällsamhet vid användning av ansi'ikningsuppgifter även i företagsupplysningar att uppgiften behandlas som oriktig eller missvisande.

Andra stycket. Liksom hittills- ges genom bestämmelsen i andra stycket möjlighet att föreskriva undantag från det principiella förbudet mot att pä personupplysningsomrädet lagra och lämna ut uppgifter om betalningsför- summelser som inte har fastställts genom beslut av myndighet eller på liknande sätt. Hittills har gällt att sädant undantag medges av datainspek- tionen. Nu föreskrivs. i enlighet med bestämmelsermi i & kap. 75 första stycket 3 samt 11 & regeringsformen. att undantag fär medges av regeringen men med rätt för denna att delegera sin befogenhet till datainspektionen.

75. KUL

Prop. l980/81:10 " 137

Vid lagens tillkomst motiverades möjligheten till ttndantag främst metl att en registrering av hur kredittagare skötte avbetalningskrcditer hade visat sig bidra till en sanering av avbetalningshandcln. Även när det gällde kreditformer som läneköp och kontokrcdit ansägs det finnas risk för en ogynnsam utveckling. om förbudet enligt 7 & första stycket gjordes oefter— givligt. I sammanhanget anfördes bl. a. att en ökning av kreditförluster. som kunde följa av ett generellt förbud enligt första stycket. ytterst skulle vara till nackdel även för konsumenterna i form av höjda priser. Dessa motiv för en undantagsmöjlighet gäller alltjämt. Som har nämntsi avsnittet 4.33) kan deti dag finnas särskild anledning att i detta sammanhang ttppmärksamma förhällandemi pä kontokortstnnrät'let.

Rätten att föreskriva undantag enligt andra stycket bör alltsä kunna användas bl. a. för att tillgodose ett behov hos finanslmlagen. särskilt kontok(.irtsföretagen. av att ktmna registrera och förmedla en utförligare information om betalningsförsununelser. Undantagsmi'ijligheten bör hante- ras med återhållsamhet. Detta hari lagtexten markerats genom att undantag skall fä föreskrivas endast om det finns särskilda skäl. Sätlana särskilda skäl kan vara att det pä ett omräde. t. ex. kontokortstmirädet. finns behov av att sanera kreditgivningen c. (1. eller förebygga en frän konsumentpolitiska synpunkter inte önskvärd utveckling med oacceptabla kreditförluster. I dessa och liknande situationer kan undantag behöva medges för uppgifter om t. ex. allvarligare betalningsförsttmmelser eller liknande kreditmissbruk. Som har framhållits i departementspromemorian bör vid prövningen av huruvida och ttnder vilka villkor undantag skall f("ireskrivas hänsyn tas till kvaliteten hos de uppgifter som kommer i fräga. Stor betydelse bör ocksä tillmätas det sätt på vilket en uppgift förutsätts bli utlämnad. Undantag bör sälunda knappast medges för publicering i skrift. Även i övrigt bör kretsen av mottagare beaktas och eventuellt begränsas i samband med att undantag medges. Konkurrensnetttralitet mäste dock eftersträvas. Det katt vidare vara päkallat att en undantagsföreskrift tidsbegränsas. sä att dess berättigande måste omprövas efter någon tid.

Ett särskilt skäl för att medge undantag från förbudet i första stycket kan också vara att undantag behövs för att undvika att en personujmlysning blir uppenbart missvisande (jfr 7 s* andra stycket i promemorieft'irslagct). Som päpekades såväl i datainspcktitmens promemoria som i departementsprt» memorian kan det t. ex. vara av väsentlig betydelse i kreditupplysningssam- manhang. om det mot en och samma person har gjorts ett flertal ansökningar om lagsökning eller betalningsföreläggande under loppet av en kortare tid. Det är bl. a. sädana situationer som tiatainspektionens hittills gällande undantagsföreskrifter har tagit sikte pä (se avsnittet 4.2.9). Om undantag av detta slag skall medges är det emellertid angeläget att de. i enlighet med vad som har sagts i departementspromemorian. utformas sa att inte lagringsför- budet enligt 75 första stycket i alltför stor utsträckning sätts ur spel.

7.5. KUL

Prop. 1980/81:10 128

Personupplysning fär ej innehalla uppgift om omständighet eller förhal- lande som är av betydelse för bedömningen av nägons vederhäftighet i ekonomiskt hänseende. om tre är förflutit fran utgången av det ar dä omständigheten inträffade eller förhållandet upphörde. Uppgift som enligt det sagda ej får lämnas ut skall efter den angivna tiden gallras ut ur register som används i kreditupplysningsverksatnhet. ('iallringen skall göras så snart det kan ske och i vart fall innan upplysning lämnas om den som uppgiften avser.

(Jfr 8 & i promemorieförslaget). Ändringen av paragrafen innebär att den nuvarande tidsgri'insen pä fem är ersätts med en treärsgräns. vilken liksom den tidigare femärsgränsen skall gälla generellt och alltså iakttas oavsett den närmare beskaffenheten av den omständighet eller det förhållande som en uppgift avser. Hitbi'årande frågor har behandlats i avsnittet 4.2.10.

Eftersom nägon ändring inte görs i den nuvarande ;n'gränsningen av begreppet personupplysning (se avsnittet 4.2.3). blir tillämpningsomrädet för 8 & oförändrat.

Sänkningen av tidsgränsen medför att en gallring enligt andra och tredje meningarna måste ske i samband med ikraftträdandet av de här föreslagna lagämlringarna. Tidpunkten för ikraftträdandet har bestämts med hänsyn bl.a. till att kredituppl_vsningsföretagen bör få rädrum att dessförinnan förbereda eller eventuellt genomföra denna gallring. '

95

Personupplysning far ej lämnas ut. om det finns anledning urna att upplysningen kommer att användas av någon annan än den som pä grund av ingänget eller ifrågasatt kreditavtal eller av liknande anledning har behov av upplysningen. Vad nu sagts gäller ej offentliggt'irande av personupplysning i tryckt skrift eller annan skrift som anses i ] kap. 5 s* /r_i'(:kl/i'i/zcrsj/önur/ning- en.

([ departementspromemorian föreslogs inte nägon ändring av 9 st. I enlighet med 'ad som har sagts i avsnittet 4.2.ll har undantagsregeln i andra meningen kompletterats så att den omfattar även offentliggörande av personupplysning i sådana stenciler m. m. som enligt 1 kap. 5 & tryckfrihets- förordningen jämställs med tryckt skrift.

När det gäller den praktiska tillämpningen av paragrafen. bl. a. i ADB-baserad kreditupplysningsverksamhet. fär hänvisas till avsnittet 4.2.4. Som framgär av vad som har anförts där föresläs nu en bestämmelse om straff för den som uppsåtligen föranleder att den som bedriver kreditupplysnings— verksamhet lämnar ut en personupplysning i strid med fi'irevaramle paragraf (se vid l9 s),

80611955. KUL

Prop. HSO/81:10 129

Frägan i vad män det enligt 9 55 kan anses tillätet att den som avser att träda i ekonomisk förbindelse med en gift person erhäller personupplysning även beträffande dennes make (s. k. äkta make—upplysning] har behandlats i avsnittet 4.2.7. Sammanfattningsvis innebär det som där har sagts följande. Personupplysning rörande make — som alltsä inte själv är kreditsökande e. d. —- fär lämnas ut endast på särskild begäran och bara om beställaren kan anses ha ett beaktansvärt behov av upplysningen. Det innebär att äkta make- upplysning inte bör fä lämnas ut i fall dä det är fräga om endast en mindre kredit e. d. Endast i undantagsfall bör det komma i fräga att äkta make—upplysning lämnas när makarna inte är sammanlmende. Datainspek- tionen kan med stöd av 7 & kreditupplysningskungörelsen utfärda närmare föreskrifter för tillämpningen av paragrafen i de nu berörda hänseen- dena.

105

Var och en har rätt att mot skälig avgift hos den som bedriver kreditupplysningsverksamhet fä skriftligt besked om huruvida deti verksam- heten finns uppgifter lagrade om honom och. om zletfinns sådana uppgifter, vad (le har för innehäll.

(Jfr 105 i promemorieförslagct).

l enlighet med promemorieft'irslaget. som pä denna punkt inte har mött nägon erinran frän remissinstansermt. har paragrafen ändrats sä att det framgär att rätten till skriftligt besked enligt paragrafen omfattar även besked om att uppgifter rörande den ifrågavarande personen inte finns lagrade i verksamheten. Ändringen motstarar ett tillägg som genom en tidigare författningsändring (SFS 1979133'4) har gjorts i 105 datalagen.

Vid lagens tillkomst framhölls att det i första hand ankommer på den som bedriver kreditupplysningsvcrksamheten att bestämma storleken av avgiften för besked enligt 1035 men att avgiften inte i nägot fall bör få överstiga de kostnader som har uppstätt (prop. 1973:155 s. 149). Det ankommer på datainspektionen som tillsynsmyndighet att övervaka att högre avgift än som kan anses skäligt inte tas ut. Som inspektionen har päpekat i sitt remissyttrande är det naturligt om avgiften för ett besked om att uppgifter saknas blir lägre än för ett utförligt registerbesked.

lls'

När perstmupplysning lämnas. skall den som avses med upplysningen samtidigt och kostnadsfritt til/ställas ett skriftligt meddelande om de uppgifter. omdömen och råd som upplysningen innehåller rörande honom och om vem .vom har begärt upplysningar.

9 Riksdagen 198018]. ] saml. Nr [()

10 och II ## KUL

Prop. 1980/81:10 131)

När annan kreditupplysning rörande enskild person lämnas. skall dcn som avses med upplysningen samtidigt och kostnadsfritt tillställas ctt skri/lligt mcddclandc om de uppgifter som upplysningen innehäller rörande honom.

Harsom ett led i en upplysning som avscs i första eller andra stycket uppgift. omdöme eller råd lämnats ävcn beträffande en annan enskild person. skall detta anges i meddelandet jämtc den andra personens nanm. Andra uppgi/icr rörande den [n'/sonen än idelititclsuppgiftcr och adrcss _/iir cj framgå av meddelandet.

Forsta—tredje styckena gäller ej kreditu/ndysning som lämnas genom olji'wtliggörandc i tryckt skrift eller annan skri/l som avses i ! kap. 5 s* tryckfrihetsförordningcn.

(Jfr 11 å i promemorieförslaget).

Paragrafen innehäller bestämmelser om s. k. kreditupplysningskopia i olika situationer. lförhällande till nuvarande 11 ågörs följande ändringar: 1) När en personupplysning lämnas skall den som avses med upplysningen tillställas inte bara. som f. n.. ett skriftligt meddelande om upplysningens innehäll utan även ett skriftligt meddelande om vem som har begärt upplysningen. 2) En rätt till kreditupplysningskopia införs även för enskilda näringsidkare och andra enskilda personer som inte är hänförliga till personupplysningskategorin: meddelande behi'iver i dessa fall dock lämnas endast rörande de faktiska uppgifter som upplysningen innehäller men däremot inte om räd eller omdömen och inte heller om vem som har begärt upplysningen. 3) Genom särskilda bestämmelser släs fast att ett skriftligt meddelande enligt paragrafen skall -— dä det som ett led i en personupplysning eller annan kreditupplysning om en enskild person har lämnats uppgifter e. d. även om en annan enskild person — innehälla besked om detta samtidigt som meddelandet inte fär innehälla de uppgifter rörande den andres ekonomi m. ni. som har lämnats ut. 4) Undantagsregeln för upplysning som lämnas genom tivffentliggörande i tryckt skrift utvidgas till att omfatta även fall dä offentliggt'n'ande sker i sädana stenciler m. in. som enligt 1 kap. 5 & tryekfrihetsförordningen jämställs med tryckt skrift.

Första stycket. Bestämmelsen gäller när personupplysning lämnas. Som tidigare har framgätt behälls definitionen av begreppet personupplysning oförändrad (se avsnittet 4.2.3).

Den väsentliga nyheten när det gäller s. k. personupplysningskopior är att ett skriftligt meddelande skall lämnas även om vem som har begärt upplysningen (bcställaruppgift). Denna fräga har behandlats i avsnittet 4.2.5. Skyldigheten att lämna bcställaruppgift utgör en viktig förbättring av den enskildes integritetsskydd. eftersom han med hjälp av den uppgiften själv kan kontrollera huruvida bestämmelsen i 9 s har iakttagits. Risken för missbruk av möjligheten att erhälla perstmupplysning om annan torde därmed reduceras.

]] s* KUL

Prop. l98l)/81:10 131

Skyldigheten att lämna uppgift om "vem som har begärt upplysningen" avser den egentliga beställaren och inte t. ex. ett ombud som denne kan ha anlitat. Det innebär att kreditupplysningsföretagen mäste tillämpa sädana beställningsrutiner att inte mellanhanden anges som beställare. Den som uppträder som ombud e. d. kan naturligtvis inte göra anspräk pä att fä ut en personupplysning. om han vägrar att uppge vem som är hans huvudman. Den hos vilken upplysningen begärs kan ju i sädant fall inte göra den prövning som förutsätts i 9 5 och kan dessutom inte fullgöra sin skyldighet enligt den här berörda bestämmelsen.

l:. n. gäller att ett uppsåtligt eller oaktsamt lämnande av osann uppgift i personupplysningskopia medför straff enligt 19 &. Straffansvaret utvidgas nu till att gälla även lämnande av osann uppgift om vem som har begärt en perstmupplysning. I enlighet med vad som har föreslagits i departements- promemorian omfattar straffansvaret emellertid endast fall dä det har lämnats en positiv. osann uppgift om beställaren. Om en bcställaruppgift utelämnas. skall detta alltsä inte föranleda straff. Datainspektionen kan däremot enligt 22 & tvinga fram beställaruppgiften genom vitesföreläggan- de.

Som har framhållits i avsnittet 4.2.7 föreligger vid de s. k. äkta make—upplysningarna tvä kreditupplysningar. en som avser den make sotn söker kredit e. d. och en som avser den andra maken. ()m bäda upplysningarna är personupplysningar. skall bestämmelserna i första stycket iakttas i förhz'tllant'le till var och en av makarna. Bäda skall alltsä tillställas ett skriftligt meddelande om innehället i upplysningen närande honom eller henne och om vem som har begärt upplysningen. llärvid skall även iakttas bestämmelserna i tredje stycket. Motsvarande gäller givetvis om det någon gang skulle inträffa att personupplysningar. på samma sätt som vid äkta make-upplysningar. lämnas ut beträffande två personer som inte är gifta med varandra.

Om en enskild näringsidkare söker kredit e. d. för sin rörelse kan det tänkas att kreditupplysning begärs och lämnas ut även beträffande närings- idkarens make. Denna upplysning torde i allmänhet vara att anse som en personupplysning. Av detta följer att bestämmelsermt i första stycket skall iakttas gentemot maken. medan bestämmelserna i andra stycket skall tillämpas pä kreditupplysningen avseende näringsidkaren själv. Även i detta fall skall därjämte bestämmelserna i tredje stycket iakttas.

.»lndra stycket. Här upptas den nya bestämmelsen om skyldighet att lämna* kreditupplysningskopia även i fall dä en kreditupplysning om en enskild person inte utgör en perstmupplysning utan en s. k. företagsupplysning (jfr 2 ä'). Frågan har behandlats i avsnittet 4.2.6.

Ett meddelande enligt andra stycket aktualiseras inte bara när kreditupp- lysning har lämnats om en enskild person i dennes egenskap av näringsidkare

Ilé'KUl.

Prop. HSO/81:10 132

utan även i de övriga fall dä en kreditupplysning om en enskild person enligt 2 i inte utgör en personupplysning. Detta innebär t. ex. att ett meddelande skall lämnas till en verkställande direktör eller styrelseledamot i ett aktiebolag eller till en delägare i ett lmndelsbolag. om det i samband meden

kreditupplysning avseende bolaget har lämnats uppgifter av kreditupplys-

nings natur om en sadan enskild person. Givetvis är det endast de uppgifter som avser personen i fräga som behöver anges i meddelandet.

I enlighet med vad som har sagts i avsnittet 4.2.6 behöver ett meddelande enligt andra stycket uppta endast de faktiska uppgifter som har lämnats om personen i fraga. Detta gäller exempelvis uppgifter om förmögenhet. inkomst och betalningsförsummelscr eller om att vederbörande har varit försatt i konkurs m. m. Däremot behöver meddelandet. i motsatstill vad som gäller enligt första stycket. inte innehälla de rad eller omdömen som har lämnats. lnte heller behöver det lämnas uppgift om vem som har begärt upplysningen.

Nägra remissinstanser har i sammanhanget berört frägan om innehället i kreditupplysningskopia till en näringsidkare. när det i upplysningen har angetts t. ex. att dennes kreditvärdighet är tveksam pit grund av att en konkurrent inom kort väntas lansera en klart överlägsen produkt c. d. F.nligt dessa remissinstanser skulle ett sädant meddelande kunna allvarligt skada konkurrenten. om förhållandet inte tidigare är känt för den omfrägade näringsidkaren. Att dennes kreditvärdighet av sadan eller annan liknande anledning är tveksam utgör emellertid ett sädant omdöme som inte behöver anges i ett meddelande enligt andra stycket. Vidare framgär av bestämmel- sen att meddelandet behöver innehälla endast de uppgifter som har lämnats om vederbörande själv. Med den utformning som har getts ät bestämmelsen torde det alltsä inte behöva befaras att ett meddelande enligt denna skulle medföra att andras yrkes- eller affärshcmligheter avslöjas.

Tredje stycket. 1 detta stycke har tagits upp de nya bestäm melserna om vad en krcditupplysningskopia enligt första eller andra stycket skall innehälla resp. inte far innehalla. när det som ett led i en kreditupplysning om en enskild person har lämnats uppgift. mndthne eller rad även beträffande en annan enskild person. Bestämmelserna har sin största praktiska betydelse vid s. k. äkta make-upplysningar och har från den synpunkten behandlats i avsnittet 4.2.7.

Reglerna i tredje stycket avser den situationen att uppgift etc. om en annan har lämnats som ett led i kreditupplysning om en viss enskild person. Uppgifterna etc. skall alltsä ha lämnats för att tjäna till ledning för bedömningen av den senares kreditvi-irdighet eller ekonomiska vederhäftig- het i övrigt. Detta är det typiska vid de s. k. äkta make-upplysningarna. där uppgifterna om den make som inte söker krcdit c. d. lämnas för att komplettera bilden av den kreditsökattdes ekonomiska förhällatulcn.

ll .ö KUL

Prop. 1980/81 : 10 IB

Reglerna tar däremot inte sikte pä den situationen att upplysningar om nägon annan har lämnats enbart i samband med kreditupplysning som avses i första eller andra stycket. säsom när personupplysningar har inhämtats beträffande tvä makar som gemensamt söker kredit e. d. eller när det i en kreditupplys- ning avseende ett aktiebolag eller ett handelsbolag har lämnats uppgifter av kreditupplysnings natur om flera styrelseledamöter. delägare e. d.

När det som ett led i en personupplysning eller annan kreditupplysning rörande en enskild har lämnats uppgift. omdöme eller rad om en annan enskild person skall detta enligt tredje stycket anges i det meddelande som ' enligt första eller andra stycket tillställs den förre. Motivet för detta är att det för den som har sökt kredit e. d. givetvis är av intresse att fä veta att hans eller hennes kreditvärdighet kan ha bedömts med beaktande även av uppgifter rörande en annan person. [ meddelandet mäste därför ocksä. enligt vad som vidare föreskrivs i tredje stycket. anges den andra personens namn.

I enlighet med vad som har anförts i avsnittet 4.2.7 bör däremot de uppgifter om en annans ekonomiska ft'n'hällanden eller de räd och omdömen som har lämnats om en annan inte fä lämnas ut i ett meddelande enligt ll s" första eller andra stycket. Detta framgär av f_iestämmelsen i tredje stycket andra meningen. enligt vilken meddelandet inte fär innehälla andra upplysningar rörande den andra personen än identitetsuppgifter. dvs. namn och perstmnummer. samt actress.

Fjärr/t'.vlyt'lrt'r. Genom denna bestämmelse görs undantag frän reglerna om kreditupplysningskopia för det fall kreditupplysningen har lämnats genom offentliggörande i tryckt skrift eller skrift som enligt ! kap. 5 & tryckfrihets— förordningen jämställs med tryckt skrift. [ fräga om undantaget även för de jämställda skrifterna. vilket saknade motsvarighet i promemorieförslaget. fär hänvisas till avsnittet 4.2.1 !.

Förekommer anledning till misstanke att en uppgift i kreditupplysning som lämnats under den senaste tolvmänadersperioden eller i register som ("trilla/si kreditupplysningsverksrnnhet äroriktig eller missvisande. skall den som bedriver verksamheten utan drifijsmäl vidta skäliga ätgärder för att utreda förhällandet.

Visar sig uppgiften vara oriktig eller missvisande. skall den. om den förekommer i register. rättas. kompletteras eller uteslutas ur registret. llar uppgiften tagits in i en kreditupplvsning som lämnats pä annat sätt än genom tryckt skrift eller annan skrift som avsav [ I kap. 5 # try(:kfri/ieisjiiirortlningt'n. skall rättelse eller komplettering sä snart det kan ske tillställas var och en som under den senaste tolvmänadersperiodcn fätt del av uppgiften. Har uppgiften underdelire/tastemlrn1alzatlcrsperioden lämnats i periodisk skrift. skall rättelse eller kmnplettering sä snart det kan ske införas i ett följande nummer av skriften. Vad sotn sägs i detta stycke gäller dock icke. om

[2 55 KUL

Prop. HSO/81:10 134

uppgiften uppenbarligen saknar betydelse för bedömningen av vederböran- des vederhäftighet i ekonomiskt hänseende.

Har en fräga om rättelse eller liknande ätgärd tagits tipp efter framställning frän den som uppgiften avser. skall denne kostnadsfritt underrättas om huruvida sädan ätgärd vidtagits.

(Jfr 12.5 i promemorieförslaget). I paragrafens andra stycke har. i ("iverensstämmelse med vad som föreslogs i departementspromemorian. tillförts en bestämmelse som innebär att reglerna för tryckta skrifter kommer att omfatta även sadana stenciler m. in. som enligt 1 kap. 5 sftryckfrihctsförordningen jämställs med tryckt skrift (jfr avsnittet 4.2.11). Vidare har. med anledning av en anmärkning i datainspek- tionens remissyttrande. i andra stycket gjorts ett tillägg som klargör att även skyldigheten att rätta eller komplettera en uppgift som har lämnats i periodisk skrift gäller endast om uppgiften har lämnats under den senaste tolvmänadersperioden. Detta innebär inte nägon saklig ändring i förhallande till vad som har avsetts vid paragrafens tillkomst (se prop. 19732155 s. 152).

Vissa frägor rörande tillämpningen av 12 & har behandlats i avsnittet 4.2. *. Vidare har i anslutning till 7 % berörts ett särskilt problem som har anknytning till 12 s och som gäller förekomsten i företagsupplysningar av uppgifter om ogrundade ansökningar om betalningsföreläggande c. d.

Register som används i kreditupplysningsverksamhet fär överlt'itas eller upplätas till annan endast efter medgivande av datainspektionen.

Den som upphör att bedriva kreditupplysningsverksamhet ellersnm avser att flytta sådan verksamhet till ett annat land eller att kassera en register som används i sådan verksam/n'! skall anmäla detta till datainspektionen. lnspektionen föreskriver i sådana fall hur det skall förfaras med register som berörs av åtgärden.

(Jfr 13.5 i promemorieförslaget). Första stycket. I första stycket föresläs inte nägon saklig ändring. Som har framhällits i departementspromemorian. med anledning av ett uttalande i datainspektionens promemoria om kreditupplysningslagen. omfattar bestämmelsen även en sädan begränsad upplätelse av ett register som innebär att nägon erhäller rätt att använda registret tillsammans med upplätaren.

Andra stycket. F. n. f("ireligger anmälningsplikt enligt andra stycket. om någon upphör att bedriva kreditupplysningsverksambet. Enligt ett motivut- talande vid lagens tillkomst avses härmed även det fallet att nägon som

[3 s* KUL

Prop. 1980/81:10 135

bedriver kreditupplysningsverksamhet här i landet ämnar flytta över verksamheten till utlandet (se prop. 1973: 155 s. 153 f). Vid remissbehand- lingen av departementspromenrorian. där nägon ändring inte föreslogs pä denna punkt. har frän domstolshäll framhallits att detta motivuttalande knappast har täckning i den gällande lagtexten. Nled anledning av detta har en uttrycklig bestämmelse om flyttrringsfallet tagits in i andra stycket. Bestätnnrelsen har utformats sä. att anrrrälrringsskyldighet föreligger även när nägon avser att flytta endast en del av en här bedriven kreditttpplys- ningsverksamhet till utlandet.

1 sin promenroria om kreditupplysningslagen uppgav datainspektionen att det i samband nred företagssammanslagningar eller vid en övergang till ADB fi'irekommer att register som har använts i kredittrpplysningsverksamhet kasseras. trots att verksamheten fortsätts. Enligt inspektionen borde det i hithörande situationerföreligga skyldighet att anmäla avsikten att kassera ett register. 1 enlighet med vad som har f("fu'eslagits i departementspromemorian har 13 å andra stycket kompletterats nred en bestämmelse av den innebi'år- den.

ns

Den som är eller har varit verksam i kreditupplysningsverksamhet far inte ('rbehörigen röja eller utnyttja vad han till följd därav fätt veta om enskildas personliga ft'frrhi'rllarrden eller om yrkes- eller a]_'/'iirslrenrlig/reter.

(1 departementspromemorian föreslt'rgs inte någon ändring av 14 55). Den ändring som nu föresläs är endast spräklig och innebär en anpassning till terminologin i den nya sekretesslagen (se prop. 1979581130 om följdlag- stiftnirrg till den nya sekretesslagen. s. 45).

Som har framhällits i nämnda proposition skall den nya sekretesslagen. som träder i kraft den 1 januari 1981 . ersätta i princip samtliga föreskrifter i annan lag om tystnadsplikt för offentliga funktionärer. Förde fall då en sådan föreskrift gäller säväl för offentliga funktionärer som för enskilda bör den enligt propositionen kompletteras med en bestämmelse som innebär att i det allmi'innas verksamhet i stället tillämpas bestämmelserna i sekretesslagen (se a. prop. s. 44 f).

Hos det allmänna torde det inte f. n. förekomma nägon verksamhet som kan anses omfattad av kreditupplysnirrgslagerrs bestämmelser om kreditupp- lysningsverksamhet. Nagot tillägg av det nyss angivna innehället till 14 s är därför i dagens läge inte päkallat. För den händelse en tillämpning av lagen i det allmännas verksamhet framdeles skulle aktualiseras fär frägan om en samordning av 14 ö med sekretesslagen tas tipp på nytt.

14 s KUL

Prop. 1980/81:10 136

lös

Datainspektionen har rätt att företa inspektion hos den som bedriver kreditttpplysningsverksamhet och att ta del av samtliga handlingar som rör verksamheten.

Den som bedriver kreditupplysningsverksamhet skall lämna datainspek- tionen de upplysningar om verksamheten som inspektionen begär för sin tillsyn.

Bedrivs kreditupplvsnin_gsverksam/tet genmn utgivande av tryckt skri/t eller annan skrift som avses i I kap. 5 s* try:'k_/'riltetsfr')'rördningen. skall den som bedriver verksamheten inom en vecka efter utgivandet kustmtdsfritt tillställa datainspektionen ett e.t'emplar av skri/1en.

(Jfr tas i promemorieförslagetl. I det nya tredje stycket har. i överensstämmelse med vad som har sagts i avsnittet 4.2. 1 1. tagits in en bestämmelse om skyldighet för den som bedriver kreditupplysningsverksamhct genom att utge tryckt eller därmed jämställd skrift att inom en vecka efter utgivandet kostnadsfritt leverera ett exemplar av skriften till datainspektionen. Lev-'eransplikten är straffsanktionerad enligt 19ä i dess nya lydelse.

19 .S'

Till böter eller fängelse i högst ett är döms den som uppsätligen eller av oaktsamhet

1. bedriver" kreditupplysningsverksamhet utan jk'ireskrivet tillständ. 2 . bryter mot 6—9 s. 13 s*fötsta stycket eller andra stycket_l'örsta meningen eller 16 $$ tredje stycket.

3. bryter motjöreskri/t som meddelats enligt 4 s*" andra styr-ket. 13 s* andra stycket andra meningen eller 17 s*. eller

4. lämnar osann uppgift i sådana fall som avses i ltls' eller lb & andra stycket eller i ett meddelande enligt Il ä' såvitt angårjör/ui/landen söm avses i l l s* första eller andra stycket eller tredje stycket _l'örsta meningen.

'l'ill höter döms den som uppsåtligen föranleder att den som bedriver kreditupplysningst'erksam/tet. i annatfa/I än som avses i 9 # andra meningen. lämnar ut en parsunupplysning till någon som inte på grund av ingånget eller Ifrågasatt kreditavtal eller av liknande anledning ltar behov av upplysningen. ] ringa fall döms dock inte till ansvar.

(Jfr 19 å i promemorieförslaget). Paragrafen innehäller straflbestätnmelser. Fi:")rutom vissa sakliga ändring- ar. bl. a. införande av en straffbestämmelse för obehörig beställning av personupplysning. har gjorts en redaktionell omarbetning av de nuvarande reglerna.

Första stycket. Hänvisningen i punkt 2 till 13 å andra stycket första meningen innebär att även en underlåtenhet att anmäla avsikt att kassera ett register som används i kreditupplysningsverksamhet kan medföra straffan- svar. Vidare har i punkt 2 tagits upp en bestämmelse om straff för den som

1 Andra stycket har lätt en nägot annan lydelse i propositionsförslaget.

[() och 19 555 KUL

Prop. HSO/81:10 _ 137

underläter atti rätt tid tillställa datainspektionen ett exemplar av skrift som avses i det nya tredje stycket av lh 9". Här får hänvisas till avsnittet 4.2. ll och till specialmotiveringen till de bäda nämnda paragraferna. [ övrigt motsvarar bestämmelsen under punkt 2 vad som gäller f. n.

l'li'invisningen ipn/tkr.? till 4 & andra stycket innebär att straff kan ädömas även den som bryter mot en föreskrift om skyldighet att anmäla ändring av förhållande som haft betydelse för ett meddelat tillständ. [ fraga om de krav som bör ställas på en sadan föreskrift fär hänvisas till specialmotiveringen till 4 5.

När det gäller hänvisningen i punkt 3 till 13 & kan nämnas att hittills endast själva anmälningsskyldigheten enligt paragrafen har varit straffsanktione- rad. 1 departementsprmnemorian har föreslagits att straff skall kunna ädömas också om nagon åsidosätter en sådan föreskrift rörande hantering av register som datainspektionen meddelar enligt 13.5- andra stycket andra meningen i paragrafens nya lydelse. H'trslaget har godtagits av praktiskt taget samtliga remissinstanser. Med hänsyn till vikten av att en föreskrift av ifrägavaramle slag iakttas har promemorieft'irslaget följts. Den nya straffbev stämmelsen har tagits upp under ft'irevarande punkt.

I övrigt överensstämmer punkten 3 med vad som nu gäller. l'inligt punkt 4 kan straff adömas den som lämnar osann uppgift i registerbesked enligt l() &. vare sig beskedet består i ett registerutdrag eller i ett meddelande om att uppgifter inte finns registrerade om den som har begärt beskedet. Detta innebär inte nägon ändring i förhallande till vad som gäller i dag. Vidare är. liksom f. n.. ett lämnande av osann uppgift i upplysning som datainspektionen enligt 16 i andra stycket har begärt för sin tillsyn straffsanktionerat.

Under punkt 4 upptas vidare bestämmelser om straff för den som lämnar osann uppgift i meddelande enligt ll 5. Dessa bestämmelsergäller för de fall att det i en s. k. personupplysningskopia enligt ll & första stycket lämnas en osann uppgift om vad personupplysningen innehaller beträffande den som avses med upplysningen eller att det därvid lämnas en Osann uppgift om vein som har begärt upplysningen. Vidare omfattar bestämmelserna det fall att det i en kreditupplysningskopia enligt ll s andra stycket till enskild näringsidkare e. d. lämnas en ösann uppgift om de faktiska uppgifter som kreditupplysningen innehäller beträffande denne. Bilde i fall som avsesi l l s* första stycket och i fallsom avsesi ] l sandra stycket kan straff vidare ädömas den som lämnar en osann uppgift om huruvida det som ett led i upplysningen harlämnats uppgifter m. m. även om annan enskild person. Detsamma gäller om det lämnas en osann uppgift om den andra personens namn.

I enlighet med vad som har anförts vid 1 1 & bör det inte vara straffbart att i ett meddelande enligt 11 i första stycket helt utelämna uppgift om vem som har begärt personupplysningen. Om ett meddelande enligt 1 l & första eller andra stycket innehäller att det som ett led i upplysningen har lämnats uppgifter m.m. även om annan enskild person bör det inte heller vara straffbart. om den personens namn utelämnas. De nu nämnda uppgifterna

19 s* KU].

Prop. l980/81:l(l 138

kan dock framtvingas genom vitesförcläggande enligt 22 &. I övrigt bör. när det gäller meddelande enligt ll &. ett förtigande jämställas med en positiv. osann uppgift.

.-—"tndru stycket. Här har tagits upp den nya bestämmelsen om straff för den som -- genom vilseledande eller pä annat sätt uppsätligen föranleder att den som bedriver kreditupplysningsverksamhet lämnar ut en personttpplysning för att användas av nägon som inte har ett legitimt behov av upplysningen. Beträffande bakgrunden till detta s. k. beställaransvar ftir hänvisas till avsnittet 4.2.4. Som framgär av vad som har sagts där är bestämmelsen om beställaransvar avsedd att komplettera regeln i 9 s. vilken riktar sig till den som bedriver eller annars är verksam i kreditupplysningsverksamhet. samt det straffansvar för en sådan person som följer av lt) & första stycket vid brott mot 9 &. Bestämmelsen i andra stycket har därför utformats med nära anknytning till 9 s. Den tar sikte pä att förebygga och straffa ett utpräglat missbruk av möjligheten att frän ett kreditupplysningsföretag e. d. fä ut personupplysningar. Ansvaret har i överensstämmelse med detta begränsats bl. a. till att gälla uppsatliga handlingar. litt straffansvar för beställare redan vid oaktsamhet skulle kunna föra alltför langt.

Ansvar enligt andra stycket kan för det första drabba den som begär en personupplysning för att själv använda den. trots att han inte har nagot legitimt behov av upplysningen. Den som bedriver kreditupplysningsverkv samheten eller nägon som är i dennes ställe torde i dessa fall ofta ha vilseletts om beställarens behov av upplysningen. För att straff skall kunna ädömas enligt andra stycket krävs dock inte att nägot vilseledande genom lämnande av osanna uppgifter e. d. har förekommit. Det är tillräckligt att beställaren ästadkommer att upplysningen lämnas ut till honom fran kreditupplysnings- företaget. lluruvida nägon hos företaget enligt lf) & första stycket kan fällas till ansvar för själva utlämnandet av upplysningen saknar i och för sig betydelse. Som framgär av avsnittet 4.2.4 törekmnmer det i stor omfattning att kreditupplysningslöretag levererar personupplysningar via datatermina- ler som är stationerade hos företagets abonnenter. ()m nagon med utnyttjande av en sädan terminal tar ut en personupplysning som han inte har legitimt behov av kan det knappast sägas att kreditupplysningsföretaget vilseleds att lämna ut upplysningen. l regel torde det i ett sädant fall inte heller bli aktuellt att fälla nägon hos kreditupplysningslf'iretaget till ansvar enligt l9s' första stycket. Den som tar ut upplysningen kan likväl ädömas straff enligt andra stycket.

Bestämmelsen i andra stycket kan ocksä bli tillämplig i fall da nägon för annans räkning begär en personupplysning frän ett kreditupplysningsföretag e. d. och den som skall använda upplysningen saknar legitimt behov av den. Som ett exempel kan nämnas att den som är anställd hos ett företag beställer en personupplysning som skall användas av företaget trots att detta inte har legitimt behov av den. I ett sädant fall kan den anställde dömas till straff enligt andra stycket. om han med vetskap om nämnda förhällande beställer

195. KUL

Prop. 1980/81 :10 139

upplysningen och denna lämnas ut. Har den anställde av annan. t. ex. sitt förman. beordrats eller annars uppmanats att beställa upplysningen katt denne senare drabbas av ansvar enligt andra stycket. 1 sädana fall torde straffansvar enligt förevarande bestämmelse i regel inte aktualiseras för den anställde som verkställer beställningen.

För att ansvar enligt andra stycket skall inträda är det tillräckligt att persrmupplysningen. när den lämnas ut frän ett kreditupplysningsföretag e.d.. är avsedd att användas av nägon som saknar legitimt behov av upplysningen och att den som föranleder att upplysningen lämnas ut härvid känner till detta förhällande. Å andra sidan framgär av bestämmelsens lydelse att den inte avser det fallet att nägon som legitimt har fatt ut en personupplysning först därefter beslutar eller förmäs att lämna ifrän sig upplysningen till nägon som inte har legitimt behov av den. 1—"rägan om ett eventuellt ansvar för ett sädant förfarande hör inte hemma i förevarande sammanhang.

Det bör vidare framhällas att ansvar enligt andra stycket inte kan ädt'fnnas den som föranleder att en personupplysning lämnas ut till nägon som har ett sädant legitimt behov av upplysningen sotn sägs i andra stycket. även om förfarandet frän andra synpunkter kan framstä som obehörigt. llär äsyftas främst det fallet att nägon. anställd eller uttmtstäende. olovligen utnyttjar en annans abonnemang hos ett kreditupplysningsföretäg till att skaffa sig en personupplysning som han har legitimt behov av. Huruvida nägon form av ansvar kan utkrävas i sädana fall fär bedömas enligt andra regler som kan vara tillämpliga.

Beskrivningen av vad som i sammanhanget skall anses grunda ett legitimt behov av en personupplysning ("överensstämmer med den som finns i 9 =". Det skall sälunda vara fräga om att beställaren behöver upplysningen pä grund av ingänget eller ifrägasatt kleditavtal eller av liknande anledning. I denna del får hänvisas till prop. 1973. 155 s. 104 och 148. Av vad som har anförts där framgär att det ibland kan vara vanskligt att bedöma huruvida nägon katt anses ha ett legitimt behov av en personupplysning eller inte. Som tidigare har understrukits är bestämmelsen i 19 s" andra stycket avsedd att tillämpas endast i fall där det mäste anses föreligga ett klart missbruk av möjligheten att få ut en personupplysning frän den som bedriver kreditupplysningsverksam- het. Mot den nu angivna bakgrunden föreskrivs i sista meningen att ansvar inte skall ädömäs i ringa fall.

20?"

Har kreditupplysningsverksamhet bedrivits utanfr'ircskrive/ tillständ. skall register som använts i verksamheten förklaras förverkat. om det ej är uppenbart obilligt. Detsamma gäller. om register överlätits eller upplätits i strid med 13.5 första stycket eller om _]i'ircxkrfft som met/delats enligt 13 s* (uzdm stycket (uu/ra nte/tingen (fi./Fifi”.

20 sf KUL

Prop. HSO/81:10 14t1

(.lfr Ztls" i promcmorieförslaget ). Paragrafen har kompletterats sä att förverkande. om det inte är uppenbart obilligt. skall ske även för det fall att nägon inte har följt en föreskrift av datainspektionen om hur det skall förfaras med ett register i samband med att kreditupplysningsverksamhet upphör m. ut.

Om den som bedriver kreditupplysningsverksamhet inte fullgör vad som äligger honom enligt 111. 11 eller 12 &. fär datainspektionen förelägga vite. Detsamma gäller. om den som bedriver sädan verksamhet underläter att lämna tillgang till handling eller att lämna upplysning i fall som avses i los jörsta eller andra .s'ti't'kct.

(I departementspromemorian föreslogs inte nägon ändring av 22 15). 1 lb 35 har i ett nytt tredje stycke tagits in en bestämmelse om skyldighet för den som bedriver kredituppl_vsningsverksamhet genom att utge tryckt eller därmed jämställd skrift att inoin en vecka efter utgivandet kostnadsfritt leverera ett exemplar av skriften till datainspcktioncn. Lev-'eransplikten är straffsanktionerad enligt 19 s i dess nya lydelse. Det finns inte behov av att därjämte ge möjlighet att framtvinga fullgörande av leveransplikten genom vitesföreläggande enligt förevarande paragraf. 1 andra meningen har gjorts ett tillägg som klargör denna begränsning av möjligheten att använda vitesföreläggande till fall som avses i los första eller andra stycket.

O1'ereårigslmvn'inznzc/xt'r

Denna lag träder i kraft. sävitt avser upphävandet av IH & den 1 januari 1981 och i övrigt den 1 juli 1981.

Utan hinder av första stycket far datainspektionen i ett tillständsärende som avgörs före den 1 juli 1981 meddela fi'ireskril't enligt 4 s'andra stycket om skyldighet att anmäla ändring av visst f("irhi'illande. sävitt angär tid frän och med nämnda dag.

Ikraftträdandet och övergängsbestämmelserna har behandlats i avsnittet 4.5. till vilket här fär hänvisas.

6.2. Förslaget till lag om ändring i inkassolagen 1 s

Denna lag gäller ini/rivning av egen eller annans fordran genom krav eller annan inkassmimlir:l ( inkassoverksam/a'!). il-Ictl inkaxxoiitglirrl förr!/ix åtgärd som innebär annan påtryckning pli gäldenären [in angivande av tid ji'ir heta/ning eller uppgi/i om att for(/ringen. om den inte betalar, kommer att återlämnas till någon mrnan för inkasso.

Burmilla/ldr! cnskilrla ln'rsoncizr eller (lötlslmns int/rivning ar egna./"(.a'tlring-

22 s” och övergångs— bestäm/nelse/' K UL

Inkassolagen (IL)

Prop. HSO/81:10 141

ar lil/("impar lagen endast mn jon/ringen har uppkommit i ttt'iringvt'erkvamltet eller har övertagits för indrivning. Lagen giiller ej exekutiva tnyntlig/teters verksam/tet.

(.lfr 1 ä' i promemorieförslaget). Paragrafen anger lagens tillämpningsomräde. som enligt fi'ärslaget utvidgas i fi.")rhällande till vad som hittills har gällt. Frägan härom har behandlats utförligt i avsnittet 4.3.1.

Av paragrafen följer att lagen i fortsättningen komtner att gälla för praktiskt taget all indrivning av fordringar som sker med vidtagande av inkassoätgärder. Sädan indrivning kallas i lagen inkassoverksamhet. Undan- tag görs endast för dels enskilda fysiska personers eller dödsbotts egna ätgärder för indrivning av egna fordringar. förutsatt att f("trdringen varken har uppkommit i näringsverksamhet eller har övertagits för indrivning. dels exekutiva mytu'ligheters verksamhet.

Annorlunda ttttryckt innebär bestämmelserna i första och andra styckena till en början att lagen omfattar all inkassoverksamhet som avser indrivning av en fordran för atmans räkning eller av en fordran som har övertagits för indrivning. l sistnämnda fall är det. rättsligt sett. fräga om indrivning av egen frn'dran. När det gäller indrivning av egen fordran i övrigt omfattar lagen för det första all inkassoverksamhet som avser indrivning av egen fordran som har uppkommit i näringsverksamhet. Vidare omfattar den all inkassoverk— samhet som avser indrivning av egen fordran som tillkommer annan juridisk person än dödsbo.

Till skillnad från vad som hittills har gällt uppställs inte längre nägot krav pä att det skall vara fräga om en inkassoverksamhet som kan betecknas som yrkesmässig. Detta innebär bl. a. att lagen kommer att omfatta även inkassoverksamhet som är av tillfällig natur och avser en enstaka fordran. Vissa av lagens bestämmelser gäller dock inte för sädan mindre omfattande inkassoverksamhet. Detta anges uttryckligen i dessa bestämmelser.

En särskild fräga. sotn datainspektionen tog upp i sin promemoria rörande inkassolagen. är i vad män lagen katt anses tillämplig pä internationellt bedriven inkasstwerksamhet. Som har framhallits i departetnentspromemo- rian torde denna fräga med hänsyn till lagens uppbyggnad inte kttnna ges nägot enkelt och generellt svar. 1 viss utsträckning mäste ändamälsövervä— ganden bli avgi'irande. Spörsmälet lätnpar sig därför bäst för bedömande i sädana enskilda fall som kan komma ttpp i den praktiska tillämpningen. Nägra riktlinjer kan dock anges.

Som har sagts i promemorian torde de bestämmelser av offentligrättslig natur som är avsedda att ge gäldenären ett skydd mot otillbörliga inkassoatgärt'ler i princip vara tillämpliga pä all inkassrn'erksamhet som riktar sig tuot gäldenärer i Sverige. även om verksamheten bedrivs från ett annat land. Ett utländskt rättssubjekt bör sälunda ha datainspektionens

tillstand för att häri Sverige fä utöva inkassoverksamhet sotn är av sadan art

] .fi IL

Prop. 1980/81: lt) 142

och omfattning att den omfattas av tillstandspliktcn enligt reglerna i 2 s. lnkassm'erksamhet som bedrivs frän ett annat land mot gäldenärer här i Sverige stär också i och för sig ttnder datainspektionens tillsyn enligt lagen. och inspektionen kan utfärda föreskrifter för verksamheten. Som har päpekats av justitiekanslern i dennes remissyttrande torde denna möjlighet dock ha ett begränsat praktiskt värde. eftersom nägra sanktioner aldrig kan användas mot rättssubjekt som driver sin verksamhet frän utlandet.

Det förekommer ocksä ittkassoverksamhet som bedrivs frän Sverige och riktar sig mot gäldenärer i utlandet. Enligt vad datainspektionen uppgav i sin promemoria har flera större svenska inkassoföretag dt.)tterbolag sotn har specialiserat sig pä inkassm-erksamhct över gränserna.

lenlighet med vad sorti har anförts i departetuentspromemorian mäste den som sälttnda i egenskap av ombud eller annars driver inkasst.)v-'erksamhet frän Sverige anses skyldig att ha tillständ till verksamheten. om denna är sädan att den faller ttnder tillständsplikten enligt inkassolagen . [ sammanlutnget kan anmärkas att kravet pä tillständ har ställts upp bl. a. av hänsyn till fordringsägat'nasittppdragsgivarnas intressen (jfr avsnittet 4.3.2). Verksam- heten stär ttnder tillsyn av datainspektionen. Skyldighet torde i och för sig föreligga att iaktta bestämmelserna om god inkassosed i 4—8 ss inkassolagen även i fall dä verksamheten riktar sig mot en gäldenär i ett annat land. lin annan sak är att dessa bestämmelser och eventuella föreskrifter av datainspektionen. som har päpekats i departetnentspromemorian. kan fä äsidosi'ittas om de till äventyrs skulle visa sig stä i strid med rättsregler i det land där gäldenären finns eller om de pä grttnd av innehället i sädana rättsregler skulle leda till att borgenärens rätt äventyras eller omintet- görs.

Första stycket. 1 enlighet med vad som har utvecklats i avsnittet 4.3.1 avgränsas lagens tillämpningsomräde här genom att begreppen inkassoverk- samhet oeh inkassoätgärd definieras närmare. Som framgär av det nämnda avsnittet är syftet härmed främst att lämna tttrytntne för att en borgenär eller dennes ombud sänder ut enkla betalningspi'tminnelser till en gäldenär utan att det blir fräga om inkasstwerksamhet i lagens mening. En av de frän praktisk synpunkt viktigaste följderna av dessa clefinitirmer är att bestäm— melserna i 5 s*om utformningen av krav motgäldenären inte behöver iakttas. om en anmaning till denne att betala en skuld inte förenas med annan pätryckning än angivande av en tner eller mindre bestämd —tid inom vilken borgenären önskar erhälla betalning eller uppgift om att ft.")rdringen. om den inte betalas. kommer att överlämnas till nägon annan för inkasso.

Det är självfallet inte möjligt att utti'immande ange de andra pätryckningar mot en gäldenär. vilka medför att en anmaning till denne att betala blir att betrakta sotn en ittkassoätgärd i lagens mening. Normalt är det fräga om att gäldenären hotas med rättsliga eller exektttiva ätgärder. med att ett kreditavtal eller ett annat avtal kan komma att sägas tipp eller med att borgenären kan komtna att innehälla en prestation som han annars

Prop. 1980/81: 10 143

fortlöpande tillbandabäller gäldenären. t. ex. leverans av elektrisk ström eller anslutning till teleftitnnätet.

Andra stycket. Som redan tidigare ltar framgätt avser det undantag frän tillämpningen av lagen som följer av andra stycket endast enskilda fysiska personers eller dödsbotts egna ätgärder för indrivning av egna fordringar. Som har fratnhällits i departementspromemorian skall med enskild persons egna ätgärder för indrivning av fm'dran givetvis jämställas i'ttgärder sotn vidtas av den som i egenskap av förmyndare eller god man är legal ställföreträdare för personen i fräga. Sotn ett dödsbos egna ätgärder för indrivning av en fordran bör anses ätgärder sotn vidtas av dödslmdelägare eller boutredningsman.

Tredje stycket. Undantaget för exekutiva myndigheters verksamhet

motsvarar vad sotn gäller f. n. 2 ä'

lnkassoverksamhet. sotn avser indrivning av fordringar för annans räkning eller fordringar som har övertagits för indrivning. fär bedrivas endast efter tillständ av datainspektionen.

Om inkassm'erksantheten utgör ett nndemnlnat led i en annan verksamhet och båda i'erksamheterna bedrivs titanfört't'irt'ssyj'le eller om inkassaverksam- lteten bedrivs av en_l'r'iretagj'lir ett annar/iiretag inom santnta koncern. behövs til/saint! endast ifall då inkassoverksam/teten at'serfordringttr som tillkrnn/ner eller har övertagits från nagon som inte utan tills/(ind enligt denna lag ltade ktntnat driva in jon/ringarna.

Tillständ behövs ej för inkassrwerksamhet sotn (ir av till/i'il/ig natur och avser endast enstaka _/'urdringar eller .WHH bedrivs av Sveriges riksbank. Sveriges investeringslnrnk AB.]Tiretag under bankinspektionens tillsyn eller advokat.

(.lfr 2 s i promemmieförslaget'). Paragrafen anger i vilka fall det krävs tillständ av datainspektionen för att bedriva inkassoverksamhet. Frägan om tillständspliktens omfattning har behandlats i avsnittet 4.3.3. När det gäller kravet pä tillstand för internatio- nellt bedriven inkasstn'erksamhct med anknytning till Sverige fär hänvisas till vad som har anförts ttnder 1 s.

Första stycket. l-lär äterfinns huvudregeln om datainspektionens tillständ för att bedriva inkassoverksamltet. Den överensstämmer med vad som gäller f.n. Det bör dock observeras att begreppet inkassoverksamhet utvidgas nägot till följd avdcn föreslagna ändringen av 1 35. vilket medför att kravet pä tillständ utsträcks i tnrnsvaratule män. Genom undantagen i andra och tredje styckena inskränks ä andra sidan det tillständspliktiga omrädet i förhallande till den nuvarande huvudregeln.

Andra stycket. De ttndantag frän tillständsplikten som följer av andra stycket utgör. i vart fall i huvudsak. nyheteri förhällande till vad som gälleri dag. De har utförligt behandlats i avsnittet 4.3.2. Som framgär där är syftet

' Andra stycket har fatt en nagot annan lydelse i propt»sitionsförslagel.

.?s'fIL

Prop. l980/8lzltl 144

med de nya utulantagsreglerna bl. a. att frän tillständsplikt undanta en del fall i vilka kravet pä tillständ och tillständsprövningen kan uppfattas sotn utslag av en onödig byri'ikrati.

(ienom andra stycket undantas frän kravet pä tillständ för det första sädan inkassoverksarnhet som bedrivs utan föt'vi'irvssyfte. trnder fi'irutsättning att inkassoverksamheten ingär som ett led i en annan verksamhet. som ocksä den bedrivs utan fi'irvärvssyfte och dessutom framstär som dominerande i fifrrhällande till inkassoverksamheten. l-lärigenom avses att frän tillständs- plikt undanta bl. a. fackliga och andra ideella organisationer. vilka som en service ät medlemmarrur bedriver inkassoverksarnhet avseende deras ford- ringar men väsentligen har andra uppgifter. litt annat fall som omfattas av den nu berörda undantagsregeln i andra stycket utgörs av den inkassoverk- samhet som en del kommuner bedriver för t. ex. krnnmunala bolags eller stiftelsers räkning. Ytterligare fall kan tänkas.

När det i den nu berörda undantagsbestärnmelsen f("rrutsätts att inkasso- verksamheten utgör ett underordnat led i en annan verksamhet r'tsyftas att den andra verksamheten rent faktiskt skall vara den dominerande. Som har framhallits i departementspromemorian bör det alltsä inte vara möjligt att undgä tillständsplikten genom att exempelvis bilda en förening som visserligen enligt sina stadgar huvudsakligen skall fullfölja ett annat ärtdamäl men som i praktiken väsentligen sysslar med inkassoverksarnhet för medlemmarruts räkning.

Genom andra stycket undantas vidare frän kravet pa tillständ sädan inkasswerksamhet som bedrivs av ett företag för ett annat företag inom samma koncern. 1 fräga om skälen för detta nya ttndantag frän tillständsplik- ten fär hänvisas till avsnittet 4.3.2. Begreppet koncern har här samma innebörd som i l & kreditupj'tlysningslagcn. | den delen kan hänvisas till vad som har sagts i specialnmtiveringen till den bestämmelsen.

De undantag frän tillständsplikten som nu berörts gäller emellertid inte oinskrl'inkta. Tillständ krävs sälunda enligt andra stycket även för sädan inkassoverksamhet som nyss har nämnts. om och i den män verksamheten avser fordringar som tillkommer eller b ar övertagits frän nägon som inte titan tillständ enligt lagen hade kunnat driva in fordringarna. Som framgär av vad som har sagts i avsnittet 4.3.2 är avsikten med denna inskränkning att hindra att en annars gällande tillsti'rndsplikt kringgäs med utnyttjande av de berörda undantagsreglerna. Det bör päpekas att nägon nurtsvarande inskränkning inte äterfinns i undantagsregeln i tredje stycket. (..)m exempelvis ett koncernföretag tillfälligtvis driver in enstaka fordringar som tillkommer eller har övertagits frän ett annat företag inom koncernen. behövs alltsa inte tillständ för denna inkassrn'erksamhct även om det senare företaget inte självt hade kunnat driva in fordringartur utan tillständ enligt lagett.

Tredje stycket. Undantaget för inkassoverksamhet som är av tillfällig natur och avser endast enstaka fordringar är avsett att motsvara vad som hittills har gällt pä grund av att zs enligt lagens tidigare lydelse endast omfattat

Zäll,

Prop. 1980/81 : 10 145

yrkesmässig inkassoverksamhet.

] enlighet med vad som har sagts i avsnittet 4.3.2 har det nuvarande undantaget för inkassoverksamhet som bedrivs av kreditinrättningar under bankinspektionens tillsyn utvidgats till att omfatta 'alla företag under bankinspektionens tillsyn. De företag som sälunda undantas från tillständs- plikt är banker (bankaktiebolag. sparbanker och föreningsbanker). kredit- aktiebolag. fondbolag enligt aktiefondslagen (1974:931) samt stads- och landshypoteksinstitutionerna. Vidare undantas sädana finansbolag som omfattas av lagen om finans_bolag och enligt den lagen stär under bankinspektionens tillsyn. Undantagsregeln i tredje stycket omfattar där- emot inte inkassoverksamhct som bedrivs av ett sädant dotterföretag till de nu nämnda företagen som inte stär under bankinspektionens tillsyn (jfr prop. 1974:42 s. 106 ).

35

Tillständ får meddelas endast om verksamheten kan antas bli bedriven på ett sakkunnigt och omdömesgillt sätt.

Tillständ får meddelas för en tid av högst tio är i sänder. Tillståndet fär förenas med föreskrift om hur verksamheten skall bedrivas och om skyldighet att anmäla tilldring av förhållanden som har haft betydelse för tillståndet.

(Jfr 3 & i promemorieförslaget). I enlighet med förslaget i dcpartementspromemorian har 3 & komplette- rats med en bestämmelse som ger datainspektionen rätt att förena ett tillstånd att bedriva inkassoverksamhet med föreskrift om skyldighet att anmäla ändring av fi.")rhällanden som har haft betydelse för tillständet. Samtidigt har paragrafen av redaktionella skäl delats ttpp på två stycken.

Äsidosättandc av en föreskrift om skyldighet att anmäla ändring av ett visst förhållande kan enligt 17 å i dess nya lydelse medföra straffansvar.

1 övrigt kan beträffande tillägget till paragrafen hänvisas till vad som har anförts i specialtnotiveringen till 4.5 kreditupplysningslagen beträffande det motsvarande tillägg som har gjorts i den paragrafen.

55'

Krav mot en gäldenär skall framställas skriftligt. Kravet skall innehålla tydlig uppgift om borgenärens nanm och ont det förhållande som fordringen grundar sig på. Är det fråga om en fordran som har överlåtits eller pantsatts och kan gäldenären ej med befriande verkan betala till överlåtaren eller pantst'ittaren. skall kravet innehålla en tydlig upplysning om detta förhållande. [ krav bör lämnas anvisning om lämpligt betalningsst'itt. .

Ikrav skall vad som fordras i kapital. ränta och ersättning för kostnader anges var för sig. I fråga om ränta skall särskilt anges beloppet av upplupen ränta. räntesatsen samt den tid och det kapitalbelopp som ligger till grttnd för räntebcräkningcn.

I samband med krav skall anges viss skälig tid inom vilken gäldenären har

' Paragrafen har fått en nägot annan lydelse i propositionsförslaget.

3 och 5 5.6 IL

Prop. 1980/81 : 10 146

att betala frivilligt eller anmäla om han har nägon invi'tndning mot kravet.

(Jfr 5 s i promemorieförslaget). Paragrafen innehäller bestämmelser om utft'n'mningen av krav mot en gäldenär. l förhallande till vad som har gällt tidigare har bestämmelserna kompletterats med en del ytterligare föreskrifter. [ samband med detta har paragrafens indelning i stycken ändrats. De nya föreskrifter som har tillagts aterfinns i första stycket. Ilitltörandc frågor har behandlats i avsnittet 4.3.3.

Bestämmelserna om krav mäste ses i samband med regeln i b s. Enligt den bestämmelsen fär rättslig ätgärd inte vidtas mot gäldenären förrän denne har tillställts ett sädant krav som avses i Så och den i samband med kravet angivna tiden för betalning eller anmälan om invändning har löpt ut.

Som framgår av vad som har anförts i avsnittet 4.3.1 har gränsdragningen mellan vad som utgör krav i inkassolagens mening och vad som kan anses utgöra sadana enkla betalningspäminnclser som inte omfattas av reglerna i 5 % tidigare vallat åtskilliga problem i den praktiska tilli'tmpningen. Genom den nya definitit'men i l &” av begreppet inkassoätgärd. däri inbegripet krav. har gränsen dragits pa ett mera konkret sätt och med hänsyn tagen till de praktiska behoven pä omrädet. Definitionen innebär. som tidigare har framgått. att det över huvud taget inte skall anses föreligga ett krav i den mening som avses i 5 s. om en betalningsanmaning till gäldenären inte förenas med någon annan pätryckning mot honom än angivande av tid för betalning eller uppgift om att ärendet kan komma att lämnas över till annan för inkasso. I detta fall bchöveralltsä de tämligen detaljerade föreskrifternai 5.5 inte iakttas. utan betalningspäminnelscn kan ges en enklare form.

Av det nu sagda följer att borgenären enligt 6 sfär vidta rättslig ätgärd mot gäldenären först sedan denne har tillställts en betalningsanmaning som inte bara uppfyller de föreskrifter som har upptagits i 5 & utan dessutom innehåller någon annan form av påtryckning än de nyss nämnda. Detta torde stå i överensstämmelse med vad som redan tillämpas.

Första stycket. I enlighet med vad som har sagts i avsnittet 4.3.3 har här föreskrivits att ett krav alltid skall innehälla tydlig uppgift om borgenärens namn och om det förhållande som fordringen grundar sig på. Däremot har. av de skäl som har berörts i nämnda avsnitt. inte förts in den i departcmentspromemorian föreslagna bestämmelsen om en ovillkorlig skyldighet att också ange borgenärens adress i kravet. I samband med ett krav mäste det dock alltid anges en adress till vilken gäldenären skall sända en sädan anmälan om invändning mot kravet som avses i paragrafens tredje stycke. [ de fall då borgenären har anlitat ett inkassoföretag eller annat ombud är det naturligtvis i regel ombudets adress som anges.

Bestämmelsen om att ett krav skall innehälla tydlig uppgift om det förhållande som fordringen grundar sig på innebär inte att det krävs nägra

5.51L

Prop. 1980/8lzl0 147

detaljerade uppgifter i detta hänseende. Det fordras dock att gäldenären i själva kravbrevet eller i en handling som fogas vid krav-brevet far sädana uppgifter om grunden för fordringen att han kan identifiera den fordran sorti avses. Är det fraga om en fordran pä grund av lån bör sälunda detta anges jämte datum e. d. för låneavtalet. Avser fordringen ett varuköp eller köp av en tjänst skall uppgift lämnas om detta och om datum för avtalet eller för en tidigare utsänd faktura. Det katt däremot inte anses nödvändigt att kravbrevet i dessa senare fall innehäller uppgift om varans eller tjänstens art. Är det fräga om en fordran pit grund av ett avtal om kontokredit skall detta anges jämte kontots nummer eller beteckning i övrigt. Däremot är det självfallet inte nödvändigt att specificera de olika inköp e. d. som har gett upphov till det utestående kontosaldot. Det bör alltid fordras att grunden för fordringen. i enlighet med de principer som nu har antytts. anges i klartext och inte enbart genom ett nummer eller en annan kod. Det kan inte heller anses godtagbart att grunden för fordringen anges endast genom en hänvisning till en tidigare överlämnad faktura. betalningspäminnelse e. d.. utan uppgift måste i sä fall lämnas om vad fakturan avscr.

I första stycket har vidare tagits upp den nya föreskriften att gäldenären. om han på grund av att fordringen har överlätits eller pantsatts inte kan med befriande verkan betala till överlätaren eller pantsättaren. skall i ett krav erhälla tydlig upplysning om detta förhällande. Beträffande bakgrunden till denna bestämmelse fär hänvisas till avsnittet 4.3.3. Som framgär av vad som har sagts där är syftet med bestämmelsen att motverka att gäldenären av misstag eller förbiseende betalar till en överlätare eller pantsättare och därmed riskerar att behöva betala även till den som är rätt borgenär.

Denna upplysningsplikt kan fullgöras pa ett skäligen enkelt sätt. Det bör sälunda vara tillräckligt att i kravbrevet ta in. utöver en uppgift om den-nye borgenärens namn. en tydlig upplysning om att betalningsskyldigheten enligt kravet kan fullgöras endast genom betalning till denne eller eventuellt till dennes otnbud. En sådan upplysning mäste lämnas endast om gäldenären verkligen inte kan med befriande verkan betala till överlataren eller pz'tntsättaren. Bestämmelsen lägger alltså inte hinder i vägen för sädana arrangemang som har berörts i det remissyttrande som har avgetts av Finansieringsft'jretagens förening och som gär ut på att gäldenären trots en överlätelse eller pantsättning skall med befriande verkan kunna betala till överlätaren eller pantsättaren. Självfallet innebär bestämmelsen inte heller någon skyldighet för parterna i ett avtal om överlätelse eller pantsättning av en fordran att underrätta gäldenären om överlåtelsen eller pantsättningen. om de inte önskar göra detta.

Bestämmelserna i Så kan sägas beskriva vad som är att anse som god inkassosed när det gäller utformningen av krav mot en gäldenär. De har sålunda inte några direkta verkningar i civilrättsligt hänseende. (')m gäldenären tidigare har underrättats om att en fordran mot honom har överlåtits eller pantsatts kan gäldenären inte med befriande verkan betala till

3"le

Prop. l980/8l : 10 148

överlätaren eller pantsättaren. även om kravet inte på nytt innehåller en upplysning om detta. Däremot kan upplysningen naturligtvis. om gäldenären inte tidigare har fått underrättelse om en överlätelse eller pantsättning. få verkan som en sådan underrättelse (s. k. denuntiation).

l första stycket har slutligen tagits ttpp den nya bestämmelsen om att deti ett krav bör lämnas anvisning om lämpligt betalningssätt. Av de skäl som har anförts i avsnittet 4.3.3 har bestämmelsen getts karaktären av en rekom- mendation. I enlighet med vad som har sagts där är det emellertid angeläget att denna rekommendation följs. Det lämpligaste torde i allmänhet vara att ett helt eller delvis ifyllt inbetalningskort fogas vid kravbrevet.

Arn/ra stycke/. Bestämmelserna i detta stycke har tidigare återfunnits i 5 & första stycket.

Som har framhällits i departementsprometnorian bör det. sävitt gäller ränta som vid tiden för kravet ännu inte är upplupen. vara tillräckligt att i kravet hänvisa till tillämplig bestämmelse i räntelagen (1975:o35) eller i avtal.

I sin promemoria om inkassolagen uppgav datainspektionen att det vid tillämpningen av 5 5 hade uppkommit vissa svårigheter när det gällde att skilja ränta frän kapitalskuld vid fortlöpande krediter av typ kontokrcdit. Kreditbeloppet ökas här genom nya uttag på kontot och minskas genom exempelvis månatliga inbetalningar från kredittagaren. Kreditgivaren debi- terar varje mättad viss ränta på det då utestående kreditbeloppet. Denna ränta läggs påföljande månad till kapitalskulden. Om kredittagaren upphör att göra sina månatliga inbetalningar. kommer en månads drt'ijsmälsränta att varje månad läggas till kapitalbeloplpet. Datainspektionen framhöll att detta kunde ha skett vid flera tillfällen innan ärendet överlämnades till inkasso. vilket enligt inspektionen medförde problem eftersom vad som fordras i kapital och vad som fordras i ränta skall anges var för sig enligt 5 5. Enligt inspektionen borde dröjsmålsränta inte heller i de nu berörda fallen fä kapitaliseras under sin löptid.

Som har framhållits i departctnentsprotnemorian bör frägan om angivande av ränteanspräk när ett krav bottnar i ett kontokurantförhållande lämpligen lösas genom anvisningar av datainspektionen. Bl. a. torde det vara avgöran- de vad avtalet mellan parterna innehäller i fråga om ränta och hanteringen av upplupna räntefordringar. [ enlighet med vad som har sagts i promemorian synes det därför inte uteslutet att upplupen ränta i vissa fall av kontokurant- fi.")rhällanden betraktas som en kapitalfordran vid tillämpningen av 5 5. Som exempel kan nämnas den av Kooperativa förbundet berörda situationen att upplupen ränta kapitaliseras enligt avtal eller enligt sedvänja på området. Som vidare har understrukits i promemorian är bestämmelserna i Så av sådan natur att inspektionen inte kan anses förhindrad att i särskilt besvärliga fall söka praktiska lösningar sotn svarar mot syftet bakom bestämmelser- na.

l departementspromemorian har vidare. med anledning av vissa anmärk-

5.51L

Prop. l980/8l:10 149

ningar från datainspektionens sida. tagits upp en fråga om ränteangivclse i krav. vilken rör sambandet mellan bestämmelserna i 5 och 6 ååå. l promemorian har framhållits att det i princip strider mot god inkassosed att borgenären när han vidtar en rättslig åtgärd mot gäldenären framställer betalningsanspräk, t. ex. anspråk på ränta. sotn gär utöver dem som har angetts i det föregående kravet. Undantag gäller naturligtvis för bl.a. anspråk på ränta som har uppkommit efter den dag då kravet avsändes till gäldenären.

Det förekommer emellertid att en borgenär är beredd att avstå från dröjsmålsränta. om gäldenären betalar efter krav. men däremot önskar göra anspråk på sådan ränta om han måste vidta rättsliga åtgärder mot gäldenären. I sin promemoria rörande inkassolagen uppgav datainspektio- nen att bestämmelserna i 5 och 6 är; i sådana fall hade ansetts innebära att borgenären. för att uppfylla kravet på god inkassosed. måste i kravet framställa ett fullständigt ränteyrkande enligt 5 så men villkora detta yrkande så att anspråket på ränta efterges för det fall att kapitalskulden och eventuella kostnader betalas inom den i kravbrevct angivna tidsfristen. Som har framhållits i departementspromemorian synes det emellertid formalistiskt att fordra att borgenären skall framställa ett fullständigt men villkorat ränteyr- kandc enbart för att han, om betalning inte sker inom angiven tid. skall kunna kräva räntan i ett efterfi'iljande rättsligt förfarande. lenlighet med vad som har sagts i promemorian bör det vara tillräckligt att borgenären i kravet angeratt han. om betalning inte sker inom angiven tid. avser att göra anspråk på ränta samt anger den räntesats. den tid och det kapitalbelopp som i så fall kommer att ligga till grund för ränteberäkningen. Det kan vara lämpligt att datainspektit.>nen utfärdar vissa anvisningar beträffande den nu berörda frågan.

Tredje stycket. Bestämmelserna motsvarar vad som hittills har gällt.

Bestämmelsen i 6 # gäller ej. om gäldenären uppenbarligen söker undandraga sig att betala eller om det annars föreligger särskilda skäl att frångå vad som föratt/trivts" där.

(Jfr 7 så i promemorieförslaget). Paragrafen har ändrats så att hänvisningen till 5 & har uteslutits. [ fråga om skälen till denna ändring får hänvisas till avsnittet 4.3.3.

10%

Medel som har inkasserats för annans räkning skall hållas avskilda. Har medlen uppburits i inkassoverksam/tet som inte är av tillfällig natur och inte avser endast enstaka fordringar. ska/[ de utan dröjsmål insättas på räkning i bank eller tnotsvarande.

7 och 10 5.6 IL

Prop. HSO/81:10 150

()m den sour/iir en borgenärs uppdrag (lll (ll'll'tl i/t enfordrutt hur ett utt/itil. fiir/löpande uppdrag av horgt'niirwt att i väsentlig (inträtt/ting upp/Mira medel för dennes räkning utan skyldig/tet att lui/Ia dessa Ittt'tlt'l avskilda. kan parterna skrijilt'gcn öt'crcnskotntntt om undantag från _l'örsttt stycket.

Mede/sont har inkusserats/"r'ir annans räkning skall utan d röjsmäl redovisas till denne. om ej tttliitii hur avtalats.

(Jfr 1035 i promemorieft'ärslaget). Paragrafen innehåller bestämmelser om hanteringen av medel som har inkasserats för annans räkning. De ändringar som har gjorts i paragrafen har behandlats utförligt i avsnittet 4.3.4.

Fömtu stycket. Ett avskiljande av inkasserade medel enligt huvudregeln i första meningen medför att medlen enligt lagen om redovisningsmedel är förbehållna den för vars räkning de har inkasserats. Som har berörts i avsnittet 4.3.4 innebär utvidgningen av lagens tillämpningsområde att plikten till avskiljant'ie enligt första meningen kommer att gälla även när någon helt tillfälligt inkasserat" en fordran för annans räkning. Det krävs emellertid att inkasseringen har skett inom ramen för vad sotn utgör inkassoverksamhet i lagens tnening. Om någon har i ttppdrag att driva in en fordran för annans räkning och att därvid eventuellt vidta inkassoätgätder i den mening som avsesi l &. bör plikt till avskiljande anses föreligga även om betalning uppbärs innan någon inkassoi'ttgärd ännu har vidtagits. Som har framhållits i avsnittet 4.3.4 är bestämmelsen om skyldighet att hålla inkasserade medel avskilda däremot inte tillämplig. om den som uppbär betalning för annans räkning inte har ttppdrag att vidta inkassoätgärder och inte heller vidtar sädana åtgärder.

Vad som fordras för att tnedel skall kunna anses avskilda för fordrings- ägarens räkning får bedömas enligt allmänna regler. [ många fall torde det enligt lagen om redovisningsmedel kttntta anses tillräckligt att medlen förvaras i en särskild kassa eller annat särskilt utrymme. t. ex. ett kuvert med påskrift om innehållet. Från fordringsägarens synpunkt är det naturligtvis säkrare. om medlen sätts in på en särskild räkningi bank eller motsvarande. Krav på ett sådant förfarande gäller emellertid enligt andra meningen endast om medlen har uppburits av ett inkassoföretag eller i annan inkassoverk— samhet som inte är av helt obetydlig omfattning. Detta innebär att skyldigheten till ett sådant mera kvalificerat avskiljande kommer att föreligga i huvudsak i samma utsträckning som hittills har gällt pågrund av att lagens tillämpningsomräde har varit begränsat till sådan inkassm'erksamhet som kunnat betraktas som yrkesmässig.

Andra stycket. Genom denna bestämmelse öppnas den i avsnittet 4.3.4 berörda möjligheten för fordringst'igare och inkassoombud att träffa skriftlig överenskommelse om undantag från bestämmelserna i första stycket. De krav som ställs upp för att en sådan överenskommelse skall få träffas torde hindra att möjligheten till ttndantag kan utnyttjas i så stor utsträckning eller i sådana partsförhållanden att den kan få oft'jrdelaktiga följder.

IOQ'IL

Prop. 1980/81:10 151

Tredje styckat. Bestämmelsen motsvarar vad sotn gäller redan i dag. Utvidgningen av lagens tillämpningsområde torde i det här aktuella hänseendet inte behöva medföra något problem.

IOa s*

Register som avser gäldenärer och som (antänds i tillsttitttlspliktig inkasso- verksamltetfiir överlåtas eller upplåtas till annan endast efter medgivit/ale av datuinspektionen.

Den som upp/lör med tillständspliktig.7 inkassoverksam/tet eller som avser att flytta en sådan verksam/tet till ert ("(it/It'll land eller att kassera ett register som används i sådan verksamhet skall anmäla detta till datuinspektionen. lnspektionen f("ireskrivur f sådana fall hur det skul/förfäras med register som berörs av åtgärden.

(Jfr ll)a få i promemorieförslaget). Reglerna i denna paragraf om gäldenärsregister utgör en nyhet i inkassolagen och har utformats efter mönster av 13 & kreditupplysningsla- gen. De är avsedda att undanröja risker för integritetskränkningar och liknande skador som kan uppkomma till följd av olämpliga överlåtelser eller upplåtelser av register eller genom olämpligt förfarande med register i samband med att inkassoverksatnhet läggs ned c. d. Överträdelser av bestämmelserna kan medföra straff enligt 17s i dess nya lydelse samt föt'vcrkande av register enligt den nya 17 a å.

Av skäl som berörts i avsnittet 4.3.5 har bestämmelserna begränsats till att gälla register i tillståndspliktig inkassoverksamhet. Detta torde från integri- tetsskyddssynpunkt vara tillräckligt. eftersom reglerna därmed kommer att gälla för huvuddelen av den kommersiellt bedrivna inkassoverksamheten. Tillståndspliktens omfattning framgår av 2 &.

Paragrafen tar vidare endast sikte på register över gäldenärer. Vanligen torde det här röra sig om en samling av uppgifter rörande personer och företag m. ni. som är eller har varit gäldenärer i ärenden hos den sont har upprättat registret. Detta är dock inte något krav för att reglerna i paragrafen skall bli tillämpliga. Som ett register över gäldenärer i paragrafens mening bör nämligen betraktas varje sådan samling av uppgifter rörande enskilda personer m. fl. som har upprättats för att i en inkassm'erksamhct underlätta identifiering och eftersökande m.m. av gäldenärer. Bestämmelserna är tillämpliga oavsett den teknik med vilken ett register förs. De gäller sålttnda. i likhet med motsvarande regler i kreditupplysningslagcn. även sådana register som faller under datalagen.

Bestämmelserna är tillämpliga på ett register över gäldenärer i nyss angiven mening även om registret innehåller enbart uppgifter om adresser eller andra liknande uppgifter som inte har någon större betydelse från ' integritetsskyddssynpunkt. En annan sak är att datainspektionen i ett sådant fall sällan torde ha anledning att med stöd av inkassolagen motsätta sig

1 Andra stycket har fått en något annan lydelse i propositionslkiirslaget.

10 a s [L

Prop. 1.980/81 : 10 152

exempelvis en överlåtelse av registret. Rör det sig om ett register som omfattas även av datalagen. får hithörande frågor bedömas även med tillämpning av den lagen och eventuella föreskrifter som har meddelats med stöd av den.

Första stycket. Bestämmelsen avser såväl frivillig överlätelse genom köp, byte eller gåva m. rn. som tvångsöverli'ttelse. t. ex. exekutiv försäljning. Den gäller vidare upplåtelser av olika slag, exempelvis med nyttjanderätt eller panträtt. Även vid upplåtelse är det likgiltigt om ersättning för upplåtelsen utgår eller inte. Självfallet avses i första stycket även en sådan begränsad upplåtelse som innebär att registrets ägare kan fortsätta att använda detta vid sidan av den till vilken registret har upplåtits. Reglerna i första stycket gäller också vid överlåtelse eller upplåtelse av en del av ett större register. om denna del är av sådan omfattning m. m. att den med ett naturligt betraktelsesätt kan anses utgöra ett eget register.

Huruvida medgivande till överlåtelse eller upplåtelse skall lämnas får bedömas med hänsyn till syftet bakom bestämmelserna i 10 a &. Registrets omfattning och natur har naturligtvis betydelse, liksom den omständigheten om den till vilken registret skall överlåtas eller upplåtas har tillstånd att bedriva inkassoverksamhet eller inte. I det senare fallet måste beaktas att registret genom överlåtelsen undandras från tillämpningen av Mark inkassolagen . Datainspektionen får givetvis ställa upp villkor för ett medgivande till överlåtelse eller upplåtelse, exempelvis gallring av re- gistret.

Andra stycket. Anmälningsplikten m. m. enligt andra stycket motsvarar vad som gäller enligt Bä andra stycket kreditupplysningslagen i dess nya lydelse. Skyldigheten att göra anmälan när ett register skall kasseras avser endast register över gäldenärer. Detsamma gäller bestämmelsen i andra meningen.

115'

Den som är eller har varit verksam i en inkassm'crksamhet som avser indrivning av fordringar för annans räkning eller fordringar som har ("it-'ertagitsför indrivning får inte obehörigen röja eller utnyttja vad han till följd därav har fått veta om enskildas personliga förhållanden eller om yrkes— eller ajfärshemligheter.

Första stycket tillämpas ej ifråga om den som enligt annan författning är underkastad en motsvarande tystnadsplikt. [ det allmännas verksam/tel tillämpas bestr'immelserna i sekretesslagen ( I 980.100).

(Jfr 11 å i promemorieförslaget'). Tystnadsplikt enligt 11 åinkassolagen har hittills gällt för den som år eller har varit verksam i tillständspliktig inkassoverksamhet. Kravet på tillstånd har i princip gällt inkassoverksamhet som avser indrivning av fordringar för annans räkning eller fordringar som har övertagits för indrivning. Från

' Paragrafen har fått en något annan lydelse i propositionsförslaget.

IIS/L

Prop. 1980/81:10 153

tillständsplikten har dock varit undantagen dels inkasst'werksamhet som bedrivs av Sveriges riksbank. Sveriges investeringslmnk AB. kreditinrättning under bankinspektionens tillsyn eller advokat. dels sädan inkassoverksamhet för annans räkning etc. som är av obetydlig omfattning och som därför inte har betraktats som yrkesmässig.

Enligt l ä i den föreslagna nya lydelsen kommer lagen i fortsättningen i princip att omfatta all inkassoverksamhet som avser indrivning av fordran för annans räkning eller fordran som har övertagits för indrivning. dvs. även om det är fräga om indrivning av en enstaka fordran. Å andra sidan föresläs vissa ytterligare undantag från tillständsplikten (2 :$). Tillstånd skall sälunda i fortsättningen normalt inte krävas för inkassoverksamhet som utgör ett underordnat led i en annan verksamhet. om båda verksamheterna bedrivs utan förvärvssyfte. Detta gäller hl. a. den inkassoverksamhet som vissa intresseorganisationer bedriver för medlemmars räkning. Tillständ skall normalt inte heller krävas för s. k. koncerninkasso.

Som har framhållits i avsnittet 4.3.6 bör emellertid den nuvarande omfattningen av tystnadsplikten enligt ll få inte inskränkas på det sätt som skulle bli fallet. om tystnadsplikten även i fortsättningen anknöts till tillständsplikten. Bestämmelserna i 11 & har därför arbetats om.

Föxrtasfycket. Liksom hittills begränsas tystnadsplikten till att gälla för den som är eller har varit verksam i inkassoverksamhet som avser indrivning av fordringar för annans räkning eller fordringar som har övertagits för indrivning. Det saknar emellertid i fortsättningen betydelse om inkassoverk- samheten är tillständspliktig eller inte. 'l'ystnadsplikt enligt första stycket skall sälunda. med de undantag som kan följa av andra stycket. gälla även i inkassoverksamhet som utgör ett underordnat led i en verksamhet som bedrivs titan förvärvssyfte. t. ex. hos en facklig (.trganisatitm. i inkassoverk- samhet som utgör s. k. ktmcerninkasso och i inkasstwerksamhet som bedrivs av företag som står under bankinspektionens tillsyn.

l huvudsaklig ('werensstämmelse med vad som förordades i departements- promemorian utvidgas tystnadsplikten nu enligt lagen till att gälla även för den som är eller har varit verksam i sädan mindre omfattande inkassoverk- samhet som hittills över huvud taget inte har fallit under lagen. Som har framhållits i promemorian är fordringsägares och enskilda gäldenärers behov av skydd mot spridning av ömtåliga uppgifter som rör dem oberoende av i vilken omfattning ett inkassoombud bedriver inkassoverksamhet. Tystnads- plikten gäller därför även för t. ex. innehavare av juridiska byråer och andra näringsidkare som åtar sig inkassouppdrag. även om denna del av deras verksamhet är av obetydlig omfattning. samt för anställda hos dem som handlägger sädana uppdrag.

Bestämmelsen i första stycket avser endast den som är eller har varit verksam i en inkasstwerksamhet. Av denna formulering får anses följa att tystnadsplikten inte gäller för någon som helt tillfälligt och utan inslag av yrkesmässighet inkasserar en fordran för annans räkning e. d.. även om detta

”le

Prop. HSO/81:10 154

sker ttnder sädana förhällanden att lagen i och för sig är tillämplig (se under 1 s).

'liystnadsplikten enligt första stycket är straffsanktionerad enligt lll kap. 3 & brottsbalken.

,»lna'ru sive/ter. [ flera fall sotn pä grund av den tidigare anknytningen till kravet på tillständ inte har träffats av tystnadsplikten enligt 1 1 åinkassolagen gäller särskilda författningsbestämtnelser som innebär en i huvudsak motsva- rande tystnadsplikt. Här äsyftas bl. a. reglerna om s. k. banksekretessi 192 5 lagen ( 1955:183) om bankrörelse. 98 % lagen (1955:416) om sparbanker och 89s' lagen (1956216) om jordbrukskasserörelsen.

För finansbolag som fr. o. m. den 1 juli 19Rllomfattas av den nya lagen om finansbolag kommer en tystnadsplikt som motsvarar banksekretessen att gälla enligt 23? i nämnda lag. Tystnadsplikten för advokat som inte är anställd vid allmän advokatbyrå kommer fr. o. m. den l januari 1981 att regleras av en bestämmelse som i samband med antagandet av den nya sekretesslagen har förts in i 8 kap. 4 s' första stycket rättegängslmlken (se SFS 198011011.

[ den mån det sälunda finns särskilda författningsbestämmelser om en i huvudsak tm)tsvarande tystnadsplikt i vissa verksamheter bör dessa tillämpas i stället för tystnadspliktsregeln i 11 & första stycket.

Inom ramen för det allmännas verksamhet torde det f. n. endast i undantagslall förekomma inkasswerksamhet som avser indrivning av fordringar för annans räkning eller fordringar som har övertagits för indrivning: som framgär av 1 s* gäller inkassolagen inte för exekutiv myndighets verksamhet. Ett exempel pä att ett allmänt organ bedriver sadan verksamhet är emellertid verksamheten vid de allmänna advokatbyråerna. Vidare kan nämnas den inkasstwerksamhet som en del kommuner bedriver för kommunala bolags och stiftelsers räkning.

Ett grundläggande syfte med den nya sekretcsslagstiftningen är att offentliga funktionärcrs tystnadsplikt skall regleras uteslutande i sekretess- lagen. För att åstadkomma detta har i prop. 1979!811:Sllom följdlagstiftning till den nya sekretesslagen föreslagits ändringar i ett stort antal olika lagar som innehäller tystnadspliktshestämmelser. vilka kan vara tillämpliga sä 'äl för enskilda som för offentliga funktionärer. I regel innebär de föreslagna ändringarim att det till de aktuella reglerna om tystnadsplikt fogas ett tillägg som innebär att i det allmännas verksamhet i stället bestätnmelserna i sekretesslagen skall tillämpas. Samtidigt finns det dä i huvudsak likvärdiga tystnadspliktsbestämmelser i sekretesslagen.

[ enlighet med den princip som sälunda skall tillämpas i regleringen av offentliga funktitmers tystnadsplikt bör naturligtvis inte heller tystnadsplikts- regeln i förevarande pt'tragraf gälla i det allmännas verksamhet. Detta innebär inte nagot särskilt problem när det gäller den nyss berörda verksamheten vid de allmänna advokatbyråerna. För sadan verksamhet finns i *) kap. % första stycket sekretesslagen bestämmelser om sekretess i

115511.

'Jl 'J !

Prop. 1980/Slzltl 1

ärenden om rättsligt biträde. vilka blir tillämpliga vid inkasst'tuppdrag och innebär i huvudsak motsvarande tystnadsplikt som 11 & första stycket inkassolagen.

För den inkassovcrksamhet som vissa kommuner enligt det tidigare sagda bedriver för kommunala bolags och stiftelsers räkning finns inte i sekretess- - lagen nägra bestämmelser som ger ett sekretesskydd som är likvärdigt med tystnadsplikten enligt 11 55 första stycket. I viss utsträckning torde dock i hithörande fall komma att gälla sekretess enligt reglerna i 8 kap. 10% sekretesslagen. vilka avser uppgifter om enskildas affärs— och driftförhällan- den. Det kan. i vart fall f.n.. inte anses päkallat att därutöver föra in bestämmelser i sekretesslagen som tar sikte på att :'tstadkomma tystnadsplikt i inkassoverksamhet för annans räkning.

1 enlighet med det nu anförda skall bestämmelsermt om tystnadsplikt i första stycket inte tillämpas i fräga om den som enligt annan författning är underkastad motsvarande tystnadsplikt. Som framgär av det som har sagts i det föregående avses härmed en väsentligen likvärdig tystnadsplikt. dvs. plikt att inte obehörigen röja vissa f("örhällanden. För tillämpligheten av bestämmelsen i andra stycket första meningen saknar det emellertid betydelse. huruvida tystnadsplikten enligt den andra författningen är straffsanktionerad enligt 20 kap. 3 s" brottsbalken eller ej. Det skall nämnas att bestämmelserna om banksekretess inte är förenade med sädan sanktion. Vissa andra reaktionsmöjligheter står dock här till buds (jfr prop. 197918030 om följdlagstiftning till den nya sekretesslagen. s. 46).

Vidare skall bestämmelserna om tystnadsplikt i första stycket inte tillämpas i det allmännas verksamhet. Där tillämpas i stället sekretessla- gen.

125

Om gillt/emiren skyldighet att ersätta kostnader för inkussoåtgärder finns särskilda bestämmelser.

(Jfr 1235 i promemorieförslaget). Ändringarna i 12 s” är av redaktionell natur. Tidigare angavs i paragrafen att det fanns särskilda bestämmelser om gäldenärs skyldighet att ersätta kostnad för inkassoätgärd "i vissa fall". De citerade orden har utgätt till följd av de förslag som har lagts fram rörande ny lagstiftning om ersättning för inkassokostnader m. m. (se avsnittet 4.4).

139"

Datainspektitmen utövar tillsyn över efterlevanden av denna lag. lnspek— tionens tillsyn otnfattar dock ej verksamhet som bedrivs av Sveriges riksbank. Sveriges investeringsbank AB. _/i')'remg under bankinspektionens tillsyn eller advokat.

12 och 13 ## II.

Prop. 1980/81:10 156

Tillsynen skall utövas så. att den inte vållar större kostnader eller olägenheter än som är nödvändigt.

(Jfr 13 å i promemorieftlörslaget). 1 första stycket har uttrycket "kreditinrättning under bankinspektitmens tillsyn" bytts ut mot "företag under bankinspektionens tillsyn". Beträffande denna ändring får hänvisas till avsnitten 4.3.2 och 4.3.6 samt till vad som i anslutning till 'Zå har sagts rörande motsvarande ändring i den paragra- fen.

175

Till böter eller fängelse i högst ett är döms den som uppsåtligen eller av oaktsamhet

1. bedriver inkassoverksamhet utan föreskrivet tillstånd.

2. bryter mot föreskrift enligt 3 # andra stycket att anmäla ändring av visst förhållande,

3. bryter mot I () a 5 första stycket eller andra stycket första meningen eller mot föreskrift som har meddelats enligt 1 () a 35 andra stycket andra meningen. eller

4. lämnar osann uppgift i sådana fall som avses i 14 å andra stycket.

(Jfr 17% första stycket i promemorieförslaget). Enligt den nya lydelsen av 3 & kan datainspektionen förena ett tillstånd till inkassoverksamhet med en föreskrift om skyldighet att anmäla ändring av förhållande som har haft betydelse för tillståndet. 1 förevarande paragraf har som en ny punkt 2 förts in en bestämmelse om straff för den som uppsåtligen eller av oaktsamhet bryter mot en sådan föreskrift. Som en ny punkt 3 har förts in bestämmelser om straff för den som på motsvarande sätt bryter mot de i 10 a ;" upptagna nya reglerna rörande gäldenärsregisteri tillståndspliktig inkasstwerksamhet eller mot föreskrift som har meddelats av datainspektio- nen mcd stöd av andra stycket andra tneningen i ltla s.

17115

Har inkassoverksamhct bedrivits tttan jörcskrivct tillstånd. skall register som avser gäldenärer och som har använts i verksamheten ]i'irklarasjört'crkat, om det ej är uppenbart obilligt. Detsamma gäller. om ett register har överlåtits eller upplåtits [ strid med l() a s* första stycket eller om föreskrift som [tar meddelats enligt 10 a 55 andra stycket andra meningen aj Izarjöljts.

(_lfr 17s' andra stycket i promemoricförslaget). ! denna nya paragraf har tagits tipp bestämmelser om fört-'erkande i vissa fall av gäldenärsregister i tillständspliktig inkassovcrksamhet. Bestämmel- serna har utfortnats efter förebild av 31) & kreditttpplysningslagen i dess nya lydelse.

I7och l7a 5.6 IL

Prop. l980/81:10 157

()vergångshestämmelser

Denna lag träder i kraft. såvitt avser ] l ä och upphävandet av 16 å den I januari 1981 och i övrigt den 1 juli 1981.

Utan hinder av första stycket får datainspektionen i ett tillsti'mdsärende som avgörs före den I juli l981 meddela föreskriftenligt3 å andra stycket om skyldighet att anmäla ändring av visst förhållande. sävitt angår tid från och med nämnda dag.

Har någon erhållit tillstånd till inkassoverksamhet enligt äldre bestämmel- ser men fordras ej sådant tillstånd enligt den nya lagen. skall dock föreskrift som har förenats mcd tillståndet fortsätta att gälla till dess datainspcktionen beslutar om annat.

Ikraftträdandet och övergångsbestämmelserna har behandlats i avsnittet 4.5. till vilket här får hänvisas.

6.3 Förslaget till lag om ersättning för inkassokostnader m. m.

Som har framgått i den allmänna motiveringen (avsnitten 4.4.2 och 4.4.3") skall den nya lagen reglera en gäldenärs skyldighet att ersätta kostnader inte bara för krav eller andra inkassoätgärder som avses i inkassolagen utan även för enkla betalningspåminnelser och eventuella andra åtgärder som syftar till att förmå gäldenären att erlägga betalning för en förfallen skuld. Med anledning av detta anges i rubriken att lagen gäller ersättning för "inkassokostnader m. m."

Denna lag gäller en gäldenärs skyldighet att ersätta en lmrgcnärs kostnader för åtgärder som syftar till att förmå gäldenären att erlägga betalning för en förfallen skuld.

(Jfr l ä i promcmorieförslaget). Paragrafen anger lagens tillämpningsområde. Denna fråga har behandlats utförligt i avsnittet 4.4.2. till vilket får hänvisas.

Som framgår av vad som har sagts i avsnittet 4.4.2 skall lagen reglera gäldenärens skyldighet att ersätta borgenärens kostnader för åtgärder som normalt ingår i det utomrättsliga förfarz'tndet för indrivning av en förfallen fordran. I praktiken är det här fråga om enkla betalningspäminnelser. krav enligt 5.6 inkassolagen och uppgörelser om amorter'ingsplaner på indriv- ningsstadiet samt andra rutinmässiga åtgärder i anslutning därtill. såsom samtal och korrespondens med gäldenären. De åtgärder som sälunda avses har beskrivits med uttrycket "åtgärder som syftar till att förmå gäldenären att erlägga betalning". Detta får anses ge en tillräckligt tydlig anvisning om att lagen inte berör frågan om gäldenärens skyldighet att ersätta kostnader som avser olika rättsliga förfaranden eller exekutiva åtgärder. Det kan därför inte anses nödvändigt att. som föreslogs i departementspromemorian. i lagen ta

0 vergångs- bestämmelser [ L

Lagen om ersättning för inkasso/castaader m. m. ( kostnads- lagen)

Prop. HSO/81:10 ' 158

in en särskild erinran om detta tämligen självklara förhallande. Att lagen inte reglerar frägan om en gäldenärs eventuella skyldighet att ersätta kostnad för en mer omfattande förhandling för biläggande av tvistefräga närande en fordran framgär av 5 &.

Av paragrafen framgär att lagen reglerar endast ersättningsskyldigheten för atgärder som vidtas med avseende pä en förfallen skuld. dvs. efter det att förfallodagen har inträtt. Kostnader för faktttreringar. aviseringar eller päminnelser som görs före en fordrans förfallodag omfattas alltsä inte av lagen.

( enlighet med vad som har utvecklats närmare i avsnittet 4.4.2 omfattar lagen inte frägan om en gäldenärs skyldighet att ersätta kostnad för förhandsavisering oeh bokföring av betalning enligt en amorteringsplan som har upprättats pä indrivningsstadiet. Att bokföring av betalning inte utgör nägon sädan åtgärd som avses i förevarande paragraf är titan vidare klart. Förhandsaviseringen kan inte anses utgöra en ätgärd som syftar till att förmä gäldenären att betala en förfallen skuld. eftersom amorteringsplanen innebär att nya förfallotider har fastställts.

Lagen är tillämplig oberoende av om gäldenären oeh borgenären är konsumenter eller näringsidkare. fysiska eller juridiska personer etc. Vidare bör framhällas att den är tillämplig oavsett huruvida indrivningsförfarandet omfattas av inkassolagen eller inte. Lagen gäller alltsa även i fall dä t. ex. en enskild fysisk person driver in en egen fordran som varken har uppkommit i näringsverksamhet eller har övertagits för indrivning (jfr l »? inkassolagen i dess nya lydelse).

Vilka ätgärder av det i paragrafen angivna slaget som gäldenären är ersättningsskyldig för framgär av 2—5 st.

2.5

Gäldenären är skyldig att utge ersättning för skriftlig betalningspäminnel- se rörande skulden, om avtal därom har träffats senast i samband med skaldens uppkomst.

(Paragrafen saknar motsvarighet i promemorieförslaget'). Med en betalningspämimtelse avses en sädan enklare päminnelse om skyldighet att betala en förfallen skuld som ofta sänds ut innan borgenären vidtar eller läter vidta strängare ätgärder i form av krav m. m. Sävitt angär förhällanden som omfattas av inkassolagen i dess nya lydelse framgär av 1 få i den lagen att en betalningsanmaning blir att betrakta som ett krav. om den förenas med nägon annan pätryekning mot gäldenären än angivande av tid för betalning eller uppgift om att ärendet. om betalning inte sker. kommer att (")verli'tmnas till nägon annan för inkasso. [ ett sädant fall far frägan om gäldenärens ersättningsskyldighet bedömas enligt 3 så i förevarande lag.

För att gäldenären skall vara skyldig att betala ersättning för en

2 55 kutlands/agan

Prop. 1980/81 : I0 159

betalningspz'tminnelse fordras att avtal om sädan ersättningsskyldighet har träffats senast i samband med skaldens uppkomst. llaruvida ett sadant avtal föreligger fär bedömas enligt vanliga regler. Det torde krävas att det pa tydligt sätt har gjorts klart för gäldenäreii att han skall vara skyldig att ersätta betalningspäminnelse och att gäldenären har accepterat sädan skyldighet. I regel torde en skyldighet att betala ersättning för betalningspäntiiinelse över huvud taget bli aktuell endast i fall dä ett formligt avtal rörande skulden upprättas. såsom vid banklän eller vid avbetalningskt'ip eller upprättande av kontokreditavtal. Det är främst med tanke på kontokreditavtalen sotn det anges att avtalet om ersättningsskyldighet skall ha träffats "senast" i samband nted sktildens uppkomst. lblaiid uppkommer jti här inte nägon sktild pä kontot förrän en längre tid efter det att själva kontokreditavtalet har ingåtts.

Som framgår av avsnittet 4.4.4 är avsikten att regeringen skall meddela föreskrifter om ersättningens storlek. När det gäller sädana betalningspä— minnelser som det här är fräga ont bör ersättningsbeloppet sättas avsevärt lägre än för krav. Frägan om utformningen av de här nämnda föreskrifterna berörs närmare under 4 få.

35

Gäldenären är vidare skyldig att utge ersättning för

1 . krav rörande skulden. om kravbrev som har utformats pa ett sädant sätt som anges i Så inkassolagen (l974:182) har lämnats över eller sänts till gäldenären.

2. upprättande av fullständig plan för amortering av äterstäende del av skulden. om planen har tillkommit i samräd med gäldenären samt har satts tipp skriftligt och lätttnats över eller sänts till gäldenären.

(Jfr 2 s" första stycket i promeinorieförslaget.) Bestämmelsen ipmikt I om ersättnittgsskyldighet för kravkostnad tar inte i första hand sikte på kostnaderna för att upprätta och sända ut det enskilda kravbrevet. Ersättningsskyldigheten avser i stället hela kravförfarandet rörande en viss förfallen fordran. För att ersättniiigsskyldighet över huvud taget skall föreligga fordras emellertid att ett skriftligt krav har lämnats över eller sänts till gäldenären. F.n. anges i inkassokostnadskangörelsen att kravet skall ha "tillställts" gå'ildenären. Detta ttttryek har undvikits. eftersom det inte sällan har vällat missuppfattningen att kravet bevisligen har kommit gäldenären till handa. Detta katt självfallet inte fordras. När kravbrevet har sänts till gäldenären måste det emellertid ha skett pä ett ändami'tlsenligt sätt och Linder den adress som borgenären eller dennes ombud — med iakttagande av tillbörlig ontsorg — ltar noterat sont gäldenärens senast kända adress.

Ersättningsskyldighet för krav föreligger endast om kravbrevet har utformats på ett sädant sätt som anges i Så inkassolagen. Detta gäller oberoende av om den lagen är tillämplig på inkassoverksamheten eller inte.

3 s*" kostnadslageri

Prop. HSO/81:10 _ 160

Enligt punkt 2 är gäldenären skyldig att betala ersättning för upprättande av amorteringsplan pä ittdrivningsstat'liet. För detta krävs till en början att planen är fullständig och alltsä avser hela den äterstäende delen av kapitalskulden jämte ränta. De olika avbetalttingstillfällena och storleken av varje delbetalning skall ha angetts i planen.

Planen skall vidare ha upprättats i samräd med gäldenären. Detta utgör en viktig förutsättning för ersättningsskyldigheten. Det är sälunda endast när gäldenären har haft möjlighet att upplysa om sitta ekonomiska möjligheter och att påverka planens utformning som upprättandet av denna kan anses utgöra en effektiv inkassoätgärd. Om gäldenären uttryckligen har förklarat att han inte kommer att kunna fullfölja en föreslagen '.tmorteringsplait. hör han inte bli ersättningsskyldig om planen likväl upprättas mot hans vilja. Detta följer av 4 &. som innebär att gäldenärens ersättningsskyldighet endast gäller kostnad som har varit skäligen päkallad för att ta till vara borgenärens rätt.

För att leda till ersättningsskyldighet skall planen ha upprättats skriftligt samt ha lämnats över eller sänts till gäldenären. Beträffande innebörden av sistnämnda förutsättning för ersättningsskyldigheten fär hänvisas till vad som nyss har sagts beträffande krav.

:tå

Ersättningsskyldighet enligt 2 och 3 & gäller endast kostnader som har varit skäligen päkallade för att ta till vara borgenärens rätt.

Ersättning utgär med skäligt belopp enligt vad regeringen närmare föreskriver.

(Jfr 2 5 andra stycket och 3 & första meningen i promemorieft'trslaget). I—"örsmstvcket. Den förutsättning för crsättningsskyldigheten som här ställs upp motsvarar vad som hittills har gällt enligt inkassokostnadskungörelsen. Denna förutsättning mäste i princip anses innebära att den ätgärd som kostnaden avser skall ha varit ägnad att leda till betalning. Alltför stränga anspräk härvidlag kan dock inte uppställas. Borgcnären mäste i regel vara berättigad att genom en betalningspäminnelse och/eller ett krav försöka fä betalning även frän en notoriskt betalningsovillig gäldenär. Det bör framhällas att enligt 6 och 7 åå inkassolagen ett skriftligt krav normalt mäste tillställas gäldenären innan rättslig ätgärd fär vidtas mot honom. Som har sagts vid 3 få katt en atnorterittgsplan sotn har upprättats mot gäldenärens uttryckliga önskan inte anses skäligen päkallad för att ta till vara borgenärens rätt.

Kostnaden för en ätgärd som strider mot god inkassosed kan aldrig anses ha varit skäligen päkallad för att ta till vara borgenärens rätt. lätt kravbrev som innehåller ovederhäftiga utfall c. d. mot gäldenären föranleder alltsä inte ersättningsskyldighet.

[ regel torde det inte kunna anses skäligen päkallat för att ta till vara

4 5 kostnadslagen

Prop. watt/31:10 tm

bt')rgenärens rätt att gäldenären tillställs fler ätt en betalningspäminnelse och ett kravbrev. Det torde ocksä endast i unt'lantagsfall kunna vara päkallat att man i samband med indrivningen av en fordrati upprättar mer än en atttorteringsplan. Ett sädant undantagsfall katt vara att gäldenären. sedan en amorteringsplan har upprättats. medverkar till en ny atitorteringsplan därför att ltan önskar ytterligare lättnader i fräga om avbetalningarna. Det mäste dock fordras att varje amorteringsplan. itär den uppi'ättat'les. katt anses ha framstätt som en realistisk möjlighet för borgenären att fa betalning för sin fordran.

Amira .t'1_i'('ket. Som tidigare har framgätt är det meningen att regeringen skall meddela verkställighetsföreskrifter till lagen vilka närmare reglerar ersättningsbeloppensI storlek. Beträffande regleringens närmare innehäll kan följande nämnas.

I en särskild förordning bör fastställas de högsta ersättningsbelopp som normalt skall ktitina utgä för skriftlig betalningspämitirtelse. krav rörande skulden och amorteringsplan. Dessa belopp bör kunna överskridas. om särskilda skäl föreligger. En sädan reglering överenssti'iinmer i princip med den som f. n. gäller enligt inkassokostnadskungörelsen.

Liksom f. n. bör beloppet för kravkostnadsersättning bestämmas sä att det kan anses täcka kostnaderna för att upprätta och sända ut ett enda kravbrev. utformat i enlighet med bestämmelserna i 5 %$ inkassolagen. samt kostnader- na för andra ätgärder som normalt förekommer i ett kravft'örfarande. såsom mottagande och registrering av inkassouppdrag. enklare behandling av invändningar frän gäldenären. bokföring och redovisning av inflytande betalning. Det sälunda fastställda beloppet — f. n. enligt inkassokostnads- kungörelsen 55 kr. — bör normalt vara hela den ersättning som en gäldenär skall behöva utge för kravförfarandet rörande en viss skuld. Gäldenären bör alltsä i regel inte vara skyldig att utge högre ersättning därför att borgenären eller dennes ombud har tillställt honom flera kravbrev. Detta följer av att en sädan ätgärd i allmänhet inte katt anses ha varit skäligen päkallad för att ta till Vara borgenärens rätt. Om det finns särskilda skäl bör borgeni'iren emellertid kttnna ta ut en högre sammanlagd ersättning.

Vad som nu ltar sagts om en gäldenärs skyldighet att betala ersättning för kostnader för mer än ett kravbrev har i princip giltighet också för den situationen att en fordran mot en gäldenär har överlätits frän en borgenär till en annan. [lar den förre borgenären framställt krav enligt 5 & inkassolagen mot gäldenären. torde det sälunda endast mer undantagsvis kttnna anses vara skäligen päkallat för att ta till vara deti senare borgenärens rätt att även denne frantställer ett sädant krav innan ltan eventuellt vidtar rättslig ätgärd mot gäldenären. Om sä emellertid kan anses vara fallet. är gäldenären skyldig att ersätta säväl den förre som den nye borgenärens kravkostnader. [ den män dessa tillsammans skulle överstiga det av regeringen för normalfall fastställda högsta beloppet. katt sädan skyldighet äläggas gäldenären med stöd av bestämmelsen om särskilda skäl.

4 5 kostnadslagen

Prop. 1980/81:10 ' 162

I fråga om vad som i övrigt skall anses utgöra särskilda skäl för större ersättningsskyldighet än i not'titalfallen torde hittillsvarande praxis kunna följas. Ersättning med högre belopp än som normalt gäller som maximum för krav bör sälunda kutina utgä t.ex. om kravförfarandet har fordrat översättningsarbete eller en onormalt stor arbetsinsats för att identifiera gäldenären c. d.

Som har sagts redan tidigare bör ersättningsbeloppet för skriftlig betalningspäminnelse kunna sättas avsevärt lägre än ersättningsbeloppet för krav. I enlighet med vad som ltar framhällits vid första stycket torde gäldenären i regel inte vara skyldig att utge ersättning för mer än en betaltiingspäminnelse avseende en skuld. Vid hetalningspäminnelse torde det ocksä mera sällan kunna föreligth särskilda skäl för högre ersättning ätt

den som normalt skall gälla som maximum.

Säl

Har någon annan ätgärd än som avses i 2 eller 3 s*vidtagitsi syfte att förmä gäldenären att erlägga betalning för en förfallen sktild. är denne inte skyldig att ersätta kostnaderna för åtgärden. Vad nu sagts inskränker dock inte en gäldenärs skyldighet att ersätta kostnader för mer omfattande förhandling för biläggande av tvistefräga rörande ert fordran.

(Jfr stå första stycket i promemorieförslaget). Genom denna paragraf kommer till uttryck att lagett inoin deti 1 & angivna tillämpningsområdet innefattar en uttömmande reglering av gäldenärens skyldighet att ersätta kostnader för olika ätgärder. Samtidigt klargörs dock genom bestämmelsen i andra meningen att lagen över huvud taget inte är avsedd att reglera frägan om en gäldenärs skyldighet att ersätta kostnad för mer omfattande förhandling för biläggande av en tvistefräga rörande ett fordran. [ den delen fär hänvisas till avsnittet 4.4.2.

65

Avtalsvillkor som utvidgar gäldenärens skyldighet att utge ersättning utöver vad som följer av denna lag är ogiltigt.

(Jfr 4.5 andra stycket i promemorieförslaget). Paragrafen innebär att lagen är på det sättet tvingande till gäldenärens förmän att ett avtalsvillkor är ogiltigt. om det älägger honom en vidsträcktare ersättningsskyldighet än som följer av lagen och till den anslutande verkställighetsföreskrifter om ersättningsbeloppen. Som framgär av vad som har sagts i avsnittet 4.4.5 tar bestämmelsen emellertid sikte endast pä sädana avtalsvillkor som har tillkommit pä förhand. dvs. innan en skyldighet att betala ersättning för betalningspäminnelse. krav eller amorteringsplan har konkret aktualiserats. Därefter kan gäldenären däremot med bindande

' Paragrafen har fått en något annan lydelse i propositionsförslaget.

5 och 6 sw kost- nedslagen

Prop. 1980/81:10 163

verkan ta pä sig en längre gäende ersättningsskyldighet. Detta överensstäm— mer med den innebörd som vanligen brukar tilläggas bestämmelser av det här ifrågavarande slaget (jfr t. ex. prop. 1973:129 s. 193 och 232. 1976177: 123 s. 159 och 369 f samt l979."8(fl:9 s.1(12). 1 övrigt får i denna fräga hänvisas till avsnittet 4.4.5.

()i-'ergångsl>estäntmelser

Denna lag träder i kraft den 1 jtili 1981. Bestämmelsen i 6 % tillämpas även pä avtalsvillkor som ltar tillkommit före den nya lagens ikraftttädande.

Enligt 6 s i den nya lagen skall ett avtalsvillkor som utvidgar gäldenärens skyldighet att utge ersättning för kostnader utöver vad som följer av lagen vara ogiltigt. Av allmänna grundsatser torde följa att denna regel inte skulle drabba ett avtalsvillkor som har tillkommit före ikraftträdandet. om inte annat föreskrivs (jfr prop. .1976/77: 123 med förslag till konsutttentkreditlag m. m.. 5. 149). Om en gäldenär genom ett sådant avtalsvillkor har tagit på sig en längre gäende ersättningsskyldighet än som följer av lagen. skulle detta villkor alltså i princip vara giltigt även med avseende pä ersättning för åtgärd som har vidtagits först efter den nya lagens ikraftträdande. Det katt här vara fråga om villkor i t. ex. ett kreditavtal. vars giltighet sträcker sig långt in i framtiden. En sädan ordning är inte tillfredsställande och kan medföra komplikationer vilka med hänsyn till de belopp som är aktuella framstår som onödiga. På grund av det nu anförda gäller att bestämmelsen i 6.5 skall tillämpas även på avtalsvillkor som har tillkommit före ikraftträdandet. Detta innebär att lagen blir tillämplig fullt ut i fräga om ersättning för varje åtgärd som omfattas av lagett och som har vidtagits efter dess ikraftträdan- de.

Av övcrgängsbestämmelserna till ändringarna i rättegängsbalken och smämälslagen framgär att den processrättsliga reglering som f. n. gäller i fråga om rätten till ersättning för inkassokostnad skall även efter den 1 juli 1981 tillämpas på ersättning för åtgärder som ltar vidtagits före nämnda dag. 1 fråga om krav bör det avgörande vara när kravet lämnades över eller sändes till gäldenären.

6.4. Förslaget till lag om ändring i lagsökningslagen 1 si

För fordran som grundar sig på skuldebrev eller annat skriftligt fordrings- bevis och ärförftillen till betalning/fir gäldenären lagsökas enligt vad som sägs i det följande.

()m panträtt i fast egendom. skepp eller skeppsbygge har skriftligen upplåtits för en ]?)rdmn som avses i första stycket. kan borgenären genom lagsökning söka betalning ur egendomen. l-iar borgenären för fordringen inteckning i luftfartyg eller reservdelar till luftfartyg eller företagsinteekning. kan han genom lagsökning söka betalning ur den egendom vari inteckningen gäller.

Övergånga- bestämmelser kostnadslagen

Lagsöknings- lagen ( LS L )

Prop. 1980/81:10 164

För en fordran på ersättning som avses i 2 eller .i' s* lagun ( / 990-001!) om ersättning för inkassokostmnler m. m. fiir lagsökning äga rttm även om fordringen inte grundar sig pri skriftligt jbrdringslwvis. Lin förtttsättning är dock att lagsökningcn liger rum i samband med lagsökning enligt_/'i.5rsta eller andra stycket för den fordran som har föranlett den åtgärd som ersättnings- anspräket avser.

Lagsökning för fordran på ersättning som avses i tredje stycket får liga rum endast i den tnrin denfordrade t'rst'iltningen kan utgå enligt lagen om erst'ittning för inkassa/tosttuuler m. m.

Vad som sägs i denna lag om gäldenären skall vid lagsökning som avser fastställelse till betalning ar viss egendom til/(int].tas pa ägaren av egendo- men.

(Jfr 1 5 i prt'nnemorieförslaget).

Första och andra stvckena. Ändringarna är av rent redaktionell natur. Tredje stycket. Genom det nya tredje stycket öppnas den i avsnittet '—l.—l.7 förordade möjligheten att lagsöka en gäldenär för fordran pä ersättning som avses i 2 cller 3 & lagen om ersättning för inkassokostnader m. ni.. även om denna fordran inte grundar sig på ett skriftligt fordringsbevis. För att detta skall fä göras krävs emellertid att lagsökningen för inkassokostnad sker i samband med lagsökning enligt första eller andra stycket för den fordran som har föranlett den ätgärd som crsättningsanspräket avser (huvudfordringen). Kravet på samband fär normalt anses innebära att de bada fordringarna mäste omfattas av samma ansökan om lagsökning. Av det nämnda kravet bör vidare följa att om ansökningen av nägon anledning inte till nägon del kan tas upp såvitt gäller huvudfordringen. sä bör den samtidigt avvisas i fräga om inkassokostnaden. Borgenären har i sädant fall givetvis möjlighet att i stället kräva ut inkassokostnaden genom en ansökan om betalningsföreläggan- de.

Det bör understrykas att bestämmelsen i tredje stycket gäller endast när fordringen pä ersättning för inkassokostnad inte grundar sig pa skriftligt fordringsbevis. Om fordringen grundar sig pä ett sädant fordringsbevis kan lagsökning för den äga rum enligt 1 s första eller andra stycket. varvid nägot krav på samband med en lagsökning för huvudfordringen inte uppställs.

Vid lagsökning enligt 1 5 andra stycket gäller f. n. att i regel även kostnaden för lagsökningsförfarandet — däri inbegripet eventuell ersättning för inkassokostnad — fastställs att utgä ur den pantförskrivna egendomen. Grunden för detta är att den upplåtna panträtten i allmänhet anses gälla också fören del biförpliktelser. t. ex. indrivningskostnadoch rättegangskost- nad (jfr i fräga om panträtt i fast egendom Westerlind. Kommentar till jordabalken. 6 kap.. Stockholm 1977. s. 291 ff). Den nya lagstiftningen om ersättning för inkassoktztstnader rn. m. innebär inte nägon ändring i synen pa skyldigheten att utge ersättning för inkassokostnad sotn en biförpliktelsc till skyldigheten att betala huvudfordringen. Vid lagsökning enligt l å andra stycket kommer en fordran pä ersättning för inkassokostnad sälunda även i fortsättningen att kunna fastställas att utgä ur den pantförskrivna egendo-

l # LSI.

Prop. 1980/81zltl 165

men. förutsatt att panträttsupplätelsen får anses omfatta även inkassokost- nad.

Fjärde stycket. Här upptas den nya bestänunelse som. i enlighet med övervägandena i avsnittet 4.4.7. innebär att domstolens rätt och plikt till s. k. officialprövning av ett anspräk pä ersättning för inkassokostnad bibehålls och t. o. m. utvidgas i nägon .män. Bestämmelsen är tillämplig oavsett om lagsökningen för inkassokostnad äger rum enligt tredje stycket eller enligt något av de. två tidigare styckena i paragrafen,

Av förevarande stycke och 3 & följer att en ansökan om lagsökning för inkassokwtnad skall avvisas i den män den kostnadsersättning som fordras inte kan utgä enligt den nya lagen om ersättning för inkassokostnader m. m. och till den anknytande verkställighetsföreskrifter beträffande ersättnings- beloppen. Prövningen av denna fraga skall göras av domstolen självmant och redan på anst'ökningsstadiet. Rörande den prövning som sälunda skall verkställas kan framhällas följande.

Om ansökningen innefattar anspräk pä ersättning för betalningspäminnel- se. bör det fordras att borgenären i ansökningen anger bäde att gäldenären efter förfallodagen för huvudfordringen har tillställts en skriftlig betalnings- päminnelse och att gäldenären är skyldig att utge ersättning för påminnelsen enligt ett sädant avtal som avses i lä i den nya lagen om ersättning för inkassokostnader m. m. Yrkar borgenären ersättning för kostnad för krav bör det fordras att han i ansökningen anger att ett kravbrev. utformat pä det sätt som sägs i 5 s' inkassolagen. har lämnats över eller sänts till gäldenären efter lmvudfordringens förfallodag. Begär borgenären ersättning för upprät- tande av amorteringsplan bör det fordras att han på motsvarande sätt anger att de i 3 s* i den nya lagen om ersättning för inkassokostnader m. m. angivna förutsättningarna för rätt till ersättning för upprättandet av planen är uppfyllda. Som har framhållits i avsnittet 4.4.7 kan domstolen. när omständigheterna ger anledning till antagande exempelvis att ett kravbrev eller en amorteringsplan inte uppfyller förutsättningarna för rätt till ersättning. fordra in en avskrift av krav-brevet eller amorteringsplanen.

Det åligger vidare domstolen att pröva. om en kostnad som borgenären begär ersättning för har varit skäligen päkallad för att ta till vara borgenärens rätt (jfr 4 & första stycket i den nya lagen om ersättning för inkassokostnader m. ut.). Som har framhallits i departementspromemorian ligger det emeller- tid i sakens natur att domstolen vid den här diskuterade prövningen. som sker redan på ansökningsstadiet och pä grundval enbart av borgenärens ansökan samt andra av honom ingivna h:-tndlingar_ endast i uppenbara fall kan avvisa ett anspräk pä ersättning för inkassokostnad därför att den ifrägavarande kostnaden inte kan anses ha varit skäligen päkallad.

Om förutsättningarna för ersättningsskyldighet är uppfyllda. har dom- stolen att pröva att borgenären inte har yrkat ersättning med högre belopp än som i det enskilda fallet kan utgä enligt lagen om ersättning för inkassokost- nader m. m. och de därtill anknytande verkställighetsföreskrifterna. Anled-

1.5LSL

Prop. 1980/81:10 166

ning att överväga avvisning därför att ett alltför högt belopp har yrkats torde i allmänhet föreligga endast om borgenären gör anspräk pä ersättning med högre belopp än det som för normalfallet skall utgöra maximum. lett sädant fall måste det krävas att borgenären i ansökningen äberopat" (.mtständigheter som kan utgöra särskilda skäl för den högre ersättningen. Aberopar borgenären inte alls nägra speciella omständigheter eller är de omständig- heter som anförs sädana att de inte kan anses utgöra särskilda skäl för högre ersättning än normalt. skall ansökningen avvisas sävitt gäller ('n-'erskjutande belopp. Det torde dock bli sällsynt att domstolen pä detta inledande stadium kan anses ha grund för att genom avvisning besluta att det yrkande som skall bli föremål för fortsatt förfarande sätts ned under maximibeloppet för normalfall.

Det bör påpekas att borgenären någon gång kan vara berättigad till högre ersättning än den som enligt regeringens föreskrifter om ersättningsbelop- pens storlek skall gälla som maximum för normalfall. utan att han behöver åberopa att det föreligger sädana särskilda skäl som enligt dessa föreskrifter skall fordras för en högre ersättning. Detta gäller om gäldenären. sedan en skyldighet att betala ersättning för en kravkostnad e. d. har aktualiserats i det konkreta fallet. har åtagit sig att utge högre ersättning än han enligt lagen om ersättning för inkassokostnader m. m. skulle vara skyldig att betala. 1 ett sådant fall mäste det fordras att borgenären i ansökningen anger att det föreligger ett åtagande av ifrågavarande innebörd frän gäldenärens sida. I annat fall skall. i enlighet med vad som nyss sades. ansökningen avvisas sävitt gäller belopp som överstiger vad gäldenären normalt är skyldig att utge enligt lagen om ersättning för inkassokostnader m. m.

Mot ett avvisningsbeslut enligt l ä fjärde stycket och 3 & kan borgenären enligt 34 & lagsökningslagen föra talan genom besvär. Ett beslut om att helt eller delvis avvisa ett yrkande om ersättning för inkassokostnad innebär inte att frågan om borgenärens rätt till ersättning enligt det avvisade yrkandet är rättskraftigt avgjord. Borgenären är således oförhindrad att genom stämning eller i sumntarisk process på nytt framställa ett avvisat yrkande. som dä kan vara bättre underbyggt. Att detta dock inte alltid kan ske genom en ny ansökan om lagsökning följer av 1 ätredje stycket. Har det lagsökningsmäl i vilket ett visst yrkande har avvisats hänskjutits till rättegäng. torde borgenären vidare i den rättegängen kunna framställa det avvisade yrkandet. under de förutsättningar som anges i 13 kap. 3 & rättegängsbalken. Sker det och finner domstolen att attspräket är ogrundat. skall det givetvis inte då avvisas utan ogillas.

Femte stycket. Bestämmelsen motsvarar sakligt sett nuvarande l & fjärde stycket. I detta anges f. n. att vad som i lagen sägs om gäldenären skall vid lagsökning enligt l å andra stycket tillämpas på ägaren av den egendom ur vilken betalning söks. Som har berörts i anslutning till andra stycket kan emellertid en fordran pä ersättning för inkassokostnad fastställas till betalning ur pantförskriven egendom. förutsatt att panträttsuppläteIsen fär

I # LSL

Prop. 1980/8lzl0 167

anses omfatta även sädan kostnad. Detta gäller även om lagsökning för inkassokostnaden sker enligt lå tredje stycket. På grund av detta har hänvisningen till andra stycket ersatts med en uttrycklig beskrivning av den situation som avses med förevarande bestämmelse.

35

Finner rätten att de handlingar som har åberopats ej utgör bevis om fordran eller rätt till betalning ur den egendom som har angivits ellcrfinner rätten annars att hinder föreligger mot att ta upp en ansökan enligt 1 5 första, andra eller tredje stycket, skall den avvisas. Bevis om avvisning skall tecknas på det ena exemplaret av ansökningen.

(Jfr 3 & i promemorieförslaget).

Bestämmelserna i paragrafen har ändrats så att de omfattar även en ansökan om lagsökning enligt det nya tredje stycket i lä. I övrigt är ändringarna av redaktionell eller förtydligande natur. I fråga om sambandet mellan paragrafen och det nya fjärde stycket i 1 åfär hänvisas till vad som har sagts i anslutning till sistnämnda bestämmelse.

12l$

Gör gäldenären någon annan invändning mot kravet än som anges i 10 och 11 åå och vill han styrka sin invändning, skall han genast förete sina bevis. Härvid gäller endast skriftliga bevis. Finner rätten att gäldenären har skäl för invändningen. skall målet hänskjutas som tvistigt till rättegång.

Grundas kravet på ett fordringsbevis enligt vilket gäldenären skall ha en motprestation för sin betalning och gör gäldenären en invändning som gäller motprestationen. skall målet som tvistigt hänskjutas till rättegäng, om gäldenären har visat sannolika skäl för invändningen eller borgenärens rätt till betalning annars är oklar. Detsamma gäller när gäldenären gör invändning mot ett krm-' som avser ersättning enligt 2 eller 3 .é' lagen ( ] 980.000) om ersättning för inkassokostnader m. m.

(Jfr 12,5 i promemorieförslaget). Första stycket. Ändringarna är uteslutande av redaktionell natur. Andra stycket. Om gäldenären i lagsökningsförfarandet gör en invändning mot ett anspråk på ersättning för inkassokostnad bör målet i den delen, i enlighet med vad som har föreslagits i departementspromemorian, lämpligen behandlas enligt samma regler som sedan tidigare gäller enligt 12 å andra stycket. En bestämmelse om detta har tagits in som en andra meningi andra stycket. Med anledning av vad domstolsverkct har anfört i sitt remissyttrande kan framhällas att bestämmelsen är avsedd att tillämpas vare sig det ifrågavarande ersättningsanspräket grundas på skriftligt fordringsbevis eller inte.

Den nya bestämmelsen i andra meningen innebär att ersättningsanspräket skall som tvistigt hänskjutas till rättegång, om gäldenären gör en invändning

3 och 12 55.5 LSL

Prop. 1980/81 :10 168

mot detta och visar sannolika skäl för invändningen eller om borgenärens rätt till betalning enligt ersättningsanspräket annars framstär som oklar med hänsyn till invändningen. Om lagsökningsmälet avser såväl huvudfordringen som ett anspråk på ersättning för inkassokostnad men gäldenären endäst framställer invändning mot det senare anspråket. saknas det anledning att hänskjuta målet till rättegång i den del som gäller huvudfordringen.

Som tidigare har nämnts kan skyldigheten att utge ersättning för inkassokostnad anses utgöra en biförpliktelsc till skyldigheten att betala den fordran som har föranlett kostnaden. Om en borgenär har framställt exempelvis ett krav rörande en fordran som han anser sig ha mot en gäldenär men denne sedermera inte befinns skyldig att betala den påstådda fordringen, är den förmente gäldenären givetvis inte heller skyldig att ersätta kravkostnaden.

Det kan tänkas inträffa att en gäldenär som lagsöks såväl för inkassokost- nad som för huvudfordringen framställer en uttrycklig invändning endast mot det senare anspråket. I ett sådant fall får gäldenären emellertid. åtminstone i regel. anses ha framställt invändning också mot anspråket pä ersättning för inkassokostnad. Om gäldenären har visat sädana skäl för invändningen mot huvudfordringen att denna som tvistig skall hänskjutas till rättegång, bör därmed också anspråket på ersättning för inkassokostnad hänskjutas.

185

För att få ut en penningfordran som inte grundar sig på skriftligt fordringsbevis och inte avser skadestånd kan borgenären utverka betalnings- föreläggande enligt vad som sägs i det följande.

Betalningsföreläggande får ges för fordran på ersättning som avses i 2 eller 3 5 lagen (l980:000) om ersättningför inkassokostnader m. m. iden mån den fordrade ersättningen kan utgå enligt den lagen.

(Jfr tgå i promemorieförslaget). Första stycket. Här'har gjorts endast några språkliga ändringar. Andra stycket. I detta stycke har tidigare endast funnits en bestämmelse om att betalningsföreläggande får ges för fordran som avser inkassoätgärd. Även genom styckets nya lydelse fastslås detta förhållande. liksom att betalningsföreläggande också kan ges för fordran på ersättning för skriftlig betalningspåminnelse enligt 2 .S i den nya lagen om ersättning för inkasso- kostnader m. m. I andra stycket har emellertid även tagits in en regel som innebär att betalningsföreläggande för fordran pä ersättning som avses i 2 eller 3 & i den nämnda lagen får ges endast i den mån ersättningen kan utgå enligt lagen. Härmed åsyftas att, på motsvarande sätt som med det nya l ä fjärde stycket. bibehålla och i någon män utvidga domstolens rätt och plikt till s. k. officialprövning av anspråk på ersättning för inkassokostnad (se avsnittet 4.4.7).

18 # LSI.

Prop. 1980/81:10 lok)

Den nya lydelsen av andra stycket innebär att en ansökan om betalnings- föreläggande. som avser ersättning för betalningspäminnelse. krav eller amorteringsplan. enligt 21 %& lagsökningslagen skall avvisas i den mån den fordrade ersättningen inte kan utgå enligt den nya lagen om ersättning för inkassokostnader m. m. Beträffande domstolens prövning av avvisningsfrå- gan samt borgenärens möjligheter att anföra besvär över ett avvisningsbeslut och att på nytt framställa ett avvisat anspräk kan hänvisas till vad som i anslutning till 15 fjärde stycket har sagts om motsvarande spörstnäl vid lagsökning för inkassokostnad.

Om gäldenären på rätt sätt och inom rätt tid bestrider en ansökan om betalningsföreläggande som avser ersättning för inkassokostnad. skall enligt 26 så lagsökningslagen målet i den delen som tvistigt hänskjutas till rättegång. om borgenären begär det.

Även vid betalningsföreläggande torde det ofta kunna inträffa att en gäldenär. som har delgetts en ansökan som avser både inkassokostnad och den fordran som har föranlett kostnaden. uttryckligen bestrider ansökningen endast sävitt gäller den senare fordringen. 1 enlighet-med vad som har anförts i anslutning till 125 beträffande motsvarande situation vid lagsökning fär bestridandet i ett sådant fall i regel anses omfatta ocksä anspråket på inkassokostnad. Begär borgenären att målet skall hänskjutas till rättegång. bör hänskjutandet då avse även kostnadsanspråket.

Övergångsbestämmelser

Denna lag träder i kraft den I juli 1981. Äldre bestämmelser gäller dock fortfarande i fråga om kostnad för inkassoätgärd som har vidtagits före nämnda dag.

Bestämmelsen innebär att lagsökningslagen i dess lydelse före den .1 juli 1981 fortfarande skall tillämpas vid lagsökning eller betalningsföreläggande som avser ersättning för kostnad för inkassoätgärd som har vidtagits före den dagen.

6.5. Förslaget till lag om ändring i rättegångsbalken 18 kap. 8 &

Ersättning för rättegängskostnad skall fullt motsvara kostnaden för rättegångens förberedande och talans utförande jämte arvode till ombud eller biträde. sävitt kostnaden skäligen varit påkallad för tillvaratagande av partens rätt. Ersättning skall ock utgä för partens arbete och tidsspillan i anledning av rättegängen. Såsom åtgärd för rättegångens förberedande anses förhandling för biläggande av tvistefräga som har omedelbar betydelse för partens talan. '

Ersättning 'för rättegängskostnad skall även innefatta ränta efter sex procent från dagen då målet avgöres till dess betalning sker.

Övargångsbestäm- nte/ser LSL

Rättegångsbalken

Prop. 1980/81:10 17tl

Ändringen. som motsvarar vad som föreslogs i departementspromemori- an, innebär att det nuvarande andra stycket upphävs och att det nuvarande tredje stycket träder i dess ställe. Det upphävda andra stycket innehöll bestämmelser om att inkassoätgärd som hade vidtagits före rättegängen ersattes som rättegångskostnad, varvid ersättningen utgick enligt bestäm- melser som meddelats av regeringen. dvs. enligt inkassokostnadskungörel- sen. På sådana kostnader tillämpas i fortsättningen den nya lagen om ersättning för inkassokostnader m. m. och till den anslutande författning- ar.

Övergångsbestämmelser

Denna lag träder i kraft den 1 juli 1981. Äldre bestämmelser gäller dock fortfarande i fråga om kostnad för inkassoätgärd som har vidtagits före nämnda dag.

6.6. Förslaget till lag om ändringi lagen om rättegången i tvistemål om mindre värden

Ersättning för rättegångskostnad får ej avse annat än kostnad för

1. rådgivning enligt rättshjälpslagen (19721429) vid ett tillfälle för varje instans,

2. ansökningsavgift,

3. resa och uppehälle för part eller ställföreträdare i samband med sammanträde eller. om personlig inställelse ej föreskrivits, resa och uppehälle för ombud.

4. vittnesbevisning.

5. översättning av handling. Ersättning utgår endast i den mån kostnaden varit skäligen päkallad för tillvaratagande av partens rätt.

Ersättning som anges i första stycket 3 utgår enligt bestämmelser som regeringen meddelar.

Med kostnad som sägs i första stycket 1 jämställes kostnad för annan rådgivning som lämnas av advokat eller biträdande jurist på advokatbyrå. i den mån den ej överstiger i rättshjälpslagen bestämd rådgivningsavgift.

Har mål till en början handlagts i annan ordning än enligt denna lag. utgär ersättning för kostnad som uppkommit i samband därmed enligt vad som gäller därom.

Ändringen motsvarar vad som föreslogs i departementspromemorian. Den innebär att nuvarande punkt 6 i första stycket — enligt vilken ersättning för rättegångskostnad får avse även kostnad för inkassoätgärd som har vidtagits före rättegången utgår. Vidare innebär ändringenlatt den nuvarande hänvisningen i tredje stycket till nämnda punkt 6 samtidigt utgår.

Lagen om rätte- gången i tviste- mål om mindre värden

Prop. HSO/81:10 171

Overgångsbestämmelser

Denna lag träder i kraft den 1. juli 1981. Äldre bestämmelser gäller dock fortfarande i fråga om kostnad för inkassoätgärd som har vidtagits före nämnda dag.

7. Hemställan

Jag hemställer att lagrådets yttrande inhämtas över förslagen till

1. lag om ändring i kreditupplysningslagen (1973:1173),

2. lag om ändring i inkassolagen (1974:182).

3. lag om ersättning för inkassokostnader m. m.,

4. lag om ändring i lagen (19461808) om lagsökning och betalningsföre- läggande (lagsökningslagen),

5. lag om ändring i rättegångsbalken,

6. lag om ändring i lagen (1974:8) om rättegången i tvistemål om mindre värden.

8. Beslut

Regeringen beslutar i enlighet med föredragandens hemställan.

Prop. 1980/81:10

l72

Bilaga ]

Lagförslag i departementspromemorian (Ds .lu l979:8l Kreditupplysning och inkasso

Förslag till Lag om ändring i kreditupplysningslagen (l973:ll73)

llärigenom föreskrivs att 1—4. (3—8. Ifk-13. 16. 19 och 21) så kreditupplys- ningslagen (1973: 1 173") skall ha nedan angivna lydelse.

t'y'ttvart'tntle lydelse

Denna lag gäller yrkesmässigt bedriven kreditupplysningsverksam- het. Förmedling av upplysningar mellan kreditinrättningar omfattas dock ej av lagen. i den mån det är fråga om Sveriges riksbank. Sveriges investeringsbank AB eller annan kreditinrättning under bankinspek— tionens tillsyn än finanslx'nag enligt lagen (1979:()()()) om finansbolag. [Ej heller giiller lagen förmedling av upplysningar mellan företag inom samma koncern.

Föreslagen lydelse

Denna lag gäller kreditupplys- ningsvcrksamhet som innebär att någon annat än i enstaka fall liintnnr kreditttpplvsningttr mot ersättning el- ler som ett led i niirt'ngsverksamhet. Lagen giiller också annan kreditttpp- lys/tingsverksam/tet. om den är av större omfattning.

Lagen ont./intar ej

]. verksam/tel som avser förmed- ling av krt'ditttpplvsningar mellan kreditinrättningar. i den mån det är fräga om Sveriges riksbank. Sveriges investeringslmnk AB eller annan kreditinrättning ttnder bankinspek- tionens tillsyn än finansbolag enligt lagen (l979zllllll) om finansbolag.

3. verksamhet som avser förmed- ling av kreditupplystlingar mellan företag inom samma koncern. eller

3. utgivning av tryckt skri/t eller annan skrift srnn avses i I kap. 5 .5 tr_v('kjriltUls/'i)rörd/tingen. ()HI nlgiv- ningen sker utan väsentligt s_v/te att

förmedla krvtlitttpplysningnr.

l Nuvarande lydelse angiven enligt förslag i prop. 1978..="79:l7()

Hänvisningar till S8

Prop. l980/8lzlll

Nuvarande lydelse

I lagen avses med kreditupplysning : uppgift. omdö- me eller räd som lämnas till ledning för bedömning av annans kreditvär— dighet eller vederhäftighet i övrigt i ekonomiskt hänseende.

persmupplysning: kreditupplys- ning om atttutn enskild person ("in den som är na'ringsit'lkare eller anttars ltar så väsentligt inflytande i viss närings- verksamhet att uppgift om ltans egna _l'tft'rltållant'len behövs för att belysa sliill-

verksamhetens ekonomiska

ning.

I.)

173. Föreslagen lydelse

l-"itl tillt'itnpningen av andra styeket ! skall med kretlilinrt'illning untler lmnkinspektionens tillsyn jämställas annat _/'t')'reta__e unt/er ins/n'ktt'unens tillsyn. om det ltar inrt'ittatsj't'ir kretlit-

tqntlysningsverksam/tet.

'I]:

I lagen avses med

kreditumslysning: uppgift. omdö- me eller räd som lämnas till ledning för bedömning av annans kreditvär- dighet eller vederhäftighet i övrigt i ekonomiskt hänseende.

personupplysning: kreditupplys-

ning om enskild person.

s'

Kreditupplysningsverksamhet fär bedrivas endast efter tillständ av data-

inspektionen.

Tillstand behövs ej för kreditupp- lysningsverksamhet. i den män den bet/rives genom offentliggörande av kreditupplysning i tryckt skrift.

' Tillstånd att bedriva kreditupplys- ningsverksamhet får meddelas 'en— dast om det från allmänna synpunk- ter finns behov av verksamheten och

den kan antagas bli bedriven pa ett

Tillstand behövs ej för kreditupp- lysningsverksamhet. i den man den Iver/rivs genom offentliggöramle av kreditupplysning i tryckt skrift eller annan skrift som avses i ! kap. ) s*"

tryckfriltetsjk'irart/ningen.

7/-

Tillständ att bedriva kreditupplys- ningsvcrksamhet fär meddelas en- dast om det frän allmänna synpunk- ter finns behov av verksamheten och

den kan antas bli bedriven pä ett

Prop. 1980/81 : 10

Nuvarande lydelse sakkunnigt och omdömesgillt sätt. Tillstand meddelas för en tid av högst tio år i sänder och får förenas med föreskrift om hur verksamheten skall bedrivas.

174

Föreslagen lydelse

sakkunnigt och omdömesgillt sätt.

Tillständftir meddelas fören tid av högst tio år i sänder. Det får förenas med föreskrift om hur verksamheten skall bedrivas och om skyldighet att annu'ila ändring av förluillande som ltar haft ltetvdelse för tillståndet.

Tillstand får ej meddelas någon för vilken gäller inskränkning i rätten att förvärva fast egendom enligt lagen (1916:156) om vissa inskränkningar i

rätten att förvärva fast egendom m. m.

Uppgift om någons politiska eller religiösa uppfattning. ras eller hudfärg får icke insamlas. lagras eller vidarebefordras i kreditupplysningsvcrksam- het.

Uppgift om att någon ntisstiittkes eller dömts för brott eller avtjänat straff eller undergått annan påföljd för brott eller varit föremål för ätgärd enligt barnavårdslagen (196097). lagen (1954579) om nyk- terhetsvård. lagen (195632) om soci- alhjälp. lagen (l966:293) om bere- dande av sluten psykiatrisk värd i vissa fall. lagen ( l967:94()) angående omsorger om vissa psykiskt utveck- lingsstörda. lagen (l964:450) om åtgärder vid sanihällsfarlig asociali- tet eller utlänningslagen (l954:l93) får ej utan medgivande av datain- spektionen insamlas. lagras eller vidarebefordras i kreditupplysnings- verksamhet. Detsamma gäller upp- gift om sjukdom. hälsotillstånd eller liknande.

Uppgift om att någon tnissu't'nks eller dömts för brott eller avtjänat straff eller undergått annan påföljd för brott eller varit föremal för ätgärd enligt barnavårdslagen (1960197). lagen (1954:579) om nyk- terhetsvård. lagen (1956:2) om soci- alhjälp. lagen (1966293) om bere- dande av sluten psykiatrisk vård i vissa fall. lagen (1967:94t)) angående omsorger om vissa psykiskt utveck- lingsstörda. lagen (1964z450) om åtgärder vid samhällsfarlig asociali- tet. lagen (1973:558) om tillfälligt omltändertagande. lagen (197651!) om ()mltiindermgatule av berusade personer m. ut. eller utlänningslagen (l954:l93) får ej utan medgivande av datainspektionen insamlas. lagras eller vidarebefordras i kreditttpplys- ningsverksamhet. Detsamma gäller - uppgift om sjukdom. hälsotillstånd

eller liknande.

Medgivande som avses i andra stycket får lämnas endast om synnerliga skäl

Prop. 1980/81210 175

Nuvarande lydelse Föreslagen lydelse 7 &

Personupplysning får ej innehälla uppgift om annan betalningsförsummel- se än sädan som fastslagits genom domstols eller annan myndighets avgi'irande eller ätgärd eller som lett till betalningsinställelse. konkursansö- kan eller ackord. Uppgift som enligt det sagda ej får lämnas ut fär icke heller

lagras. Datainspektionen fär medge undantag frän bestämmelserna i

första stycket.

Personupplysning får ej innehälla uppgift om omständighet eller för- hallande som är av betydelse för bedömningen av nägons vederhäf- tighet i ekonomiskt hänseende. om fem är förflutit frän utgängen av det är då omständigheten inträffade eller förhållandet upphörde. Upp- gift som enligt det sagda ej får lämnas ut skall efter den angivna tiden gallras ut ur register som användes i kreditupplysningsverk- samhet. Gallringen skall göras så snart det kan ske och i vart fall innan upplysning lämnas om den som upp- giften avser.

Regeringen eller. efter regeringens bestiintntande. datainspektionen fär ji'ireskriva undantag frän bestäm- melserna i första stycket. om det ln'liövsför att undvika att personupp- lysning hlir up,.)enbart missvisande.

Personupplysning fär ej innehälla uppgift om omständighet eller för- hällande som är av betydelse för bedömningen av nägons vederhäf- tighet i ekonomiskt hänseende. om tre är förflutit frän utgangen av det är då omständigheten inträffade eller förhållandet upphörde. För uppgift om att någon inställt sina lwtalningar. vari/jörsalt [ konkurs eller medgivits ackord och om att någon lta/'t infly- tande örer ett vixxtji'iretag giiller dock

en tid av fem år.

Uppgift som enligt första stycket ej får lämnas ut skall efter den angivna tiden gallras ut ur register som används i kreditupplysnings- verksamhet. Gallringen skall göras så snart det kan ske och i vart fall innan upplysning lämnas om den som uppgiften avser.

Prop. HSO/81:10

Nuvarande lydelse

176

Föreslagen lydelse

lös"-

Var och en har rätt att mot skälig avgift hos den som bedriver kredit- upplysningsverksamhet fa skriftligt besked om innehället i de uppgifter som finns lagrade om honom.

Var och en har rätt att mot skälig avgift hos den som bedriver kredit- upplysningsverksamhet fä skriftligt besked om innehället i de uppgifter sotn fimrs lagrade om honom eller om att sädana uppgifter ej finns lagrade i l'crksantlu'ten.

lls'

Om personupplysning lämnas pä annat sätt än genom (.)ffentliggt'iran- de i tryckt skrift. skall skriftligt meddelande om ttpplvsningens inne- häll samtidigt lämnas ktjrstnadsfritt till den som app/_vmingen avser.

(')m personupplysning lämnas på annat sätt än genom offentliggöran- de i tryckt skrift. skall den som avses med upp/_l'sningen samtidigt och kostnadsfritt tillställas-skriftligt med— delande om vad upplysningen innc- luillcr rörande honom och för vcins räkning den har begärts. Har som ett led [ ttpplvsningen uppgifter lämnats även om annan person, skall detta anges i meddelandet jämte den andra personens Ittth/t. .»lndra uppgifter rörande den personen än identitets- uppgi/ier och adress j'är ej./'ramgä av mcddelamlct.

12.5

Förekommer anledning till misstanke att uppgift i kreditupplysning som lämnats under den senaste tolvmäntulersperioden eller i register som användes i kreditupplysningsverksamhet är oriktig eller missvisande. skall den som bedriver verksamheten utan dröjsmäl vidtaga skäliga ätgärder för att utreda förhållandet.

Visar sig uppgiften vara oriktig eller missvisande. skall den. om den förekommer i register. rättas. kom- pletteras eller uteslutas ur registret. l—lar uppgiften tagits in i kreditupp— lysning som lämnats pa annat sätt än genom tryckt skrift. skall rättelse eller komplettering så snart det kan

Visar sig uppgiften vara oriktig eller missvisande. skall den. om den förekommer i register. rättas. kom- pletteras eller uteslutas ur registret. Har uppgiften tagits in i kreditupp- lysning som lämnats pa annat sätt än genom tryckt skrift eller annan skrift

som avses i 1 kap. 5 s*" tryckfrihers/'o'r-

Prop. 1980/81:10

Nuvarande lydelse

ske tillställas var och en som under den senaste tolvmänadersperioden fått del av uppgiften. Har uppgiften lämnats i periodisk skrift. skall rät- telse eller komplettering så snart det kan ske införas i ett följande num- mer av skriften. Vad som sägs i detta stycke gäller dock icke, ont uppgif- ten uppenbarligen saknar betydelse för bedömningen av vederbörandes vederhäftighet i ekonomiskt hänse- ende.

177

Föreslagen lydelse

ordningen. skall rättelse eller kom- plettering sä snart det kan ske till- ställas var och en som under den senaste tolvmäitadersperioden fätt del av uppgiften. Har uppgiften läm- nats i periodisk skrift. skall rättelse eller komplettering sä snart det kan ske införas i ett följande nummer av skriften. Vad som sägs i detta stycke gäller dock uppenbarligen saknar betydelse för

icke. om uppgiften bedömningen av vederbörandes ve— derhäftighet i ekonomiskt hänseen- de.

Har fråga om rättelse eller liknande ätgärd tagits upp efter framställning från den som uppgiften avser. skall denne kostnadsfritt underrättas om huruvida sådan ätgärd vidtagits.

13 å Register som användes i kreditupplysningsverksamhet får överlåtas eller upplåtas till annan endast efter medgivande av datainspektionen.

Upphör någon att bedriva kredit- upplysningsvcrksamhet, skall han anmäla detta till datainspektionen. lnspektionen föreskriver i sådant fall hur det skall förfaras med register som använts [ vcrksatttheten.

Den som upphör att bedriva kre- ditupplysningsverksamhet eller som avser att kassera ett register som används i sådan verksamhet skall anmäla detta till datainspektionen. lnspektionen föreskriver i sådana fall hur det skall förfaras med regis- ter som berörs av ätgärden.

16 % Datainspektionen har rätt att företaga inspektion hos den som bedriver kreditupplysningsverksamhet och att taga del av samtliga handlingar som rör verksamheten.

Den som bedriver kreditupplysningsverksamhet skall lämna datainspek- tionen de upplysningar om verksamheten som inspektionen begär för sin

tillsyn.

12 Riksdagen 1980/81. ! saml. Nr 10

Bedrivs . kreditupplysningsverk- samhet genom utgivande av tryckt skrift eller annan skrift som avses i 1 kap. 5 # tryckfriltetsjörardningen,

Prop. 1980/81:10

Nuvarande lydelse

178

föreslagen lydelse

skall den som bedriver verksamheten inom en vecka efter utgivandet kost— nadsfritt tillställa dataittspektionen ett exemplar av skriften.

19 å:

- Till böter eller fängelse i högst ett är dömes den som uppsåtligen eller av oaktsamhet

1. bedriver kreditupplysnings- verksamhet utan tillstånd enligt den-

- na lag. när sådant erfordras.

2. bryter mot (w—l) eller 13 & eller mot föreskrift som meddelats enligt 4 åförsta stycket eller 17 ä'. eller

3. lämnar osann uppgift i fall som avsesi 10 eller 11 S*" elleri 16 5 andra stycket.

Till böter eller fängelse i högst ett är döms den som uppsåtligen'eller av oaktsatnhct

1. bedriver kreditupplysnings- verksamhct utan tillstånd enligt den- na lag. när sadant tillstånd erford- ras.

Z. bryter mot (3—9 6.13 & första stycket eller andra stycket _lörsta meningen eller 16 ; tredje stycket.

3. bryter mot föreskrift som med- delats enligt 4 & andra stycket. 13 s* andra stycket andra meningen eller 17 &. eller

4. lämnar osatm uppgift i fall som avses i 1() # "eller 16 å andra stycket eller i meddelande enligt Il s* såvitt angårförhållande som avses i ll # första eller andra meningen.

21) &

l-lar kreditupplysningsverksamhet bedrivits titan tillstånd enligt denna lag. när sådant erfordras. skall regis- ter som använts i verksamheten för- klaras fi'irverkat. om det ej är uppen- bart obilligt. Detsamma gäller. om register överlåtits eller upplåtits i strid med 13 5 första stycket.

3 Senaste lydelse 1975z7—ll

Har kreditupplysningsverksamhct bedrivits utan tillstånd enligt denna lag. när sädant til/stånd erfordras. skall register som använts i verksam- heten förklaras fi'irverk'at. om det ej är uppenbart obilligt. Detsamma gäller. om register överlåtits eller upplåtits i strid med 13 & första stycket eller om fri/tiskt!) som med- delats enligt 13 5 andra styrke! andra meningen ej följts.

Prop. 1980/81:10 179

Denna lag träder i kraft den 1 juli 1980. Utan hinder av första stycket får datainspektionen i tillständsärende som avgörs före den 1 juli 1981) meddela föreskrift enligt 4 & andra stycket om skyldighet att anmäla ändring av visst förhallande. såvitt angår tid från och med nämnda dag.

Prop. l980/81:10

Förslag till

180

Lag om ändring i inkassolagen (1974zl82)

Härigenom föreskrivs i fråga om inkassolagen (19741182) dels att 1—3. 5. 7. 11). 11. 2. lydelse.

13 och 17 vs skall ha nedan angivna

dels att rubrikerna närmast före 1 och 2 så skall ha nedan angivna

lydelse.

dels att rubriken närmast före 4 s. "Verksamhetens bedrivande m. m.".

skall bytas ut mot rubriken "Regler för inkasstwerksamhct".

dels att närmast före 9 & skall införas en ny rubrik. "Verkan av viss

betalning".

dels att närmast före 10. 1 1 och 12 ss skall införas nya rubriker av nedan

angivna lydelse.

dels att i lagen skall införas en ny paragraf. lt) a 5. av nedan angivna lydelse samt närmast före denna en ny rubrik av nedan angivna lydelse.

.N'ttvarant'le lydelse

Inledande bestämmelser

Denna lag gäller yrkesmässigt bedriven inkassoverksamhet. Verk- sam/tet Itos exekutiv myndig/tet orn- fattas doek ej av lagen.

Med inkassoverksamhet avses i denna lag verksamhet med syfte att driva in betalning för fordran.

Föreslagen lydelse

Tillämpningsområde

Denna lag gäller inkassoverksam- het som avser

]. indrivning av fordringar för annans räkning eller fordringar som övertagits för indrivning.

Z. indrivning av egna fordringar som tillkommer annan än enskild person eller dödsbo. eller

3. indrivning av egna fordringar som tillkommer enskild person eller dödsbo och som har uppkommit i näringsverksam/tet.

Med inkassoverksamhet förstås i lagen verksamhet för indrivning av fordran genom krav eller annan åtgärd som ej endast innebär att gäldenären underrättas eller erinras om fordringen.

Lagen gäller ej exekutiv myndig- ltets verksam/tet.

Prop. l980/81:10

Nuvarande lydelse

Tillstånd m. m.

181

Föreslagen lydelse

Tillstånd för viss inkassoverksam- het

&

lnkassoverksamhet. som avser indrivning av fordringar för annans räkning eller fordringar som övertagits för indrivning. fär bedrivas endast efter tillstånd av datainspektionen. Tillstånd behövs ej för inkasso- verksamhet som bedrives av Sveriges riksbank. Sveriges investeringslmnk AB. kreditinrättning under bankin- spektionens tillsyn eller advokat.

Tillständ får meddelas endast om verksamheten kan antagas bli bedri- ven pä ett sakkunnigt och omdömes- gillt sätt. Tillständ meddelas för en tid av högst tio år i sänder och får förenas med föreskrift om hur verk- samheten skall bedrivas.

'.)J

Tillstånd behövs dock ej för inkas- soverksamhet som

I. är av tillfällig natur och avser endast enstaka fordringar.

2. utgör ett underordnat led i en annan verksamhet som bedrivs utan fört-'ärt-isssfte.

3. bedrivs av ett företag för antiat företa],7 som tillhör samma koncern. eller

4. bedrivs av Sveriges riksbank. Sveriges investeringsbank AB. före- tag under bankinspektionens tillsyn eller advokat.

Uta/antagen under andra stycket 2 och 3 gäller ej. om verksamheten avser jordrittgarsom tillkommer eller har övertagits frän någon som inte utan tillställt] enligt denna lag hade kunnat driva in fordringarna.

Tillstand får meddelas endast om verksamheten kan antas bli bedriven palett sakkunnigt och omdömesgillt sätt.

Tillståndjär meddelas för en tid av högst tio år i sänder. Det får förenas med föreskrift om hur verksamheten

Prop. 1980/81:10

Nuvarande lydelse

Krav mot gäldenär skall framstäl- las skriftligen. Vad som fordras i kapital. ränta och ersättning för kostnader skall anges var för sig. I fråga om ränta skall särskilt anges beloppet av upplupen ränta. ränte- satsen samt den tid och det kapital- belopp som ligger till grund för ränteberäkningen.

182

föreslagen lydelse

skall bedrivas och om skyldighet att anmäla ändring av förhålla/ale som har haft betydelse för tillståndet.

Krav mot gäldenär skall framstäl- las skriftligt. Det skall innehålla tyd- lig uppgift om borgenärens namn och adress och om det förhållande som fordringen grundarsig på samt anvis- ning om lämpligt betalningssätt. Ä r det fråga om fordran som har överlä- tits eller pantsatts och katt gäldenären därför ej med befriande verkan betala till över/ritare eller pantsättare. skall kravet även innehålla tydlig upplys- ning om detta förhållande.

[ krav skall vad som fordras i kapital. ränta och ersättning för kostnader anges var för sig. I fråga om ränta skall särskilt anges belop- pet av upplupen ränta. räntesatsen samt den tid och det kapitalbelopp som ligger till grund för ränteberäk- ningen.

I samband med krav skall anges viss skälig tid inom vilken gäldenären har att betala frivilligt eller anmäla om han har någon invändning mot

kravet.

Bestämmelserna i 5 och 6 55 gäller ej, om gäldenären uppenbarligen söker undandraga sig att betala eller om det annars föreligger särskilda skäl att frångå vad som föreskrives där.

Bestämmelsen i 6 så gäller ej. om söker undandraga sig att betala eller om det annars föreligger särskilda skäl att frångå vad som föreskrivs där.

gäldenären uppenbarligen

Prop. l980/81:lO

Nuvarande lydelse

183

föreslagen lvl/else

Hantering av inkasserade medel

10 %

Medel som inkasserats för annans räkning skall hållas avskilda och utan dröjsmål insättas pä räkning i bank eller motsvarande. Har ej annat avtalats. skall medlen utan dröjsmål redovisas till huvudman-

llt-"1.

Medel som inkasserats för annans räkning skall hållas avskilda. Har medlen uppburits [ inkas.sot-'erksarn- het som ej är av tillfällig natur och ej heller avser endast enstaka fordring- ar. skall de utan dröjsmål insättas på räkning i bank eller motsvarande.

Har den som får borgenärs upp- drag att driva in fordran annat. fortlöpande uppdrag av borgenären att i väsentlig omfattning uppbära medel för dennes räkning utan skyl- dighet att hälla dessa medel avskilda. kan parterna skrl/tligen ö verenskom- ma om undantag från första styck- et. . Medel som inkasserats för annans räkning skall titan dröjsmäl redovi- sas till denne. om ej annat har avta- lats. '

Register i inkassoverksamhet

lt) a &

Register .som avser gäldenärer och som används i inkassoverksamhet för vilken fordras tillslånd enligt denna lag får överlåtas eller upplåtas till ' alt/lart endt'lst eter medgivande av ' datairispektiomfn.

Den som upphör nted inkasso- verksamhet som avses i första stycket ' eller som avser att kassera ett register som används i sådan verksamhet ska/! anmäla detta till datainspektio- nen. Inspektionen föreskriver i så- dana fall hur det skall förfaras med register som berörs av ätgärden.

Prop. 1980/81:10

Nuvarande lydelse

184

Föreslagen lydelse

Tystnadsplikt i inkassoverksamhet.

11.5

Den som är eller har varit verksam i inkassoverksamhetför vilken krävs tillstånd enligt denna lag får ej obe- hörigen yppa vad han till följd därav fått veta om enskilds personliga för- hållanden eller om yrkes- eller af- färshemlighet.

Den som är eller har varit verksam i inkassoverksamhet avseende in- drivning av fordringar för annans räkning eller fordringar som överta- gits för indrivning får ej obehörigen yppa vad han till följd därav fått veta om enskilds personliga förhällanden eller om yrkes- eller affärshemlig- het.

[ stället för första stycket gäller särskilda bestämmelser om tystnads- plikt i verksamhet som bedrivs av Sveriges riksbank. Sveriges investe- ringsbank A B. företag under bankin- spektionens tillsyn eller advokat.

Kostnad för inkassoätgärd

12.5

Om gäldenärs skyldighet att ersät- ta kostnad för inkassoåtgärd i vissa fall finns särskilda bestämmelser.

()m gäldenärs skyldighet att ersät- ta kostnad för inkassoätgärd finns särskilda bestämmelser.

13%5

Datainspektionen utövar tillsyn över efterlevnaden av denna lag. Inspektionens tillsyn omfattar dock ej verksamhet som bedrives av Sve- riges riksbank. Sveriges investe- ringsbank AB. kreditinrättning un- der bankinspcktionens tillsyn eller advokat.

Datainspektionen utövar tillsyn _över efterlevnaden av denna lag. lnspektionens tillsyn omfattar dock ej verksamhet som bedrivs av Sveri- ges riksbank. Sveriges investerings- bank AB.företag under bankinspek- tionens tillsyn eller advokat.

Tillsynen skall utövas så. att den icke vållar större kostnad eller olägenhet än som är nödvändig.

Prop. 1980/81:10

Nuvarande lydelse

185

Föreslagen lydelse

17.5|

Till böter eller fängelse i högst ett är dömes den som uppsåtligen eller av oaktsamhet

1. bedriver utan tillstånd enligt denna lag. när

inkassrwerksamhet

sådant erfordras. eller 2. lämnar osann uppgift i fall som avses i 14 å andra stycket.

Till böter eller fängelse i högst ett är döms den som uppsatligen eller av oaktsamhet

[. bedriver utan tillstånd enligt denna lag. när

inkassoverksamhet

sädant tillständ erfordras.

2. bryter mot föreskrift enligt 3 _6 andra stycket att anmäla ändring av visst f(fn'ltållande.

3. bryter mot ] () a s* första stycket eller andra stycket första meningen eller mot föreskrift som meddelats enligt l!) a 5 andra stycket andra meningen. eller

4. lämnar osann uppgift i fall som avses i 14 å andra stycket.

Har inkassaverksamhet bedrivits utan tillstånd enligt denna lag. när sådant tillstånd et'ferdras. skall regis- ter som avser gäldenärer och som använts i verksam/tetenjörklarasför- verkat. om det ej är uppenlmrt abil- ligt. Detsamma gäller. om register Överlätits eller upplåtits i strid med 1!) a 9" första stycket eller om jöreskrift som meddelats enligt 10 a 55 (un/ra stycket andra meningen ejfc'iljts.

Denna lag träder i kraft den 1 juli 1981). Utan hinder av första stycket får datainspektionen i tillständsärende som avgörs före den 1 juli 1980 meddela föreskrift enligt 3 å andra stycket om skyldighet att anmäla ändring av visst fifu'hå'tllamle. sävitt angär tid från och med nämnda dag.

Har någon erhållit tillstånd till inkassmterksamhet enligt äldre bestämmel- ser men fordras ej sädant tillstand enligt den nya lagen. skall dock föreskrift som förenats med tillståndet fortsätta att gälla till dess datainspektionen

beslutar om annat.

' Senaste lydelse l975:744.

Prop. 1980/81 : 10 186

Förslag till Lag om ersättning för inkassokostnad

Härigenom föreskrivs följande.

1 5 Denna lag gäller en gäldenärs skyldighet att utge ersättning för inkassokostnad.

Med inkassokostnad förstäs i lagen en borgenärs kostnad för krav och andra ätgärder som har syftat till att förmå gäldenären att betala en förfallen skuld. dock ej kostnad för mer omfattande förhandling för biläggande av tvistefräga rörande fordran.

2 & Gäldenären är skyldig att utge ersättning för inkassokostnad som avser * ä [. krav rörande skulden. om kravbrev som har utformats enligt inkassolagen (1974182) har tillställts gäldenären.

2. upprättande i samräd med gäldenären av fullständig plan för amorte- ring av äterstäcnde del av skulden. om planen har satts upp skriftligt och tillställts gäldenären.

Ersättningsskyldighet enligt första stycket gäller endast kostnad som har varit skäligen päkallad för att ta tillvara borgenärs rätt.

3 & Ersättning som avses i 2 .ö utges med skäligt belopp enligt vad regeringen närmare föreskriver. Med fordran pä sadan ersättning följer inte rätt till ränta.

4 & För annan inkassokostnad än som avses i 2 s är gäldenären inte skyldig att utge ersättning. ' Avtal som utvitgar gäldenärens skyldighet att utge ersättning för inkassokostnad utöver vad som följer av denna lag är "ogiltigt.

S & Beträffande skyldighet att ersätta kostnader för rättsligt l'i'ärfarande och liknande ätgärder finns särskilda"bestämmelser. '

Denna lag träder i kraft den 1 juli 1980. Äldre bestämmelser gäller dock fortfarande i fräga om kostnad för inkassoätgärd som har vidtagits före nämnda dag.

Prop. 1980/81:10 187

Förslag till Lag om ändring i lagen (l946:808) om lagsökning och betalningsfö- reläggande (lagsökningslagen)

Härigenom föreskrivs att 1—3. 5. 13. IS. W och 23 ss lagen ( warsus) om lagsökning och betalningsföreläggande (lagsökningslagen) skall ha nedan angivna lydelse.

Nut-'arande lydelse Föreslagen lydelse

1 t'

För fordran som grundar sig år skuldebrev eller annat skriftligt frn'drings- bevis och är till betalning förfallen ma gäldenären lagsökas enligt vad nedan sägs.

Om för fordran som avses i första stycket skriftligen upplatits panträtt i fast- egendom. skepp eller skeppsb_-'gge. kan btn'genären genom lagsökning söka betalning ur egendomen. llar borgenären för fordringen inteckning i luftfartyg eller reservdelar till luftfartyg eller fi.")retagsinteekning. kan han genom lagsökning söka betalning ur den egendom vari inteckningen gäller.

Lngsökning_li'n' också iiga rnm._/'r'.ir fordran på ersättning _l'o'r inkasso- kostnad som inte grundar sig på skrill/ig!l/ordringshet'is. om det sker i samband med lagsökning enligt _l'o'r- s/a eller amlra stycket/iir den fordran som har föranlett inkassokostna- den.

Lagsökning för fordran pri ersiin— ning för inkassokostnadI/iir äga rum. endast i den man den fordrade ersa'n- ningen kan ntgd enligt lagen (I979:(_)(I'()) om ersättning./"('n' inkasso— kl.).S'IIlt'lll.

Vad i denna lag sägs om gäldenä- ren tillämpas vid lagsökning enligt andra stycket pa ägaren av den egen- dom ur vilken betalning sökes.

Vad i denna lag sägs om gäldenä- ren tillämpas vid lagsifrkning som at'serjastsa'illelse lill bem/ning ur t'iss egendom pa ägaren av egendomen.

:s:

Lagsökning skall göras skriftligen hos allmän underrätt. Ansökningen skall innehälla uppgift om borgenärens namn. perst'mnummer. _vrke.

' Senaste lydelse ll)73:l(l74 3 Senaste lydelse 197311074

Prop. 1980/81:10 188

Nuvarande lydelse Föreslagen lydelse

hemvist. postadress och telefonnummer samt gäldenärens namn och. där sa kan ske. dennes personnummer. yrke. hemvist. postadress och telefonnum- mer. så ock fordringens belopp och den ränta som fordras. Borgenären angive ock de omständigheter som betinga rättens behörighet. om denna ej framgår av vad eljest anföres. Vid ansökningen skall fogas styrkt avskrift av handling varä fordringen grundas och. då betalning enligt 1 & andra stycket sökes ur fast egendom. skepp eller skeppsbygge. av handling varigenom

panträtt i egendomen upplåtits.

Ansökningen skall jämte avskrift som angivas i första stycket avlämnas i två exemplar och vara egenhändigt undertecknad av borgenären eller hans ombud. Är endast ett exemplar ingivet. ambesörje rätten mot statl- gad avgift erforderlig avskrift. och git/le den i målet lika med huvud— skrift.

3

Finnas åberopade handlingar ieke innefatta bevis om fordran eller rätt till betalning ur angiven egendom eller prövar rätten eljest hinder möta att upptaga ansökan enligt l 5 första eller andra stycket, skall den avvisas. Bevis därom skall tecknas (i ena exemplaret av ansökningen.

5

Det exemplar av ansökningen vara enligt 4 & föreläggandet teck- nats skall jämte fordringshandlingen

3 Senaste lydelse 1971:496

Avser ansökningen inkassokost- nad. skall vid ansökningen fogas styrkt avskrift av kravbrev eller annan handling för vars upprättande ersättning begärs:

Ansökningen skall jämte avskrift som anges i första och andra styckena avlämnas i två exemplar och vara egenhändigt undertecknad av borge- nären eller hans ombud. Har endast ett exemplar givits in. skall rätten mot föreskriven avgift göra den avskrift som behövs.

".

Finner rätten att de handlingar som har åberopats ej utgör bevis om fordran eller rätt till betalning ur den egendom som har angivits eller jin- ner rätten (umars att hinder förelig- ger mot att ta upp ansökan enligt l & första—tredje stvekena. skall avvis- ning ske. Bevis om avvisning skall tecknas på det ena exemplaret av ansökningen.

ä-l

Det exemplar av ansökningen varä enligt 4 s föreläggandet teck- nats skall jämte t'ordringslmndlingen

4Nuvarande lydelse angiven enligt SFS 19781773. som träder i kraft den 1 juli 1979

Prop. HSO/81:10

Nuvarande lydelse delgivas gäldenären pä sätt om stäm- ning i tvistemäl är stadgat.

189

Föreslagen lydelse

och handling som avses i 2 55 andra stycket delgivas gäldenären på sätt om stämning i tvistemäl är stadgat.

12 & Gör gäldenären mot kravet annan invändning än i ltt och l l åå sägs och vill styrka den. skall han genast förete sina bevis; ej mä andra än skriftliga bevis gälla. Finnes gäldenären hava skäl för invändningen. hänskjute rätten mälet säsom tvistigt till rättegäng. Grundas kravet å fordringsbevis vari gäldenären betingat sig vederlag för den utfäsm betalningen och gör gäldenären invändning som har avseende (i vederlaget. skall mälet såsom tvistigt hänskjutas till rätte- gång. om gäldenären f("ir'ebragt san- nolika skäl för invändningen eller borgenärens rätt till betalning eljest

finnes stridig.

Grundas kravet på ett fordringsbe- vis enligt vilket gäldenären .skall ha en motprestation för sin betalning och gör gäldenären en invändning som giiller )tio/prestationen. skall malet som tvistigt hänskjutas till rättegäng. om gäldenären har visat sannolika skäl för invändningen eller borgenärens rätt till betalning an- nars iir oklar. Detsamma giiller när giildent'iren gör invändning mot ett

krav som avser inkassokostmtd.

18 s* För utfäende av penningfordran som ej grundar sig åt skriftligt fordrings- bevis och icke avser skadeständ äge borgenären utverka betalningsfi'lreläg- gande enligt vad nedan sägs. Betalningsföreläggande må givas för fordran som avser inkassoät- gård.

Betalningsförcläggaudefår ges för fordran på ersättning för inkasso- kostnad i den mån den fordrade ersättningen kan utgå enligt lagen ( ] 979.000) om ersättningför inkasso- kostnad.

19 &"

Ansökning om betalningsförelz'iggz'tnde skall göras skriftligen eller munt- ligen hos allmän underrätt. Ansökningen skall innehälla uppgift om borgenärens namn. personnummer. _vrke. hemvist. postadress och telefon- nummer samt gäldenärens namn och. där så kan ske. dennes personnummer. yrke. hemvist. postadress och telefonnummer. så ock fordringens belopp och den ränta som fordras. Borgenären angive tillika i ansökningen eller i räkning

5 Senaste lydelse 1971318 "” Senaste lydelse 197314]

Prop. HSO/81:10 ' 190 Nuvarande [vt/else Föreslagen [_W/U/St' som åberopas tydligt och fullständigt grttnden för fordringen och tiden för dess tillkomst samt de omsti'tndighete'r som betinga rättens behörighet. om denna ej framgär av vad eljest anföres.

Ansökning som göres skriftligen skall avlämnas i tva exemplar och vara egenhändigt undertecknad av borgenären eller hans ombud. Är endast ett exemplar ingivet. besörje rätten mot stadgad avgift erftnderlig avskrift. och gälle den i malet lika med huvudskril't. ("röres ansökning muntligen. skall genom rättens försorg mot stadgad avgift uppteckning därav ske i tvä exemplar: borgenären eller hans ombud skall med sin underskrift vitsorda att uppteckningen är riktig. Uppteckningen gälle sedan som huvudskrift.

Räkning som äberopas skall ingi- t'ax i tvä exemplar: (ir räkningen ingiven i alle/tax! ett exemplar". skall mot stadgad avgift avskrift (larm-' [wsörjas av rti/len.

”73

Upptages ansökningen. förelägge rätten gäldenären att. säframt han vill helt eller till nägon del bestrida ansökningen. inotn viss av rätten bestämd tid efter det ansökningen jämte räkning. om sädan äberopats. blivit honom delgiven. skriftligen

hos rätten anmäla sitt bestridande

vid påföljd att utmätning eljest mä Vid

anmälan av bestridande har rätten ske. utsättande av tiden för att taga hänsyn till belägenheten av den ort där gäldenären bor eller handlingarna eljest kunna väntas bliva honom delgivna. Utan s_vnner- liga skäl ma tiden icke bestämmas längre än till tvä veckor.

Har borgenären i ansökningen

7 Senaste lydelse [97324]

Avser anxökningwl inkasmkosl- nat/. ska/! vid anxökningc'n _lirgnx .v/j'rkl avs/(rill av kravbrev eller annan ham/Iingji'ir vart nppriitnnnlt' ersättning begärt".

Räkning och annan Innu/ling som "aberopas skall gav in i tvä exemplar.

Har endast ett exemplar givits in. skall riinen mot _lifirexkrivcn avgift göra den avskrift .vmn ln'hävx.

Upptages ansökningen. förelägge rätten gäldenären att. såframt han vill helt eller till nägon del bestrida ansitikningen. inom viss av rätten bestämd tid efter det ansökningen jämte räkning och annan handling. om sädan åberopats. blivit honom delgiven. skriftligen hos rätten an- mäla sitt bestridande vid påföljd att utmätning eljest mä ske. Vid utsät— tande av tiden för anmälan av bestri- dande har rätten att taga hänsyn till belägenheten av den ort där gälde- nären bor eller handlingarna eljest kunna väntas bliva honom delgivna.

Utan'svnnerliga skäl mä tiden ieke "bestämmas längre än till två veck—

0 l' .

""Har borgenären i ansökningen

Prop. l980/81:10 l9l-

Nuvarande lvl/else Föreslagen lvl/else fordrat ersättning för kostnad ä fordrat ersättning för kostnad ä målet. skall rätten i föreläggandet mälet. skall rätten i föreläggamlet' angiva vad i sådant hänseende skall. angiva vad i sädant hänseende skall. om bestridande ej sker. utgä utöver om bestridande ej sker. utgä utöver kostnaden för blivande delgivning. kostnaden för blivande delgivning. Ersättningen utgär enligt bestäm- [Ersättningen utgär enligt bestäm— melser som Konungen meddelar. melser som regeringar tneddelar. Föreläggandet. som skall tecknas ä ena exemplaret av; ansökningen. skall tillika innehälla anmaning till gäldenären att hos rätten anmäla perst'mnum- mer. hemvist. postadress och telefonnummer. sävida tillförlitlig uppgift härom icke föreligger. '

Denna lag träderi kraft den l juli 1980. Äldre bestämmelser gäller dock fortfarande i fråga om inkassokostnad avseende inkassoätgi'trd som har vidtagits före nämnda dag.

Prop. 1980/8l:10 192

Förslag till Lag om ändring i rättegångsbalken

Härigenom föreskrivs att IR kap. 8 & rättegängsbalken skall ha nedan angivna lydelse.

Nuvarande lydelse Föreslagen lydelse

8 ä'

Ersättning för rättegångskostnad skall fullt motsvara kostnaden för rättegångens förberedt'tnde och talans utförande. jämte arvode till ombud eller biträde. sävitt kostnaden skäligen varit päkallad för tillvaratagande av partens rätt. Ersättning skall ock utgä för partens arbete och tidsspillan i anledning av rättegängen. Säsom åtgärd för rättegångens f("irbcredande anses förhandling för biläggande av tvistefräga som har omedelbar betydelse för partens talan.

lnkasmåtgc'ird som vidtagits före rättegången ersätts som rättegångs- kostnad. Ersättning för sftdan kost- nad utgår enligt bestämmelser sattt regeringen ttteddelar.

Ersättning för rättegångskostnad skall även innefatta ränta efter sex procent från dagen då målet avgöres till dess betalning sker.

Denna lag träder i kraft den 1 juli 1980. Äldre bestämmelser gäller dock fortfarande i fråga om kostnad för inkassoätgi'trd som har vidtagits före nämnda dag.

| Senaste lydelse 197457]

PrOp. l980/8l:10

Förslag till

193

Lag om ändring i lagen ( 1974:8) om rättegången i tvistemål om mindre värden

I-lärigcnom föreskrivs att 8 a' lagen (' l974:8) om rättegången i tvistemål om mindre värden skall ha nedan angivna lydelse.

Nuvarande lydelse Föreslagen lydelse

8.5'

Ersättning för rättegångskostnad får ej avse annat än kostnad för

1. rådgivning enligt rättshjälpsla- gen (l972:429) vid ett tillfälle för varje instans.

2. ansökningsavgift.

3. resa och uppehälle för part eller ställföreträdare i samband med sammanträde eller. om personlig inställelse ej föreskrivits. resa och uppehälle för ombud,

4. vittnesbevisning.

5. översättning av handling. vidtagits

6. inkassoätgärd som före rättegån gett.

Ersättning för rättegångskostnad får ej avse annat än kostnad för

[. rådgivning enligt rättshjälpsla- gen (1972z429) vid ett tillfälle för varje instans.

2. ansökningsavgift.

3. resa och uppehälle för part eller ställföreträdare i samband med sammanträde eller. om personlig inställelse ej föreskrivits. resa och uppehälle för ombud.

4. vittnesbevisning.

5. översättning av handling.

Ersättning utgår endast i den mån kostnaden varit skäligen päkallad för tillvaratagande av partens rätt. Ersättning som anges i första stycket 3 och ö utgär enligt bestäm- melser som regeringen meddelar.

Ersättning som anges i första stycket 3 utgär enligt bestämmelser som regeringen meddelar.

Med kostnad som sägs i första stycket 1 jämställes kostnad för annan rådgivning som lämnas av advokat eller biträdande jurist på advokatbyrå. i den mån den ej överstiger i rättshjälpslagen bestämd rådgivningsavgift.

Har mål till en början handlagts i annan ordning än enligt denna lag. utgår ersättning för kostnad som uppkommit i samband därmed enligt vad som gäller därom.

Denna lag träderi kraft den 1 juli 1980. Äldre bestämmelser gäller dock fortfarande i fråga om kostnad för inkassoätgärd som har vidtagits före nämnda dag.

' Senaste lydelse l977:1144.

13 Riksdagen 1980/81. ] sattt]. Nr 10

Prop. HSO/81:10 194

Bilaga 2

Avsnitten 7 och 8 i datainspektionens utredning 1978-06-20 angående inkassoföretagens kostnader m. m. med därtill hörande underhilaga 2

7 Kostnadsundersökningen 7.1 Undersökningens bakgrund. syfte och avgränsning

Den senaste undersökningen av kostnadsläget för inkassoföretagen gjordes pä justitiedepartcmentets uppdrag av datainspektionen och dom- stolsväsendets organisationsnämnd hösten 1974. Undersökningsresultatet lades till grund för att fastställa ersättningsbelopp i inkassokostnadskungö- relsen. vilken trädde i kraft den 1 januari 1975.

Jämsides med den nyssnämnda undersökningen övervägdes ersättningsni- väerna för ätertagning. Ersättningsbeloppen fastställdes i ätertagandekost- nadskungörelsen vilken också trädde i kraft den 1 januari 1975.

Ersättningsbeloppen har sedermera — efter framställning från vissa inkassoföretag och remiss till berörda myndigheter — höjts genom ändring (19751971 och 19761795) av inkassokostnadskungörclsen. På motsvarande sätt har ersättningsbeloppen för ätertagning höjts genom ändring (19751972 och 19761796) av ätertagandekostnadskungörelsen.

De ändringar som gjorts av ersättningsbeloppen har grundats pä bedöm- ningar av den allmänna pris- och kostnadsutveeklingcn sedan den förra undersökningen.

Undersökningens syfte har varit att undersöka dels inkassoföretagens kostnader för att ge en rättvisande bild av kostnadsläget i branschen. dels förutsättningarna för en mera långsiktig reglering av crsättningsniväerna med hänsyn till kostnadsutvecklingen och förändringar i branschen än den som hittills tillämpats.

Datainspektionen har i den nu aktuella undersökningen ansett det nödvändigt att göra en mera ingående utredning av inkassoföretagens faktiska kostnader än som av tidsskäl var möjlig att göra i 1974 års undersökning. Kostnadsläget vid de undersökta företagen har sålunda kartlagts i detalj.

En viktig förutsättning för att bedöma undersökningsresultatet är frågan om representativitet. Av praktiska skäl har datainspektionen haft att avgränsa undersökningen till ett urval av samtliga företag. Urvalet har bestämts med hänsyn till att företagen skall ha erfarenhet av samtliga ätgärdstyper och att antalet vidtagna ätgärder skall vara av sådan omfattning att förutsättningar finns att uppskatta den genomsnittliga tidsätgängen i varje ätgärdstyp med ett visst mått av säkerhet. Datainspektionen anser att undersökningen haft en sådan omfattning som det av praktiska och

Prop. 1980/81110 195

ekonomiska skäl varit möjligt att uppnå med den tid som stått till undersökningens förfogande.

Det bör dock framhällas att metoden inneburit att de är de största och rimligen mest rationellt drivna företagen som deltagiti undersökningen. En inte oväsentlig del av all inkassoverksamhet drivs av få- eller enmansföretag som dessutom ofta sysslar med bokföringsuppdrag och liknande. Rimligen kan indrivningsrutinerna i sädana företag inte hanteras lika rationellt som i de specialinriktade större inkassoföretagen.

Under utredningsarbetct har datainspektionen den 17 oktober 1977 avgett yttrande över framställning den 8 juli 1977 vissa inkassoföretag om höjning av ersättningsbeloppen för inkassoätgärd. amorte ringsplan samt ansökan om betalningsföreläggandc. lagsökning och ätertagning. Datainspektionen — liksom domstolsverkct — avstyrkte i princip inkassoföretagcns framställning mot bakgrund av de preliminära undersökningsresultaten. Genom ändring (197858) av inkassokostnadskungörelscn och ändring (1978157) av återta- gandekostnadskungörelsen har ersättningsbeloppen för amorteringsplan. betalningsföreläggande. lagsökning och ätertagning höjts fr.o.m. den 1 april 1978.

Resultatet och förutsättningarna för kostnadsundersökningen redovisas närmare i bilagorna 2—5" samt under avsnitten 7.2 och 7.3. Möjligheterna till en långsiktig reglering av ersättningsbeloppen behandlas i avsnitt 8.

7.2. Undersökningens resultat

I bilaga 513 redovisas de genomsnittliga kostnaderna för de ätgärdstyper som har undersökts. Kostnaderna redovisas som ett vägt genomsnitt vilket bl. a. innebär att kostnaderna per ätgärdstyp för företag med ett stort antal ätgärder av ifrägavz'trandc slag fått propm'tionellt större betydelse än kostnaderna per ätgärdstyp för företag med ett färre antal ätgärder.

De i bilaga 5:3 framräknade genomsnittliga kostnaderna för olika åtgärdstyper hänför sig till kostnadsläget i juli 1976 om företagens skilda redovisningsperioder jämkas samman. För att bedöma kostnadsutveckling- en för tiden efter juli 1976 får tillgängliga kostnadsindex användas.

Kostnaderna kan — såsom har gjorts i bilaga 5:1 — delas upp i tre grupper. nämligen löner med sociala omkostnader. datorkostnadcr och övriga kostnader. Löner med sociala kostnader svarar för i genomsnitt 60 % av de totala kostnaderna medan dat(_)rkostnader och övriga kostnader följaktligen svarar för resten av kostnaderna. Bland övriga kostnader kan nämnas porton och telefon som svarar för 6 resp. 1 92:- av totalkostnaderna.

Lönerna har antagits följa löneutvecklingen för det 5. k. HTF-kollektivet (till vilken fackliga organisation personalen vid inkassoföretagen är anslu- ten). Till ökningarna av lönerna kommer eventuella ändringar av företagens sociala kostnader. Datorkostnadcr och övriga kostnader med undantag för

" Bilagorna 3—5 uteslutna här.

Prop. l980/81:10 196

. porto och telefon har. i brist på något mera rättvisande index. antagits följa konsumentprisindex.

Löneutvecklingen för HTF-kollektivet' har beräknats med ledning av de standardberäknade löneökningarna med avseende pä älder och yrkesför- ändringar (SÄY).

Under tiden augusti 1976 —- augusti 1977 ökade de utgående bruttolönerna. exkl. sociala avgifter. för HTF-kollektivet med9.5 %. Efter augusti 1977 har avtalsenliga löneökningar skett med 1 % fr. o. m. den 1 oktober 1977 och fr. o. m. den 1 december 1977 med ytterligare 1.3 %. Kostnaderna för 1978 års avtal har inte beaktats vid framräkningend

De successiva löneökningarna för HTF—kollektivet motsvarar en ökning sedan augusti 1977 på 12 % när en "ränta på räntaberäkning" görs.

Företagens sociala kostnader utgjorde under 1976 38.7 % och under 1977 42.8 %- pä de utgående bruttolönerna. 1978 har de beräknats till 42.9 %. Ökningen frän 1976 till 1977 har säledes varit 4.1 % pä bruttolönesum- man.2

Konsumentprisindex har under tiden fr. o. m. augusti 1976 t. o. m. december 1977 ökat med 17 %.

Portokostnaderna ökade mellan 1976 och 1977 med 10 % (höjning fr. o. m. den 1 mars 1977). En ytterligare höjning med i genomsnitt 17 % fr.o.m. den 1 mars 1978 har vidare beslutats. Telefonkostnaderna har fr. o. m. den 1 december 1977 höjts med 21 % vad gäller samtalsmarkering- ar. Övriga teleavgifter har höjts med mindre än 21 %. [ beräkningarna förutsätts emellertid att samtliga telefonkostnader har höjts med 21 %.

En beräkning av kostnadsläget som det gestaltar sig vid början av 1978 för de undersökta företagen tillsammans fär följande utseende.

Kostnadsslag Kostnad enligt Kostnad vid Skillnad

undersökningen ingången av (milj. kr) juli 1976 ' 1978 (milj. kr) (milj. kr) Lönekostnader 13.446 15.060 1.614 Sociala kostnader 5.204 6.446 1.242 Portokostnadcr 1.773 1.950 0.177 - Telefonkostnader 0.358 0.433 0.075 Datorkostnadcr och övriga kostnader 9.800 1 1.466 1.666 Summa 30.581 35.355 4.774

Skillnad i % ' 15.6

l Uppgifterna har inhämtats frän Handclstjänstcmannaförbundct och ingär i den lönestatistik som framställs i det reguljära statistiksamarbetet mellan SAF och FFK—organisationerna. . 2 Uppgifterna har hämtats ur SAF-publikationen Hur man beräknar företagets sociala kostnader för resp. är.

Prop. l980/8l:10 197

Av beräkningen framgår att företagens kostnader 1978 hade ökat med i genomsnitt 15.6 % från den tidpunkt (juli 1976) som undersökningen hänför sig till. I följande sammanställning har ökningen applicerats på de kostnader som redovisas för juli 1976. lnkassoföretagens kostnader i januari 1978 framgär av den högra kolumnen.

Kostnad per ätgärdstyp

Ätgärdstyp Juli 1976 Januari 19781 Krav 23.33

29.252 33.812 Lagsökning 88.45 102.25 Betalningsföreläggande 79.96 92.43 Ätertagning 101.10 116.87 Utmätning 42.96 49.66 Amorteringsplan ' 23.50 " 27,16 Avisering och bokföring 16.02 18.52

| Den beräknade ökningen om 15.6 % har bestämts på grundval av den totala fördelningen på kostnadsslag oavsett ätgärdstyp. Beräkningen blir approximativ när ökningstalet appliceras på kostnaderna för resp. atgärdstyp. Orsaken är att fördel— ningen pä kostnadsslag skiljer sig åt mellan åtgärdstypcrna. 1 den nu redovisade beräkningen innebär ökningen att kostnaderna per ätgärdstyp i genomsnitt blir något för högt beräknade: 3 Kostnad exkl. kostnaderna vid det företag i undersökningen som använde krav i form av s. k. inkassobrcv. Företaget ifråga har efter en fusion numera upphört.

7.3. Undersökningsresultatet jämfört med tidigare och nu gällande ersätt- ningsbelopp

Av följande tabell framgär nu gällande ersättningsbelopp (april 1978). de ersättningsbelopp som gällde i januari 1978 och kostnaderna enligt under- sökningen i januari 1978.

Åtgärdstyp Ersättnings— Ersättnings- Kostnad (avrundat) belopp (april belopp (januari enligt undersök- 1978) 1978) ningen (januari

1978)

Krav 50 50 34 Lagsökning 130 120 102

Betalnings—

föreläggande 110 100 92 Återtagning 130 120 117

Utmätning — 50l

Amorterings-

plan 40 25 27 Avisering och bokföring 152 103 19

' Det har ej i detta sammanhang undersökts hur stor andel av slutbevis och lagsökningsutslag som föranleder utmätning. 3 Ersättning för avisering och bokföring av belopp sominllyter efter amorteringsplan har genom beslut av datainspektionen godtagits på sätt framgår av avsnitt 4.3 ovan. Denna kostnadspost avses i datainspektionens förslag bli författningsregler'ad.

Prop. 1980/81:10 198

Som framgår av tabellen har undersökningen visat att inkassoföretagens kostnader per januari 1978 i huvudsak väl täckts av de författningsreglerade ersättningsbelopp som då gällde. Endast ersättningen för amorteringsplan läg något under de framräknade kostnaderna. Även de av datainspektionen godtagna ersättningsbeloppen för aviserings- och bokföringskostnader läg lägre än de verkliga kostnaderna. Genom författningsändringar ( 197857 och 197858) har ansökningskostnaderna för lagsökning. betalningsföreläggande och ätertagning samt för upprättande av aintmeringsplan höjts fr. o. m. den 1 april 1978. Då särskild ersättning ej utgär för utmätning skall i få.")rekommande fall denna kostnad täckas av ersättningsbeloppen avseende ansökan om betalningsföreläggande respektive lagsökning.

Med hänsyn till undersökningsresultat och med beaktande av höjningarna per den 1 april 1978 av ersättningsbeloppen och hittillsvarande kostnadsök- ningarna under 1978 kan konstateras att gällande ersättningsbeloppcn nu ligger över de verkliga kostnaderna för inkassoföretagen. Det sagda utesluter självfallet inte att enskilda företag kan hävda att de har kostnader som är större än de nu gällande författningsreglerade ersi'ittningsbeloppen.

litt utgångsläge med något för höga ersättningsbelopp jämfört med de verkliga kostnaderna är dock inte enbart av ondo. Intervallet till nästa beloppsändring kan göras längre och den ordning för långsiktig reglering som föresläs under 8.4 kan därmed hinna tillämpas praktiskt innan dess. Behov av ändrade ersättningsbelopp torde inte rimligen uppkomma innan erfarenhe- ter erhällits från den nya lagstiftningen som träder i kraft 1979. De författningsändringar som kan erfordras för konsumentkreditlagen (19771981) och den föreslagna avbetalningsköplagen (prop. 19777782142) kan således genmnföras utan att ersättningsniväerna behöver ändras.

Hänvisningar till S7-3

8 Långsiktig reglering av ersättningsbeloppen 8.1 Behov av långsiktig reglering av ersättningsfrågan

Enligt utredningsuppdraget skall datainspektionen inkomma med förslag till längsiktig reglering av ersättningsfrägan. Den hittillsvz'trande ordningen har inneburit att regeringen vid återkommande tillfällen — vanligen under hösten varje år efter framställning från vissa större inkassoföretag och efter vederbörlig remissbehandling har beslutat om höjning av ersättningsbelop- pen. Besluten har grundats på ett tämligen osäkert grundmaterial och på allmänna bedt'åmningar av kostnadsutvecklingen efter den f("iregäende höjningen. Det måste enligt datainspektionens mening anses angeläget att få till stånd en mera permanent och av alla parter känd ordning för att såväl bedöma behovet av som besluta om justeringar av ersättningsbeloppen. Regeringens utredningsuppdrag till datainspektionen torde bl. a. ha moti- verats av detta skäl.

inte minst inkassoföretagen har ett mycket starkt intresse av att veta på vilken nivå kostnadsersättningarna kommer att ligga på för sin budgetering

Prop. l980/8l:10 ' 199

och debitering gentemot sina uppdragsgivare. lnkassouppdrag lämnas mycket ofta inom ärsvisa abonnemang där även de belopp uppdragsgivaren skall betala bestäms. Ett starkt önskemål från inkassoft'iretagens sida är därför att beloppsgränscrna för gäldenärs ersättningsskyldighet kan faststäl— las med viss framförhållning.

Den form av långsiktig reglering som ligger närmast till hands att pröva är att anknyta ersättningarna till någon form av index. 1 den undersökning som genomfördes av datainspektionen och domstolsväsendets organisatitms- nämnd år 1974 föreslogs att förändringarna skulle anknytas till det index som basbeloppet för allmän försäkring utgör. Möjligheterna att reglera ersätt- ningsbeloppen med hjälp av ett index eller på annat sätt diskuteras i det följande.

8.2. Utgångspunkter för att bestämma ersättningsbeloppen

I kostnadsundersökningen har vissa inkassoföretags kostnader för inkas- soförfarandet beräknats. Av praktiska skäl måste en långsiktig reglering utgå från kostnadsläget vid inkassoföretagen. eftersom det inte finns någon annan möjlighet att beräkna kostnaderna.

lnkassoföretagen får —i likhet med annan uppdragsverksamhet — i princip sina intäkter från uppdragsgivaren/fordringsägaren. Den inom branschen allmänt förekommande överenskommelsen att inkassoföretaget i första hand tillgodoräknar sig ersättning för uppdraget ur den av gäldenär erlagda kostnadsersättningen ändrar inte principen att inkassoföretaget uppbär sin ersättning från uppdragsgivaren.

Ofta innefattar avtal om inkassouppdrag — inom ramen för konkurrenslä- get inom branschen — att uppdragsgivaren skall lämna ytterligare ersättning för att täcka inkassofi'iretagens kostnader. I huvudsak lämnas den ytterligare ersättningen frän uppdragsgivaren antingen för att inkassoföretagets kost- nader är större än de författningsenliga ersättningsbeloppen eller för att någon ersättning från gäldenären inte inflyter till inkassoföretaget (som alltså normalt tillgodoräknar sig den ersättningen).

Av bilaga 2 framgår att vid de undersökta företagen svarade ersättningar från gäldenärerna för 51 % och ersättningarna från borgenärerna för 46 % av intäkterna. För inkassoföretagen kan det därmed synas likgiltigt om intäkterna kommer från uppdragsgivarna eller från gäldenärerna. Det innebär inte att frågan saknar betydelse.-Om ersättningsbeloppen sätts lägre än kostnaderna innebär det att en större del av kostnaden drabbar fordringsägaren. som i sin tur kan förväntas övervältra dessa kostnader på sina samtliga gäldenärer. således ävenpå dem som betalari rätt tid. Därmed höjs den allmänna prisnivån. Sätts å andra sidan ersättningsbeloppen högre än kostnaderna fä tillskotten från fordringsägaresidan mindre betydelse. men det är ovisst om anspråken på dessa tillskott kommer att sänkas, vilket således kan innebära att inkassoföretagen överkompenseras pä gäldenärer-

Prop. 1980/81:10 200

nas bekostnad. Utgångspunkten för en reglering måste därför vara att ersättningsbeloppen skall motsvara inkassoföretagens kostnader. låt vara att den måste grundas på genomsnittskostnader för olika ätgärdstyper.

8.3. Möjligheterna att följa förändringarna av kostnaderna för inkassoförfa- randet

Kostnaderna för inkassoförfarandet påverkas främst av förändringar av lönekostnader för personal (f.n. c 60 % av totalkostnaden), porto- och telefonkostnader (f. n. e 7 %), allmänna kontors- och lokalkostnader samt datorkostnader (f. n. sammanlagt e "33 %). Vidare inverkar rationaliseringar och andra effektivitetshöjande åtgärder. .lnkassoförfarandct rationaliseras f. n. genom en ganska intensiv datorisering av de större och medelstora inkassoföretagen. Sålunda har samtliga av de undersökta f(iiretagen (utom ett) antingen redan tagit datorsystem i drift eller gör det inom kort. De som tidigare avvänt datorstöd arbetar i många fall med vidareutveckling av systemen till direktåtkomst m. m. En fortsatt datorisering i första hand av den egentliga inkassobranschen pågår således. Utvecklingen av standardsys- tem och billiga datorer innebär att även små inkassoft'.iretag kan komma att finna det lönsamt att använda datorstöd i verksamheten. Fordringsägare med större volym på egen indrivningsvcrksamhet har redan nu i stor utsträckning datoriserat sina rutiner, dvs. lagt på en inkassorutin i reskontran. I vissa fall förekommer även en mellanform av egen indrivnings-verksamhet och anlitande av inkassoföretag genom 5. k. inkassobrev. Den rutinen lämpar sig bäst för fordringsägare med egen datorkapacitet.

Det sagda innebär att det i nuvarande utvecklingsskede är svårt att med godtagbar träffsäkerhet göra bedömningar av skilda kostnadsposters andel av framtida kostnader för inkassoförfarandet. Det kan också befaras att andra förändringar senare kommer att inträffa som gör det svårt att förutse skilda kostnadsposters utveckling. Att konstruera ctt index som gör det möjligt att på förhand beräkna kostnaderna för inkassoft'irfarandet är inte heller möjligt. Knyts justeringarna av ersättningsbeloppen-till ett index som inte direkt har att göra med kostnaderna för inkassoförfarandct. t. ex. basbeloppet för allmän försäkring. kan det antas att ansträngningarna att rationalisera inkassoarbetet motverkas. vilket knappast kan vara önsk- värt.

Med de förutsättningar som angetts i det föregående och med den ytterligare förutsättningen att ersättningsbeloppen så långt möjligt skall följa de faktiska kostnaderna för inkassoförfarandet återstår möjligheten att systematiskt och regelbundet genomföra kostnadsundersökningar enligt den modell som används i den nu genomförda undersökningen.

Prop. 1980/81 :10 201

8.4. Förslag till långsiktig reglering

En svårighet när inkassoföretagens kostnader skall undersökas är att företagen saknar en branschsamim'tnslutning. Den bästa överblicken av branschen och dess verksamhet torde finnas inom datainspektionen pågrund av inspektionens tillstånds- och tillsynsverksamhet med stöd av inkassolagen. Datainspektionen har sålunda i den delen unika förutsättningar att välja ut företag och genomföra kostnadsundersökningar. Datainspektionen saknar emellertid statistisk och ekonomisk expertis. Skall datainspektionen genom- föra sådana undersökningar fortlöpande fordras resursförstärkningar. främst iform av konsulter. En annan myndighet som är tänkbar är statens pris- och kartellnämnd (SPK). SPK är enligt sin instruktion (1973:609) central förvaltningsmyndighet för frågor rörande prisövcrvakning och har till uppgift att följa utvecklingen av och främja allmän kännedom om pris- och konkurrensförhållanden inom näringslivet med undantag av bankväsendet och annan företagsamhet. över vilken bankinspektionen har tillsyn. samt försäkringsväsendet. SPK förfogar över statistisk och ekonomisk expertis. SPK synes därför ha den sakkunskap som datainspektionen saknar. SPK har dessutom en god överblick över andra branscher vilket kan vara av värde för att bedöma kostnadsläget vid inkassoföretagen.

Vad gäller frågan om var beslut om ändring av ersättningsbeloppen skall fattas ser datainspektionen ingen anledning att gå ifrån den nuvarande ordningen där sålunda beslutet ankommer på regeringen.

Datainspektionen föreslår mot den angivna bakgrunden att det skall åvila datainspektionen att i samråd med SPK fortlöpande genomföra kostnads- undersökningar inom branschen, och att förelägga regeringen förslag till nya eller ändrade ersättningsbelopp.

Med tanke på kostnadsutvecklingen och strukturförändringar i branschen är årligen återkommande undersökningar önskvärda. Mot en sådan lösning talar att undersökningarna kräver relativt betydande resursinsatser både hos de myndigheter som genomför undersökningarna och hos de företag som skall medverka. i undersökningarna. I sammanhanget må erinras om förordningen (1978:11) om prövning av myndighets uppgiftsinsamling från företag. kommuner och organisaticmer och förordningen (19771629) om ändring i kungörelsen (1970:641) om begränsning i myndighets rätt att meddela föreskrifter. anvisningar eller råd. Datainspektionen föreslår att mera ingående undersökningar genomförs vartannat år och att en mera översiktlig bedömning av förändringar i kostnadsläget görs Linder de år då inte de större undersökningarna genomförs. Även dessa mera översiktliga bedömningar bör ankomma på datainspektionen i samråd med SPK.

Under avsnitt 8.1 nämndes att det ur inkassoft'jretagens synpunkt är väsentligt att beloppsgränserna för gäldenärs ersättningsskyldighet kan fastställas med viss framförhållning. För att tillgodose sådana önskemål bör beloppsgränserna för gäldenärs ersättningsskyldighet fastställas i oktober

Prop. 1980/81:10 202

månad före det årsskifte varifrån ändringen träder i kraft. Med ett sådant tidsschema bör kostnadsundcrsökningarna genomföras under våren så att förslag kan föreläggas regeringen i så god tid före oktober månad att en remissbehandling är möjlig att genomföra dessförinnan.

Datainspektionen anser det inte meningsfullt att nu föreslå hur den fiiireslagna ordningen formellt bör regleras. t. ex. genom ändringar av inkassolagen och instruktionen för datainspektionen. Ställning bör först tas till de övriga förslag som läggs fram och till de synpunkter som framkommer vid remissbehandlingen av rapporten.

Prop. 1980/81 :10 203

Län/erbilugu 3 Undersökning av vissa inkassoföretags kostnader ] Uppläggning och genomförande

Ett antal större inkassoföretag tillfrågades i början av februari 1977 om sitt intresse att delta i undersökningen. Åtta företag förklarade sig villiga att ställa ett mera omfattande material till datainspektionens förfogande. nämligen AB Kundktmtroll. Justitias lnkasso- & Juridiska Byrå AB. Kreditinkasso AB. .lt'inköpings Juridiska Byrå AB. Handels- & Juristinkasso AB. Inkasso-Centralen i Göteborg AB. MlAB Merkantil Inkasso AB samt Motorlu'anschens Riksförlulnds Inkasso AB.

Datainspektionen har i samarbete med domstolsverkct och en särskilt anlitad konsult — auktoriserade revisorn Roland Valtersson vid Bertil Olssons Revisionsbyrå AB — utarbetat ett frågeformulär. innefattande frågor dels om tidsåtgång för olika åtgärdstyper. dels om företagens ekonomiska förhållanden. Frågeformuläret finns som bilaga 3”. Frågeformuläret har tillställts de nämnda företagen, som skriftligen lämnat de begärda uppgif- terna undertiden mars-april 1977. Datainspektitmen har därefter inhämtat kompletterande upplysningar hos inkassoföretagen vid besök. huvudsakli- gen i maj 1977. Informationen har bearbetats och sammanställts. varvid kostnaderna per åtgärd av de olika åtgärdstyperna har räknats fram. lnkassoföretagen har i september och oktober 1977 beretts tillfälle att yttra sig över de uppgifter. som rör dem själva. De fick samtidigt uttala sig om kostmulsutvecklingcn efter den redovisningsperiod som undersökningen omfattar. Beräkningarna har. i de fall så varit erforderligt. justerats med ledning av uppgifterna från företagen.

Hänvisningar till S8-4

2 Bearbetning och resultat

Kostnadsberäkningarna har gjorts enligt den beri'ikningsmctod som beskrivs i bilaga 4". Beräkningarna redovisas i sammanfattande tablåer för samtliga åtta företag vilkas svar har bearbetats. Respektive företag har beretts möjlighet att yttra sig om sina egna värden. Tablåerna och beräkningarna finns som bilaga 5".

Bilaga 5.1 ger en översiktlig bild av de undersökta inkassoföretagens ekonomiska resultat under respektive redovisningsperiml. Undersöknings— objekten bedriver i några fall flera besläktade verksamhetsgrenar. 1 de fall detta sker inom självständiga juridiska personer har. dylik verksamhet lämnats utanför. Om vcrksatttheten däremot bedrivits inom samma jurdiska person har uppgifter infordrats om hela verksamheten.

Upptill i tablån visas de totala intäkterna och kostnaderna och resultatet

" Bilagorna uteslutna här.

Prop. 1980/81:10 204

för respektive företag som helhet. dvs. när samtliga verksamhetsgrcnar har beaktats. De intäkter och kostnader som redovisas under grupp A hänför sig enbart till den verksamhet som ingår i undersökningen. nämligen betalnings- påminnelse. krav. lagsökning. betalningsförcläggamle. återtagning. utmät- ning. amortcringsplan samt avisering om bokföring av amorteringar sedan amorteringsplan upprättats.

Av bilaga 5.1 framgår att sex av de åtta företagen visar ett positivt rörelseresultat i den verksamhet som (')mfattas av undersökningen. Vid bedömning av rörelseresultatet bör dock observeras att någon enhetlig praxis vad gäller värderings- och redovisningstekniska frågor rörande oavslutade arbeten inte finns. Ett företag redovisar värdet som tillgång i balansräkning- en varför redovisat resultat på ett rättvisande sätt påverkas av förändringar i värdet av dessa oavslutade arbeten. medan huvuddelen av företagen betraktar detta upparbetade värde som en dold reserv och redovisar icke förändringen öppet. I tablån redovisas företagens egen uppfattning om förändringen i denna dolda reserv. Då undersökningens syfte icke primärt har varit att utreda lönsamheten hos berörda företag har denna post icke närmare utretts. Beroende på bl.a. förekomsten av och kvaliteten på företagens interna tidsredovisningssystem kan betydande s 'ärigheter uppstå vid närmare utredning. Ft'jretagens egna uppgifter tyder på att dolda reserver varit oförändrade eller ökat under perioden.

Sammanl'attningsvis kan således konstateras att öppet redovisat resultat tillsammans med ft.")rändring i dold reserv för sju av de åtta företagen uppvisar en vinst före skatt. Beträffande det resterande företaget föreligger betydande svårigheter att fastställa ett rättvisande resultat. Betydande kostnader har under senare år plöjts ner i framtagande av ett datasystem. Periodiseringen. dvs. frågan om över hur många år dylika kostnader skall fördelas. har efter samråd med företaget schablonmässigt gjort över fem år och med lika stort belopp varje år. Frågor om vad som skall anses vara skäligt överskott på inkassoverksamhet har ansetts falla utanför utredningens ram. En utredning med dylik inriktning inrymmer ett flertal problem utöver vad som ovan redovisats om svårigheterna att fastställa ett rättvisande resultat. Som exempel på dylika problem kan nämnas utredning om arbetande eget kapital (i syfte att beräkna räntabiliteten). bedömning av inflationens effekter (i syfte att bedöma erforderlig konsolidering för bevarande av företagets kapacitet). erforderlig resursinsats för utveckling av nya tekniker (anpass- ning till datorer) m. m.

1 bilaga 5.1 studeras vidare relationen mellan olika slag av kostnader för respektive företag. Någon slutsats synes inte kunna dras av dessa relationer. Man kan t. ex. inte slå fast att mer datoriserade rutiner och större datorkostmidcr skulle ge ett förbättrat rörelseresultat genom att andra kostnader kan sänkas eller intäkterna höjas i tillräcklig omfattning. Den tidsperiod undcr'vilken datorerna använts är dock förhållandevis kort. varför utvecklingen är svårbet'lömd.

Prop. 1980/81:10 205

Bilaga 5.2 visar antal åtgärder. genomsnittlig tidsåtgång och andel av total tidsåtgång för de undersökta företagen under respektive redovisningspcritxl. Perioden sammanfaller med den period som den ekonomiska redtwisningen i bilaga 5.1 omfattar.

Sammanlagt har företagen. under sina respektive redovisningsperioder redovisat-189 881 inkassoätgärder(krav). 24 189 ansökningar om lagsökning och 105 145 ansökningar om betalningsföreläggande.

Hur stor del av det totala antalet utfärdade inkasssobrcv som de undersökta företagen svarar för kan inte anges annat än ungefärligt. Till tingsrätterna inkom under 1976 56661 ansökningar om lagsökning och 199493 ansökningar om betalningsföreläggande. Företagen som ingår i undersökningen svarade för 43 % av det totala antalet ansökningar om lagsökning och 53 % av antalet ansökningar om betalningsföreläggande.' Ingenting motsäger att de inte också svarar för en motsvarande andel av det totala antalet inkassokrav. vilka skulle innebära att det totala antalet inkassokrav under år 1976 uppgick till e 1 milj.

Det totala antalet ärenden om återtagning och utmätning utgjorde 5 990 respektive 64 457. Vid företagen upprättades 55 418 amorteringsplaner. Sammanlagt vidtogs 264 745 aviserings- och bokföringsåtgärder.

Av bilaga 5.2 fratngår att de inbördes variationermt mellan företagen beträffande tidsåtgång för olika åtgärdstyper är stora. Skillnaderna förklaras av att arbetsrutinerna skiftar mellan företagen. att somliga av dem använder maskinella hjälpmedel. dator m. ut. andra inte och att ärendena kan skifta i svårighetsgrad mellan företagen. Några av dem handlägger t. ex. mycket likartade och rutinbetonade kravärenden medan andra handlägger ärenden som kräver mera arbete. Vidare förekommer osäkerhet i de lämnade tidsuppgifterna. i många fall finns icke tidsredovisningssystem som kan ge svar på de största frågorna utan uppskattningar har måst göras. Överslags- beräkningen har gjorts i syfte att kontrollera att total tidsåtgång är rimlig i relation till uppgivet antal anställda och dess fördelning på olika befattning- ar.

Bilaga 5.3 visar varje företags kostnad per åtgärdstyp när totalkostnaden för grupp A slås ut på antalet åtgärder enligt den beräkningsmetod som beskrivs i bilaga 4. En kontroll av beräkningarna kan göras genom att den beräknade kostnaden för varje åtgärd multipliceras'med antalet ärenden där åtgärden vidtagits varefter de så erhållna produkterna summeras. Summan uppgår för varje företag till dess totala kostnad under grupp A. Den osäkerhet som finns i tidsangivelserna äterkommer även i detta material.

Av bilaga 5.3 framgår också den genomsnittliga kostnaden för -'arje åtgärdstyp för samtliga undersökta företag. Kostnaden har beräknats som ett

' Som jämförelse kan nämnas att i den undersökning som genomfördes år 1974 beräknades de undersökta företagen ha handlagt drygt 30 % av alla ansökningar om lagsökning och c 45 % av ansökningarna om betalningsföreläggande under år 1973.

Prop. BSO/81:10 206

vägt medeltal med hänsyn till antalet ärenden som varje t't'fn'ctag har handlagt. .

Bilaga 5.4 visar de undersökta ft'iretagens intäkter fördelade på ersättning— ar frän gäldenärer. borgenärer och ("övriga intäkter.

Ersättningarna från gäldenären består av de lagstat gade ersättningsbelop- pen som tagits ut från gäldenärerna för krav. lagsökning etc. under resp. företags redovisningsperiod.

Ersättningarna frän borgenärer består bl. a. av ersättningar för inkasso- abonnemang och ersättningar i de enskilda ärenden där gäldenärerna själva inte har betalat inkassoft'iretagets kostnader.

Övriga intäkter. exkl. tillägg utgörs bl. a. av intäkter från försäljning av inkassobrevsformulär -(s. k. lB-brev).

Av redovisningen i bilaga 5.4 framgär att vid fem av de åtta undersökta företagen s 'arade gäldenärerskollektivet för en större del av intäkterna än borgenärskollektivet. I vart och ett av de tre övriga företagen var intäkterna frän borgenärerna större än frän gäldenärerna.

Ehuru det inte framgår av bilaga 5.4 kan nämnas att om intäkterna för samtliga undersökta företag slås samman svarade ersättningarmi från gäldenärer för 51 % av de totala intäkterna och ersättningar fran borgenärer för 46 % av intäkterna.

Bilaga 5.5 visar förhållandet mellan de teoretiskt möjliga och verkliga ersättningarna från gäldenärerna. För de undersökta företagen ligger bortfallet mellan 41 och 68 % av de teoretiskt möjliga intäkterna från gäldenärerna.

En principiell orsak till det bortfall som redovisas är att det upparbetade värdet kan ha ökat. vilket innebär att intäkterna i en del av de ärenden som handlagts under redovisningsperioden kommer att erhållas först efter dess slut.

Ökningen av det upparbetade lärdet är emellertid en otillräcklig . förklaring eftersom skillnaden också föreligger för företag som inte har förändrat det upparbetade värdet under redovisningsperioden. Den mera generella orsaken till skillnaderna ligger snarare i det förhållandet att företagen bedriver sin verksamhet under den förutsättningen att borgenä— rerna skall träda in och betala företagens kostnader i de fall åtgärder som riktats mot gäldenärerna inte leder till betalning. lnkassoft'iretagen tillämpar olika principer för att debitera borgenärerna. Bl. a. förekommer abonne— mangsförfaranden och./""eller uppgörelser som innebär att borgenärerna själva får ersätta inkassoföretagen med det belopp som annars skulle ha tagits ut av gäldenärerna. Andra företag tillämpar någon form av prov'isionssystem pa det inkasserade beloppet förutom att de erhåller ersättningarna från gäldenärerna. För det fall den sistnämnda debiteringsformen används finns det också exempel på företag som — om en fordran inte kan inkasseras från

Prop. 1980/81:10 207

gäldenären också låter bli att ta ut någon ersättning från borgenären för sitt arbete med det "misslyckade" ärendet.

Bilaga 5.5 visar tillsammans med bilaga 5.4 sammanfattningsvis att intäkterna från borgenärerna är nästan lika betydelsefulla för företagens ekonomi som intäkterna från gäldenärerna. '

Prop. 1980/81:10 208

Bilaga 3

Sammanställning av remissyttrandena över departementspromemori- an (Ds Ju l979:8) Kreditupplysning och inkasso samt datainspektio- nens därvid fogade utredning 1978-06-20 med förslag till långsiktig reglering av frågan om ersättning för inkassokostnader m. m.

Remissinstanserna

Efter remiss har yttranden avgetts av justitiekanslern (JK), hovrätten över Skåne och Blekinge, Stockholms tingsrätt. domstolsverkct, datainspektio- nen, bankinspektionen. riksrevisionsverket (RRV), riksskatteverket (RSV), kommerskollegium, statens pris- och kartellnämnd (SPK), datalagstiftnings- kommittén (DALK). rättegångsutredningen, Svenska kommunförbundet, Sveriges advokatsamfund, Landsorganisationen i Sverige (LO), Tjänste- männens eentralorganisation (TCO). Svenska arbetsgivareföreningen. Svenska bankföreningen. Svenska sparbanksföreningen, Sveriges förenings- bankers förbund. PKbanken. Sveriges grossistförbund. Sveriges industriför- bund. Sveriges köpmannaförbund. Sveriges hantverks- och industriorgani- sation/Familjeföretagens förening (SHIO/Familjeföretagen), Kooperativa förbundet (KF). Lantbrukarnas riksförbund (LRF), Finansieringsföretagens förening. Motorbranschens riksförbund (MRF-), Sveriges ackordscentral. Svenska kreditmannaföreningen i Stockholm. Svenska kreditmannaföre- ningen i Göteborg. Svenska kreditmannaföreningen i Malmö, Svenska inkassoföreningen. ABAK-Justitia AB och Upplysningscentralen UC AB.

Sveriges föreningsbankers förbund, PKbanken och i viss utsträckning Finansieringsföretagens förening har anslutit sig till det av Svenska bankföreningen avgivna yttrandet.

Svenska arbetsgivarcföreningen och Sveriges industriförbund har avgett ett gemensamt yttrande. Gemensamma yttranden har vidare avgetts av dels Sveriges köpmannaförbund och SHIO/Familjcföretagcn, dels kreditmanna- föreningarna i Stockholm, Göteborg och Malmö.

RSV har bifogat yttrande av Föreningen Sveriges kronofogdar. Kommers— kollegium har bifogat yttranden av Skånes handelskammare och Stockholms handelskammare.

Yttrande har dessutom inkommit från brottsförebyggande rådets styr- grupp för översynen av lagstiftning mot organiserad och ekonomisk brottslig- het.

I det följande återges yttrandena i huvudsakligen oavkortat skick under olika avsnitt.

Prop. 1980/81 : IO . 209

1 Allmänt om förslagen i departementspromemorian

1.1 Hovrätten över Skåne och Blekinge:

Kreditupplysningslagen och inkassolagen är av förhållandevis sent datum. I samband med de båda lagarnas tillkomst hade hovrätten tillfälle avge remissyttranden. De mera principiella synpunkter som då kunde anläggas på dessa lagstiftningsområden finns det inte anledning att nu återkomma till. Hovrätten, som inte har någon egen erfarenhet av tillämpning av dessa lagar att stödja sig på. har vid sin granskning av promemörieförslaget funnit anledning till erinringar och påpekanden bara i några detaljer. I övrigt bör förslaget enligt hovrättens mening kunna läggas till grund för lagstiftning. Innan hovrätten går in på detaljerna vill hovrätten emellertid påpeka den brist på koncentration och stringens som utmärker promemorian. Det borde ha varit möjligt att presentera förslaget på mindre Sidantal än de mer än 300 som här används. särskilt som det gäller endast en översyn av två lagar om cirka tjugo paragrafer vardera. Ingen detalj har befunnits för obetydlig för att föranleda den mest seriösa behandlingi förslaget. Hovrätten anser sig inte ha anledning att fingranska varje sådan detalj.

Vidare må det tillåtas ett mera principiellt påpekande. Det remitterade förslaget omnämns i propositionen 1978/79:11] avseende åtgärder mot krångel och onödig byråkrati som ett exempel på den bekämpning av onödig byråkrati som bedrivs inom justitiedepartementct. Förslaget kringgärdar emellertid medborgarna med ytterligare en rad detaljbestämmelser som gör den redan förut krångliga lagstiftningen än mera svårtillämpad. Hovrätten vill därför ifrågasätta om inte förslaget bör ses över i syfte att skala bort sådana detaljbestämmelser som inte är alldeles nödvändiga. Hovrätten vill här bara hänvisa till de kloka ord som statsministern anfört i inledningen till nyssnämnda proposition.

1.2 Stockholms tingsrätt:

Vid Stockholms tingsrätt handläggs inom en särskild enhet på tingsrättens andra avdelning ett mycket stort antal mål om lagsökning eller betalnings- föreläggande. Många av dessa mål hänskjuts till handläggning enligt lagen om rättegången i tvistemål om mindre värden på en annan enhet inom andra avdelningen. Tjänstemännen på andra avdelningen får inte bara en avsevärd kännedom om frågor. som sammanhänger med handläggningen av mål om lagsökning eller betalningsföreläggande, utan också en praktisk erfarenhet om förhållanden. som rör kreditupplysning och inkassoverksamhet. Tings- rätten finner anledning att i detta remissyttrande redogöra något för vissa praktiska erfarenheter och yttrandet blir därför nägot utförligare än som direkt föranleds av själva remissen.

Tingsrätten vill till en början uttala sin tillfredsställelse över att kredit- upplysningslagens och inkassolagens bestämmelser har setts över och att förslag till ändringar har lagts fram. Vad som föreslås är ägnat att förbättra förhållandena på områdena för kreditupplysning och inkasso. Tingsrättens erfarenheter är också sådana, att det finns all anledning att ta till vara möjligheterna att förbättra dessa förhållanden. Sådana förbättringar blir inte bara till nytta för allmänheten utan också för arbetet vid tingsrätten med lagsökningar och betalningsförelägganden. Detta arbete är en mycket viktig del av tingsrättens verksamhet och sysselsätter många tjänstemän. Antalet

14 Riksdagen 1980/81. ] saml. Nr 10

Prop. 1980/81zlll 210

mål av förevarande kategorier har stigit starkt under senare år. Trots insatta personalförstå'trkningar uppstår då och då arbetsbalanser. Olika vägar bör prövas i syfte att förenkla arbetet. En sådan väg är att — på sätt meningen är med förslagen i den remitterade promemorian — helt allmänt sett förbättra förhållandena på kreditupplysnings- och inkassoföretagens områden.

1.3 Datainspektionen:

Såväl inkassoverksamhet som kreditupplysningsverksamhet är betydelse- fulla inslag i dct ekontmiiska livet i det svenska samhället både på den offentliga och den privata sektorn.

Kreditupplysning i någon form torde föregå praktiskt taget all kreditgiv- ning till företag och privatpersoner vilket torde innebära att flera miljoner kreditupplysningar inhämtas årligen. Antalet inkassoärenden som årligen hanteras torde överstiga en miljon.

Datainspektionens rcsursmässigt största uppgift är att tillse efterlevnaden av datalagen (_ l.973'289) som f. n. innefattar cirka 23 000 tillstånd till personregister och sysselsätter huvuddelen av inspektionens handläggande personal.

Verksamheten som tillstånds- och tillsynsmynt'lighet enligt kreditupplys- ningslagen och inkassolagen kan vid sidan härav synas vara bagatellartad om man bara ser till antalet verksamma ft'iretag i respektive bransch. Det finns nämligen bara något lil-tal kreditupplysningsföretag varav blott fyra är rikstäckande. Antalet tillstånd enligt inkasst'vlagen rör sig om några hundra. litt sädant betraktelsesätt speglar emellertid inte verkligheten på ett riktigt sätt. Trots att datainspektionen av resursskäl blott kunnat göra ytterst begränsade informationsinsatser om sin verksamhet som klagomur enligt kreditupplysningslagcn och inkassolagen har allmänheten visat ett mycket stort intresse för dessa verksamheter. Detta framgår bl. a. av att antalet klagomål och förfrågningar berörande frågor som omfattas av nämnda lagar per år är större för envar av dem jämff'irt med motsvarande reaktioner från allmänheten beträffande frågor som berör datalagen. Denna tendens har iakttagits i flera år och kan således inte vara någon tillfällighet. Det är i och för sig naturligt att sådana konkreta saker som oriktiga eller missvisande kreditupplysningar och otillbörliga inkassoätgi'trder föranleder allmänheten att agera i högre grad än de ibland mera abstrakta integritetshoten som föreligger vid ADB i allmänhet.

Kreditupplysningsvcrksamhetens expansion de senaste åren har inte minst påverkats av ökningen av konsumentkrcditer. Av särskilt intresse är marknadsft'jringen av köl][Okt)l'tSerdlter där en årlig expansion med cirka 30 '.3-2- noterats. Samtidigt har antalet inkassoärendcn stadigt ökat. uppen- barligen inte enbart beroende av det ökande antal kontokort. Här torde bl. a. tillskapande av effektiva rutiner för kommunal inkasso. för indrivning av hyresft'n'dringar. för trafikft'irsäkringspremier. för tomtmarksparkerings— avgifter m. m. ha inverkat.

På kreditupplysningssidan föranleder denna utveckling anspråk på inrät— tande av s.k. engagemangsrcgister för kontokrcditer dvs. register över beviljade krediter samt på löpande kreditbevakning även av personupplys- ningssubjekt (privatpersoner). Hittills har krav inte ställts på ett engage- mangsregister som även omfattar i vilken mån krediterna utnyttjats. även om den frågan också diskuterats.

Dessa utvecklingstendenser torde innebära icke oväsentliga anspråk på

Prop. 1980/81 : 10 211

insatser från datainspektionen i skilda hänseenden.

[' detta sammanhang må påpekas att datainspektitmens formella organi- sation. som utformades med utgångspunkt från arbetsuppgifterna enligt datalagen. frånsett en mindre förstärkning inte ändrats efter det inspektio- nen tillagts uppgifter enligt förevarande lagar. Det visade sig etnellertid tidigt finnas behov av nära samarbete mellan tillsyns- och tillståndsverksamhet beträffande dessa lagar. Samtidigt visade det sig att all handläggning av ärenden enligt lagarna fordrade juridiskt skolad handläggningspersonal. Dessa frågor har därför handlagts inom en arbetsgrupp bestående av jurister från till en början såväl tillsyns- som tillståndsenheten. Gruppen har letts av ställft'jreträdaren för chefen till tillsynsenheten. Även fortsättningsvis torde kreditupplysnings- och inkassotillsynen fordra en icke helt obetydlig del av inspektionens resurser för att upprätthålla lagstiftarens syften. Datainspek- tionens interna utbildning — t. ex. av icke-jurister beträffande förevarande lagar och rättsregler i anknytning till den har av resursskäl hittills måst försummas.

Arbetsuppgifterna enligt kreditupplysningslagen och inkassolagen har i viss utsträckning inneburit att den juridiska sakkunskap. som enligt den ursprungliga organisationen avsågs tillföras tillsynsverksamheten enligt datalagen. inte kunnat disponeras för dessa uppgifter. vilket stundom varit till nackdel. '

Dcpartementsprometnorian grundas på datainspektionens promemorior från hösten 1977 om erfarenheter och iakttagelseri samband med tillämpning av förevarande lagar samt på en utredning inspektionen genomfört på departementets uppdrag om reglering av ersättning för inkassokostnader.

Departementspromemorian innefattar i huvudsak lösningar av problem datainspektionen angivit och godtagande av de förslag till ändringar i lagstiftningen som inspektionen framlagt.

Det är med denna utgångspunkt naturligt att tnånga lösningar i prome— morian är helt i linje med inspektionens erfarenheter. Likväl finns på flera betydelsefulla punkter skäl till invändningar mot förslagen i pr'omem'orian. Exempelvis är datainspektionen således tveksam till den föreslagna defini— tionen av personupplysningar och avstyrker den föreslagna definitionen av inkassoverksamhet och har vissa principiella invändningar mot promemori- ans förslag till gemensam reglering av ersättning för betalningspåminnelser och för inkassoätgärd. .

Åtskilliga beaktansvärda synpunkter i dessa eller andra avseenden torde komma att framföras i remissyttranden från andra instanser. Då dessa yttranden kan föranleda betydelsefulla ändringar förutsätter inspektionen att den bereds tillfälle att löpande tnedverka i det fortsatta arbetet med översynen av lagarna.

1.4 Riksskatteverket:

För kreditmarknaden och näringslivet är det av betydelse att kreditupp- lysningslagen (1.973:1173) och inkassolagen (19741182) får en lämplig utformning. Med ett väl fungerande kreditupplysnings— och inkassoförfaran- de har kreditgivare möjlighet både att bättre bedöma Iåntagares kreditvär- dighet och att i större utsträckning få betalt för sina fordringar i rätt tid eller efter påminnelse och krav. Lagarnas praktiska tillämpning har indirekt också betydelse för kronofogdemyndigheternas vidkommande. Allmänt gäller att vid utformning och tillämpning av lagarna är det av största vikt att skyddet för den enskildes integritet beaktas.

Prop. 1980/81:10 212

1.5 Föreningen Sveriges kronofogdar:

Föreningen kan i huvudsak tillstyrka de föreslagna ändringarna i kreditupplysningslagen och inkassolagen, eftersom de nya reglerna kommer att innebära ett utvidgat skydd för den enskilde.

1.6 Datalagstiftningskommitten:

DALK. som mot bakgrund av sitt utredningsuppdrag — saknar anledning uttala sig i frågan om inkassokostnader. har ingen erinran mot de föreslagna ändringarna i kreditupplysningslagen (1973:1173) och inkassolagen (1974:182).

Det förtjänar dock framhållas att såsom också påpekats i den remitterade promemorian (s. 193 f) chefen för justitiedepartementet i propositionen 1978/79:109 om ändring i datalagen förutskickat att han avser att genom tilläggsdirektiv till DALK ge kommittén i uppdrag att överväga frågan om en generell personregisterlagstiftning. DALKs arbete med en sådan vidgad personregisterlagstiftning kan komma att beröra även kreditupplysningsla- gen och inkassolagen.

1.7 Svenska kommunförbundet (styrelsen):

Med utgångspunkt från de intressen styrelsen har att företräda har styrelsen inte någon anledning till erinran mot innehållet i departementspro- memorian.

1.8 Tjänstemännens centralorganisation (TCO):

TCO (vill) uttrycka sin tillfredsställelse över den sanering av kreditupp- lysnings- och inkassoverksamheten som skett genom kreditupplysningsla- gens och inkassolagens tillkomst samt genom datainspektionens övervakan- de verksamhet.

1.9 Landsorganisationen i Sverige (LO):

De förslag som presenteras i promemorian syftar bl. a. till att stärka skyddet för den personliga integriteten i kreditupplysningssammanhang och till att skydda gäldenären mot en alltför omfattande skyldighet att ersätta inkassokostnader. Utifrån sina utgångspunkter har LO inget att erinra mot de framlagda förslagen.

1.10 Svenska arbetsgivareföreningen och Sveriges industriförbund:

Organisationerna finner sig kunna i allt väsentligt biträda förslagen sådana de framlagts i promemorian.

1.11 Sveriges ackordscentral:

I promemorian lämnas en ingående och förtjänstfull redogörelse för de regler som nu gäller på förevarande område. Av redogörelsen framgår klart hur invecklade hithörande förhållanden är och hur vanskligt detär att på ett

Prop. 1980/81:10 213

riktigt sätt mot varandra väga de motstridande intressen som i åtskilliga fall anmäler sig i sammanhanget. _

Enligt ackordscentralens mening innefattar de i promemorian framlagda förslagen till ändringar och tillägg i nuvarande lagstiftning en i stort sett rimlig avvägning mellan nämnda intressen och ackordscentralen kan därför tillstyrka att övervägande antalet förslag genomförs. Endast i ett par hänseenden har ackordscentralen en i viss mån avvikande mening.

Slutligen förutsätter ackordscentralen att den föreslagna lagtexten ses över. eftersom den i vissa hänseenden är oklar'och därför tvekan om dess rätta innebörd kan uppstå.

1.12 Svenska kreditmannaföreningen i Stockholm, Göteborg och Malmö:

De föreslagna ändringarna är som helhet av ganska stor omfattning och leder till mycket betydande konsekvenser.

Datainspektionens synpunkter är i många fall av väsentligt värde och bör i flera avseenden ligga till grund för de förändringar som skall ske.

Vi finner emellertid att enligt vår mening avvägningen mellan olika intressen. kanske främst kredittagarens/gäldenärens. inte skett på ett sätt som skulle leda till bättre förhållanden än de nuvarande utan i flera fall till försämringar genom att konsekvenserna inte synes utredda eller kunnat överblickas.

1 ett remissförfarande är det ofta omöjligt för en enskild remissinstans att göra en så omfattande genomgång av materialet som i och för sig skulle vara önskvärd. Vår bedömning är, att föreliggande promemoria inte är av sådan tyngd. att den är lämplig att lägga som grund för en så omfattande lagändring som förslaget i många stycken innebär. Förslaget bör därför enligt vår . mening ytterligare genomarbetas.

2 Kreditupplysningslagen 2.1 Allmänna synpunkter 2.1.1 Justitiekanslern (JK):

Förslagen synes mig i de allra flesta hänseenden väl avvägda. Mina anmärkningar gäller enbart detaljer.

2.1.2 Stockholms tingsrätt:

Tingsrätten — - — tillstyrker de föreslagna ändringarna i kreditupplysnings- lagen — —.

2.1.3 Bankinspektionen:

Den översyn av kreditupplysningslagen som har skett har beaktat erfarenheterna av lagens tillämpning och något ökat integritetsskyddet för den enskilde. Bankinspektionen anser att vad som föreslagits i stort kan läggas till grund för lagstiftning.

Prop. 1980/81:10 214

2.1.4 Riksrevisionsverket (RRV):

Vad först gäller utformningen av kreditupplysningslagen måste. såsom utredningen påpekar, en avvägning ske mellan behovet av skydd för den personliga integriteten och behovet av en effektivt fungerande kreditupplys- ningsverksamhet. Det är sålunda uppenbart att en mindre väl fungerande kreditupplysningsverk'samhet kan befaras få negativa konsekvenser för kreditmarknaden och därigenom för näringslivets effektivitet i stort-. RRV . vill emellertid i detta sammanhang också peka på den ökning av arbetsbe— lastningen vid domstolarna och de exekutiva myndigheterna som en bristfällig kreditupplysningsverksamhet kan förorsaka.

2.1.5 Svenska bankföreningen med instämmande av PKbanken. Sveriges föreningsbankers förbund, Finansieringsföretagens förening och Upplys- ningscentralen UC AB:

Sammanfattning

Bankföreningen avstyrker den ändrade definitionen av personupplysning i 2 5. De skäl. som i promemorian anförts för ändringen. finner bankföre- ningen inte bärande. Ändringen skulle påverka innebörden av 5.5 7. 8 och 11 i kreditupplysningslagen så att kreditupplysningsverksamhetens effektivitet såvitt gäller näringsidkare skulle försämras. Särskilt med nuvarande princi- per för kreditbedömning vore det olyckligt om kreditupplysningarnas kvalitet minskades. En försämring av kreditupplysningarnas kvalitet skulle också kunna försvåra svenska näringsidkares möjlighet att få kredit av motparter i utlandet. '

2.1.6 Motorbranschens riksförbund (MRF):

I promemorian föreslås bl. a. att 5. k. företagsupplysning endast skall omfatta juridiska personer. medan en upplysning om en näringsidkare fortsättningsvis skall hänföras till personupplysning. Vidare föreslås att den nu för personupplysning gällande femårstiden för fastställda betalningsför- summclser ersätts med en treårsgräns. Det föreslås även att kopia av personupplysning skall innehålla uppgift om vem som beställt upplysning— en.

Beträffande enskilda näringsidkare." Förutsättningen för att på basis av en kreditupplysning bedöma förlustrisken vid en tilltänkt kreditaffär minskar genom de föreslagna ändringarna. Detta kan leda till minskad benägenhet att lämna kredit till enskilda näringsidkare. Det för denne ökade integritets- skyddet måste alltså vägas mot hans ekonomiska intresse av att erhålla kredit. Utfallet av denna avvägning beror självfallet på hur den enskilde näringsidkaren tidigare skött sina kreditaffärer.

Enligt datainspektionens uppgift finns endast ett kreditupplysningsföretag som lämnar uppgift om ansökningar om lagsökning och betalningsföreläg- gande. Med hänsyn härtill och då registrering och publicering av dylika ansökningar onekligen är behäftad med svagheter (exempelvis fel person- nummer har använts. fel gäldenär har lagsökts. skulden redan betalad). torde ett förbud härvidlag beträffande enskilda näringsidkare icke få några större. negativa följdverkningar. Till stöd för denna uppfattning kan jämväl

Prop. 1980/81110 215

åberopas det förhållandet. att datainspektionen även framdeles kommer att medge undantag från huvudregeln i speciella fall.

Såvitt avser upplysningar om av domstol eller annan myndighet fastslagna betalningsförsummelser finns dock anledning till stor tveksamhet beträffan- de ändringsförslaget. Även om det innebär svårigheter att i kreditupplys- ningssammanhang definiera en näringsidkare. bör detta icke vara skäl nog för att jämställa honom med en privatperson. 1 stället borde man försöka finna en metod. efter vilken man kan bedöma om en person är näringsidkare eller ej. Näringsidkarens intresse av integritetsskydd torde mer än väl uppvägas av kreditgivarnas (inklusive samhällets") intresse av så fullödig information som möjligt av näringsidkarens tidigare. fastslagna betalnings- försummelser.

Under åberopande av (wanstående synpunkter finner MRF det angeläget att bibehålla den nuvarande rätten att utan tidsbegränsning registrera och lämna upplysning om av domstol eller annan myndighet fastställda betal- ningsförsummelser. 1 konsekvens härmed bör förslaget om att näringsidka- ren skall ha kopia av kreditupplysningen med uppgift om vem som beställt upplysningen inte genomföras. — Beträffande ansökningar om lagsökning och betalningsförelägganden biträder förbundet ändringsförslaget.

Beträffande andra enskilda personer än näringsidkare: Såvitt avser våra medlemsföretag torde en noggrann kreditbedifnnning endast förekomma vid försäljning av fordon på avbetalning. Eftersom fordonet då utgör säkerhet för kreditbeloppet. bör måhända de reducerade uppgifterna i en kreditupp- lysning icke negativt behöva påverka avbetalningsaffz'irertm. Å andra sidan äger avbetalningssäljaren efter en återtagning i princip icke rätt att av konsument utkräva eventuellt resterande fordran enligt den nya konsument- kreditlagen.

Vid annan kreditgivning. exempelvis för reparationskostnader. torde endast en summarisk kreditbedömning äga rum. Därest detta sker genom exempelvis telefonkontakt med ett kreditupplysningsföretag. kommer deras upplysning att vara baserad på ett reducerat material men torde detsamma vara tillfyllest för ändamålet.

Med hänsyn till vad som sagts under denna punkt vill förbundet icke motsätta sig ändringsförslaget i denna del.

2.1.7 Svenska kreditmannaföreningarna i Stockholm, Göteborg och Mal- mö:

Näringslivets kreditgivning omfattar mycket stora belopp och är livsviktig för samhällets fortbestånd och utveckling. För att denna kreditgivning skall fortfara att vara sund och till samhälleligt gagn erfordras sakliga och korrekta uppgifter om samtliga potentiella kredittagare. Skulle osäkerheten i bedöm- ningsunderlaget avsevärt öka. innebär detta betydande störningar i det nu förhållandevis väl fungerande systemet. Kreditgivares och kredittagares behov och önskemål om kreditupplysningens innehåll torde till avgörande del sammanfalla. och det är här frågan. om inte kredittagarens behov att kunna styrka sin kreditvärdighet är så stark. att ytterligare inskränkningar i dessa möjligheter blir till kredittagarens nackdel. Det förslag. som nu är framlagt. innebär inte några avgörande förändringar. när det gäller företagsuppfvsningar även om vissa försämringar sker. vilka i sin tur torde kotnma att leda till högre kreditförluster för näringslivet och för det allmänna.

Prop. 1980/81:10 216

När det gäller privatpersoner så måste vi inledningsvis konstatera att det i svensk lagstiftning inte finns någon enhetlig definition på vad en privatperson är. Man har valt att i varje enskild lag bygga upp en identifieringsprofil och sedan kalla denne för exempelvis konsument. person. fysisk person. enskild fysisk person etc. Detta förhållande är synnerligen otillfredsställande och det borde vara möjligt att samordna identifieringen.

Med kreditupplysningslagen har lagstiftaren bl. a. avsett att åstadkomma en avvägning mellan de starka kraven på personlig integritet och kreditgi- varens berättigade krav på att erhålla uppgifter om den till vilken krediten skall lämnas. Enligt vår mening har den nu gällande lagen i stort lyckats väl tillgodose bägge dessa krav.

De nu föreslagna ändringarna. med några undantag. synes rubba balansen på ett icke oväsentligt sätt. Bedömningsunderlaget synes komma att bli så uttunnat. att kreditgivarens krav på hög inkomst och helst fast egendom hos kredittagaren kommer att försvåra eller omöjliggöra för "vanliga” medbor- gare att få för dem önskvärda och behövliga krediter. Alternativt kommer det att ytterligare fördyra de kreditformer som kommer att stå öppna för de sämst ställda bland dem som nu bedöms som kreditvärdiga. Hur utveckling- en än kommer att bli. torde den vara till betydande nackdel för samtliga parter och ytterligare markera ojämlikheten mellan de ekonomiskt starka och de ekonomiskt svaga i det svenska samhället.

2.2 Tillämpningsområdet (1 & promemorieförslaget) 2.2.1 Hovrätten över Skåne och Blekinge:

Uttrycket "yrkesmässigt bedriven kreditupplysningsverksamhet" synes mindre väl funnet mot bakgrund av den innebörd detta uttryck har givits i förarbetena. Hovrätten har därför ingen erinran mot att detta utmönstras ur lagtexten. Den lydelse som i promemorian givits åt 1 så 1 st. bör emellertid ändras något. När det gäller att bedöma lagens tillämpningsområde är det ointressant att veta om verksamheten sker mot ersättning eller utan ersättning eller om den bedrivs självständigt eller som ett led i annan näringsverksamhet. Den presumtive idkaren av kreditupplysningsverksam- het kan därför. vid enbart ett studium av lagtexten. knappast sägas bli vägledd av uttrycket "mot ersättning eller som ett led i näringsverksamhet". Enligt hovrättens mening framstår det därför som onödigt att belasta lagtexten med detta uttryck.

Förutom av undantagsreglerna som framlagts i paragrafens andra stycke inskränks lagens tillämpningsområde även genom den utformning som givits åt första stycket. Undantagsregleringen i första stycket har fått den innebörden att lagens tillämpningsområde inskränks i större utsträckning när det gäller sådan kreditupplysningsverksamhet som åsyftas i detta styckes andra mening än beträffande sådan som avses i första meningen i stycket. Denna skillnad har inte motiverats och enligt hovrättens mening finns knappast bärande skäl därför. Hovrätten anser att lagen . med i andra stycket angivna undantag. bör gälla all kreditupplysningsverksamhet som bedrivs i mer än ringa omfattning. En sådan reglering torde också göra lagen klarare och lättare att tillämpa.

Mot bakgrund av det nu sagda och med beaktande av att 25 i lagen innehåller en legaldefinition av begreppet kreditupplysning vill hovrätten förorda att förevarande paragraf får följande lydelse:

Prop. HSO/81:10 217

Denna lag gäller kreditupplysningsverksamhet.

Lagen omfattar ej kreditupplysningsverksamhet som är av endast obetyd- lig omfattning. Lagen omfattar ej heller

]. verksamhet som etc.

Mot den föreslagna utformningen av 1 & skulle kunna riktas flera språkliga anmärkningar. Med hänsyn till den ståndpunkt hovrätten ovan intagit (se 1.1) avstår emellertid hovrätten härifrån.

Eftersom begreppet "yrkesmässigt" utmönstras ur kreditupplysningslagen böri det fortsatta lagstiftningsarbetet övervägas om inte detta begrepp också bör utmönstras ur 1 kap. 9 5 2 tryckfrihetsförordningen.

2.2.2 Datainspektionen:

Texten preciserar vad som ursprungligen avsetts gälla men som inte framgått av den gällande lagtexten utan angivits i motiven. Trots att föreslagna texten är något tung och kan förefalla krångligare än den gamla synes den på ett uttömmande sätt redovisa det avsedda tillämpningsområdet. Detta måste anses vara ett väsentligt rättssäkerhetsanspråk och därjämte underlätta datainspektionens tillsynsverksamhet.

Om möjligt bör således en förenkling av lagtexten ske. dock utan att förlora i klarhet. l såväl den gällande l &" som i förslaget används uttrycket "förmedling av upplysningar" vid angivande av vissa undantag. Begreppet torde språkligt sett inte täcka hela den verksamhet som avses. Ett exempel kan illustrera detta. Banken A skall pröva en kredit till personen Z som uppger sig ha varit kund i banken B. A gör en förfrågan om Z hos B. B lämnar sin information om Z till A innefattande vad B tillika inhämtat från banken C där Z varit kund. Överförande av B:s egen information till A kan knappast anses vara "förmedling av upplysningar" vilket däremot B:s vidarebefordran av informationen från C torde vara. Uppenbarligen avses dock att all B:s uppgiftslämnande till A skall omfattas av undantaget.

De praktiska problemen i samband med propositionen (1978/791170.) med förslag till lag om finansbolag berör med den i nämnda proposition valda lösningen inte kreditupplysningslagens tillämpning utan enbart inkassola- gen. Datainspektionen tar upp frågan under avsnittet om nämnda lag.

Skulle däremot statsmakterna — med frångående av det ställningstagande som gjorts i propositionen utforma lagstiftningen så att finansbolagen undantas från tillämpningen av kreditupplysningslagen kan det ifrågasättas om detär meningsfullt att upprätthålla kreditupplysningslagens regelsystem på den återstående delen av kreditupplysningsverksamheten. Det bör här erinras om att finansbolagen numera är de dominerande kreditgivarna vad gäller konsumentkredit genom finansbolagens verksamhet som kontokorts— företag.

En intressant konsekvens av undantagsbestämmelsen beträffande "för- medling av kreditupplysningar mellan företag inom samma koncern" kan uppståi den mån koncernförhällande kan anses föreligga mellan en bank och ett finansbolag.

Skrivningen i näst sista stycket på sid. 53 (i dcpartementspromemorian). som torde vara hämtad från propositionen 1973:155 fordrar viss komplette- ring. Enligt datainspektionens uppfattning är det inte kreditupplysningsverk- samhet när t. ex. ett kreditkortsföretag meddelar anslutna säljföretag att ett visst kreditkort är spärrat. eller att för ett visst kreditkortskonto kreditgrän-

Prop. 1980/81:10 218

sen är nådd och ytterligare kredit ej får lämnas på kortet. Ett besked från ett diskonteringsföretag om att man är beredd att finansiera ett kreditköp fören viss köpare är inte heller kreditupplysningsverksamhet. Om däremot kreditkorts- eller diskonteringsföretaget själv inhämtar upplysningar från ett kreditupplysningsföretag om de kredittagare vars krediter det finansierar och därefter mer eller mindre fullständigt vidz'lrcbefordrar upplysningarna till respektive säljföretag är det givetvis fråga om kreditupplysningsverksam- het.

2.2.3 Bankinspektionen:

Enligt ändring av 2 5 skall ej längre i kreditupplysningshänseende någon skillnad göras mellan enskild person i allmänhet och enskild person som är näringsidkare eller motsvarande. Det betyder att de särskilda regler som till skydd för enskilds integritet gäller för personupplysningar kommer att gälla också för upplysningar som erfordras om enskilda till följd av engagemang i näringsverksamhet. t. ex. när fråga är om kredit till rörelsen eller om personlig borgen för kredit till eget bolag. Nuvarande undantag betr. näringsidkare har utförligt motiveratsi prop. 1973: 155. s. 79—80. lnspektio- nen anser att skälen för en mera ingående information i fråga om företagare fortfarande har relevans. De övriga förslag som nu läggs fram ärinte ägnade att minska behovet av undantag för upplysningar om företagare. snarare tvärtom. Visserligen kan informationsutbyte fortfarande ske mellan kredit- inrättningar (bankintern information) oberoende av kreditupplysningslagen. Indirekt har emellertid den nu gällande bestämmelsen viss betydelse för kreditinrättningarna. bl. a. vid rebelåning av fordringar. Väsentligt i sammanhanget är också att finansbolagen om förslag därom i prop. 1978/79: 170 antages inte skulle komma att betraktas såsom kreditinrättning- ar i kreditupplysningslagens mening. Dessa bolags verksamhet är i betydan- de omfattning — särskilt genom factoring och leasing —— riktad till företag beträffande vilka upplysningar om ägaren/företagaren är av avgörande betydelse. Beträffande det nämnda förslaget i prop. 1978/79:170 vill inspektionen särskilt anföra följande.

I propositionen sägs att i avvaktan på resultatet av påbörjad översyn av kreditupplysningslagen bör kredituplysning som lämnas till finansbolag från annan kreditinrättning (även Upplysningsccntralen UC AB) under bankin- spektionens tillsyn inte vara undantagen från kreditupplysningslagen. Frågan om hur finansbolagen skall betraktas i sammanhanget skall alltså relateras till det remitterade förslaget om ändringar i kreditupplysningsla- gen. Det kan då konstateras att det nu föreslagna. vidgade integritetsskyddet för den enskilde minskar mt'öjligheterna över huvud taget för kreditgivarna att få upplysning om kreditsökandes kreditvärdighet. Därmed ökar natur— ligtvis intresset för finanslmlagen att tillhöra gruppen av kreditinrättningar inom vilken kreditupplysningar kan utväxlas nägot friare.

Synen på finansbolagen i nämnda avseende har betydelse också från banksekretessynpunkt. Mellan kreditinstitutcn sker av hävd ett utbyte av information som innebär att banksekretessen bryts igenom. Departements- chcfen konstaterar i prop. 1973:155 med förslag till kreditupplysningslag (s. 125) att det av naturliga skäl är av stort intresse för kreditinstitutcn att få information om att en kund hos en annan bank eller motsvarande har misskött en kredit. Uttalandet ligger bakom undantaget från kreditupplys- ningslagen betr. kreditinstitutens interna informaticmsut 'äxling. Det före-

Prop. BSO/81:10 219

slagna särställandet av finansbolagen synes utan närmare klarläggande av statsmakterna fä upplattas sa att kreditinstitutcn gentemot linansbolagen också måste mera strikt iaktta banksekretessen.

lnspektionen vill mot den nu angivna bakgrunden fastslå att det utifrän de säkerhetsintressen som bankinspektionen har att be 'aka inom sitt tillsyns— omräde saknas anledning att i förevarande avseende låta finansbolagen inta en särställning. Liksom man tidigare i fråga om kreditinrättningarna även åberopat det skydd för den enskilde som banksekretessen och banktillsynen innebär kan här med liknande tyngd framhällas bestämmelserna om sekretess och tillsyn i den föreslagna finansbolagslagen.

Blir finansbolagen likställda med kreditinrättningar skulle inspektionen från sina utgångspunkter kunna godta förslaget att även upplysningar om näringsidkare betraktas som personupplysningar 1 k1cd1tupplysmngslacens mera inskränkta mening.

Genom förslaget beträffande finansbolagen erfordras ett klarläggande av statsmakterna i en sekretessfräga som har aktualiserats. Det gäller möjlig- heterna för kontokortsföretag (finansbolag) att inhämta upplysning om i vilken utsträckning kreditsökande redan har kontokrediter. Kreditbevilj- ningen bygger på vederbörandes betalningsförmäga med hänsyn till inkomst— förhällanden. varvid det naturligtvis kan vara en belastning om den kreditsökande redan. vilket ej är ovanligt. är utrustad med ett eller flera kontokort. Av konsumentsociala skäl och med hänsyn till kontokortsföre- tagens kostnader och soliditet är det av intresse att en persons skuldsättning via kontokort inte blir för hög. Det bör erinras om att köp med utnyttjande av kontokort kan ske utan kontantinsats till skillnad från vad som annars gäller vid köp enligt konsumentkreditlagen. Den information det här gäller är sådan att den sävitt gäller kreditinrättningar skulle kunna utväxlas internt mellan dessa men däremot inte på grund av banksekretessen utlämnas i extern verksamhet. lnspektionen drar härav slutsatsen att det analogivis trots sekretessregeln i förslaget till lag om finansbolag skulle — i vart fall inom kretsen av finansbolag — vara tttöjligt 'att utbyta erforderlig information om kontokrediter. ev. genom UC:s förmedling.

2.2.4 Svenska bankföreningen med instämmande av PKbanken. Sveriges föreningsbankers förbund. Finansieringsföretagens förening och Upplys- ningscentralen UC AB:

1 promemorian föreslås en ny lydelse av 1 :$ kreditupplysningslagen. som bl. a. innebär att förmedling av kreditupplysningar mellan finansbolag under bankinspektionens tillsyn och mellan sädana finansbolag och andra kreditin- rättningar under bankmspekhoncns tillsyn skall falla under lagen. Detta innebär ett avsteg från den nuvarande principen att k1editupplysningslagen inte skall omfatta förmedling av kreditupplysningar mellan banker och and ra kreditinrättningar under bankinspektimtens tillsyn. Motiveringen för detta avsteg är knapphändig och enligt bankföreningens mening inte bärande (sid. 61). Särhehandlingen av bankers och andra kreditinstituts interna kredit- upplysningsverksamhet motiverades utförligt vid tillkomsten av lagen (prop. 1973:155 sid. 124 o.f.). Ett huvudargument var att kreditinstitutcn intar en särställning i så måtto att de fungerar både som förmedlare av kreditupp- lysningar och som kreditgivare. Den information. som förmedlas mellan kreditinstitutcn. ansägs med rätta ha mycket stor betydelse vid deras

Prop. 1980/81 :10 220

kreditgivning både vid prövningen av nya kreditansökningar och vid bevakningen av redan lämnade krediter. Departementschefen uttalade i anslutning härtill:

"Det kan förutses att besvärande konsekvenser skulle uppstå. om man lät samma inskränkningar i informationsinnehället gälla betr. kreditinrättning- arnas interna upplysningsförmedling som i fråga om annan kreditinforma- tion. Särskilt gäller detta förbudet mot uppgift om betalningsförsummelse som inte har fastslagits av myndighet. Av naturliga skäl är det av stort intresse för kreditinstitutcn att få information om att en kund hos en annan bank eller motsvarande har misskött en kredit. Risken för att kreditinstitutcn på denna punkt lämnar en oriktig eller missvisande uppgift är också mycket liten" (prop. sid. 124—125).

Samtidigt konstaterade departementschefen. att riskerna för integritets- kränkningar var små även om man tillät en relativt fri kreditupplysnings- verksamhet inom kretsen av kreditinrättningar. För bankernas del hänvi— sades därvid till det skydd som banksekretessen innebär för den personliga integriteten.

De sälunda åberopade skälen för en särbehandling av kreditinrättningar under bankinspektionens tillsyn anser bankföreningen äga giltighet även för fint-insbolag som arbetar under sådan tillsyn. Enligt vad bankföreningen inhämtat tillmätes inom branschen den interna informationen mellan finansbolagen inbördes och mellan banker och finanslmlag stor praktisk betydelse. Att begränsa utbytet av information inom kretsen av reguljära kreditgivare skapar onödiga risker för kreditgivning till personer. som enligt i och för sig tillgänglig erfarenhet inte bör erhälla kredit i ett sunt kreditliv. Det särskilda skydd. som banksekretessen innebär inom bankvärlden. bör i finansbolag under bankinspektionens tillsyn åstadkommas genom den särskilda regel om tystnadsplikt som föreslagits i propositionen 1978/79: 170 med förslag till lag om finansbolag. m. m. Över huvud synes den föreslagna lagen om finansbolag tillerkänna bankinspektionen sådana befogenheter beträffande dessa bolag att en skillnad mellan denna företagskategori och andra kreditinrättningar under inspektionens tillsyn inte bör ifrägakomma. Bankinspektionen böri kraft av dessa befogenheter kunna meddela bl. a. de föreskrifter som mä erfordras för ett fullgott skydd av personlig.integri- tet.

Bankföreningen föreslår därför att finansbolag under bankinspektionens tillsyn i likhet med andra kreditinrättningar under inspektionens tillsyn lämnas utanför kreditupplysningslagen sävitt avser den interna kreditupp- lysningsft'irmedlingen.

2.2.5 Svenska sparbanksföreningen:

Enligt nuvarande lydelse av 1 & kreditupplysningslagen faller kreditupp- lysningar som förmedlas mellan banker och andra kreditinrättningar som står under bankinspektionens tillsyn utanför lagens tillämpningsområde.

Genom den föreslagna ändrade lydelsen av l så kommer kreditupplysning- ar mellan dels finansbolag. dels banker/kreditinrättningar och finansbolag att omfattas av lagen. Denna utvidgning anser sparbanksföreningen vara omotiverad. Det finns enligt sparbanksföreningens uppfattning ingen anledning att. beträffande kreditupplysningar av bankintern natur. ställa finansbolag under bankinspektionens tillsyn under mer rigorösa bestämmel-

Prop. l980/81:10 . 221

ser än som gäller för banker och övriga kreditinrättningar. Den grundläg- gande motiveringen för en särbehandling av banker och andra kreditinrätt- ningar i förhållande till de typiska kreditupplysningsföretagen som angavs vid tillkomsten av lagen (prop. 1973: 155 sid. 124 f) måste i lika hög grad gälla för finansbolagen.

Sparbanksföreningen föreslär därför att finansbolag som står under bankinspektionens tillsyn i likhet med övriga kreditinrättningar under sädan tillsyn undantas från lagens tillämpningsområde sävitt avser den interna kreditupplysningsförmedlingen.

2.2.6 Finansieringsföretagens förening:

1 avvaktan på resultatet av den översyn av kreditupplysningslagen som nu har avslutats har föreningen ej berört föreslagen lydelse av l & kreditupp- lysningslagen i regeringens proposition 19785'79:l7(.l. Den föreslagna lydel- sen. som i nedan avsett hänseende äterkommer i betänkandets förslag innebär att förmedling av kreditupplysningar mellan finansbolag under lutnkinspektionens tillsyn och mellan sädana finansbolag och andra kredi- tinrättningar under bankinspektionens tillsyn skall falla under lagen.

Pä sid. 61 i betänkandet och på sid. 150 i regeringens proposition 1978/79:170 ges motiveringen till förslaget. Det sägs att om ändringen ej gjordes skulle det innebära att lagen ej skulle gälla för förmedling av kreditupplysningar mellan finansbolag under bankinspektionens tillsyn inbördes. mellan dessa finansbolag och banker eller mellan dessa finansbolag och Upplysningscentralen UC AB.

I propositionen till kreditupplysningslagen (1973:155 sid. 124 ff) redovisas utförligt de skäl som motiverade att förmedling av upplysningar mellan kreditinrättningar skulle undantagas frän lagen. Till skillnad från den uppfattning. som anges i betänkandet. menar föreningen att de skäl som anfördes i nämnd proposition äger giltighet även för finansbolag. som kommer att lyda under bankinspektionens tillsyn. Den interna informa- tionen mellan finansbolagen inbördes och mellan banker och finansbolag är av stor praktisk betydelse.

Det bör för övrigt noteras att den föreslagna ändringen endast kommer att omfatta några av de finansbolag som kommer att lyda under lagen om finansbolag. eftersom verksamhet som avser förmedling av kreditupplys- ningar mellan företag inom samma koncern ändock undantages frän lagen. varigenom lagen ej kommer att gälla bankägda finansbolag över vilkas verksamhet bankinspektionen har tillfredsställande möjligheter att utöva kontroll.

Föreningen föreslär därför att undantag ej göres frän regeln att kredit- upplysningslagen inte skall omfatta förmedling av kreditupplysningar mellan kreditinstitut som lyder under bankinspektionens tillsyn. 1 övrigt ansluter sig föreningen till Svenska Bankföreningens yttrande (under 2.2.4).

2.2.7 Bankinspektionen:

1 1 & har tillförts att med kreditinrättning under bankinspektionens tillsyn skall jämställas annat företag under inspektionens tillsyn. om det har inrättats för kreditupplysningsverksamhet. Ocksä inspektionen anser att skäl finns för att överensstämmelse uppnås mellan lagens lydelse och den rådande

Prop. 1980/81 :10 222

ordningen. även om Upplysningscentralen UC AB:s (UC:s) nuvarande ställning som kreditinrättning i och för sig har stöd i riksdagens uttalanden vid kreditupplysningslagens tillkomst. Kvar står dock det faktum att tillsynen över UC inte såsom all annan direkt tillsyn av bankinspektionen är angiven i lag. UC:s status i nämnda avseende bygger på Kungl. Maj:ts beslut 1974-11-29 rörande bolagsordningen för UC. i vilken bestämmelser finns om tillsyn av bankinspektionen. Grunden är även här det åberopade riksdags- uttalandet. Möjligen kan göras gällande att den mera direkta legalisering av UC:s status som den föreslagna lagändringen syftar till ändå inte blir fullständig med hänsyn till det sist anff'irda.

Det gjorda tillägget i l s sista stycket tar ej heller sikte särskilt på UC utan synes avse möjlighet också för annat företag under inspektionens tillsyn att bli jämställt med kreditinrättning och därmed undantaget från kreditupplys- ningslagen sävitt gäller bankinterna upplysningar. Ocksä här kan således komma att aktualiseras frågan om grunden för tillsynen. Skall tillsynen 'ara föreskriven i lag eller räcker det med att bestämmelser härom har intagits i en regeringen underställd bolagsordning? Inspektion anser att även tillsynsfrä- gan tarvar ställningstagande av statsmakterna pä grund av det föreslagna tillägget i l & kreditupplysningslagen och motiven härför.

2.2.8 Svenska bankföreningen med instämmande av PKbanken. Sveriges föreningsbankers förbund och Upplysningscentralen UC AB:

Bankföreningen ftiireslär vidare att förmedling av kreditupplysningar mellan svenska banker och utländska banker lämnas utanför kreditupplys- ningslagen. Bankfi'ireningen äterkommer nedan med närmare motivering för detta förslag i samband med sin kommentar till 11 s. '

2.2.9 Svenska kreditmannaföreningarna i Stockholm. Göteborg och Mal- mö:

Föreslagen ändring av s 1 synes oss inte vara motiverad av nägra sakliga skäl. Nägot missförhållande räder uppenbarligen inte och tendenser till detta synes inte heller förefinnas. Den byråkrati och/eller de lagbrott som kommer att bli följden av den föreslagna ändringen bör undvikas. Ändringen kommer. om (len genomföres. att försvåra för kredittagare att erhålla krediter från nya leverantörer. De referenser som kredittagaren uppger kommer i framtiden att sakna laglig möjlighet att upplysa om förhållanden som skulle kunna leda till krediter. Detta sker nu regelbundet och i "större" omfattning. Konsekvensen kan inte vara lagstiftarens avsikt eller önskan.

Ändringsförslaget hör ätertagas.

1. andra hand föreslår vi följande ändring.

51.2 Verksamhet som avser förmedling av kreditupplysningar mellan företag som organisatoriskt ingår i samma koncemfrfirhåI/ande.

Motivet till detta är att man synes ha dragit koncernbegreppet alltför snävt i det att man endast beaktar det juridiska koncernbegreppet men ej det administrativa koncernförhällandet.

Prop. 1980/81 : 10 223

2.3 Begreppet kreditupplysning. Förslaget till ändrad definition av begreppet personupplysning (2 & promemorieförslaget)

2.3.1 Datainspektionen:

Promemorian föreslär inte nägon ändring av definitionen av kreditupplys- ning— — —. Detta kan säledes även ft')rtsättningsvis innebära att för det fall att exempelvis från SPAR eller annat register utlämnas mikrokort innehållande taxeringsuppgifter blir detta utlämnande att bedöma som kreditupplysnings- verksamhet i den mån det är känt för företrädaren för SPAR att mottagaren avser att använda informationen för kreditbedömning men eljest inte (utlämning på mikrokort innefattas inte av skyldigheten att utlämna allmänna handlingar). Frägan kan få praktisk betydelse i situationer då kreditupplysningsföretag och andra registerhällande organisationer konkur- rerar om utlämnande av stora informationsmängder.

Den föreslagna ändringen avser andra punktens definition av personupp- lysning. Gällande rätts definition har medfört avsevärda praktiska svärighe- ter genom att söka upprätthålla en gränsdragning som inte finns noterad i något offentligt register. Textförslaget löser detta problem med ett svärds- hugg som också avsevärt förbättrar integritetsskyddet för i första hand småföretagare och underlättar samordningen mellan kreditupplysningslagen och datalagen samt i ett längre perspektiv också underlättarsammanföring av dessa lagari en personregisterlag. lvad mån den föreslagna lösningen i stället orsakar problem vad gäller effektiviteten av kreditupplysningsverksamhet avseende upplysningar om enskilda företagare och företagsledare i andra företag är närmast en fråga som bör belysas av andra remissinstanser än datainspektionen.

Kan gränsdragningsproblemen lösas på ett godtagbart sätt kan dock övervägas att med bibehållande av gällande rätts personupplysningsdefini- tion på andra sätt åstadkomma ett ft'irbättrat integritetsskydd för i första hand småföretagare. Det bör också understrykas att ev. samordningsproblem mellan kreditupplysningslagen och datalagen inte bör prioriteras framför en 'äl fungerande kreditupplysningsverksamhet beträffande företagare och företagsledare. .

Det bör redan här påpekas att gränsdragningsproblcm och andra tillämpningsproblem inte helt undviks med den föreslagna regleringen.

2.3.2 Bankinspektionen:

Enligt ändring av 2 & skall ej längre i kreditupplysningshänseende någon skillnad göras mellan enskild person i allmänhet och enskild person som är näringsidkare eller motsvarande. Det betyder att de särskilda regler som till skydd för enskilds integritet gäller för personupplysningar kommer att gälla också för upplysningar som erfordras om enskilda till följd av engagemangi näringsverksamhet. t. ex. när fråga är om kredit till rörelsen eller om personlig borgen för kredit till eget bolag. Nu 'arandc undantag beträffande näringsidkare har utförligt motiverats i prop. 1973:155. 5. 79—80. lnspektio- nen anser att skälen för en mera ingående information i fråga om företagare fortfarande har relevans. De övriga förslag som nu läggs fram är inte ägnade att minska behovet av undantag för upplysningar om företagare. snarare tvärtom. Visserligen kan informationsutbyte fortfarande ske mellan kredit- inrättningar (bankintern information) oberoende av kreditupplysningslagen.

Prop. 1980/81 : 10 224

Indirekt har emellertid den nu gällande bestämmelsen viss betydelse för kreditinrättningarna. bl. a. vid rebeläning av fordringar. Väsentligt i sammanhanget är ocksa att finansbolagen om förslag därom i prop. 1978/79:170 antages inte skulle komma att betraktas såsom kreditinrättning- ari kreditupplysningslagcns mening. Dessa bolags verksamhet är i betydan- de omfattning — särskilt genom factoring och leasing — riktad till företag beträffande vilka upplysningar om ägaren/fi:")retagaren är av avgörande betydelse.

Blir finansbolagen likställda med kreditinrättningar skulle inspektionen från sina utgångspunkter kunna godta förslaget att även upplysningar om näringsidkare betraktas som personupplysningar i kreditupplysningslagens mera inskränkta mening.

2.3.3 Kommerskollegium:

Vad gäller kreditupplysningslagen anförs i utredningen att den nuvarande gränsdragningen mellan personupplysningar och företagsupplysningar vällat praktiska svårigheter. På grund härav föreslås att en skiljelinje dras mellan å ena sidan juridiska och å andra sidan fysiska personer. Även om en sådan förändring innebär en förenkling finner kollegiet den tveksam eftersom företagsupplysningar härigenom riskerar att bli mindre effektiva. Bedöm- ningen av ett mindre företags kreditvärdighet beror i hög grad på företagarens personliga skötsamhet varför det vid kreditgivningen torde vara nödvändigt att ta stor hänsyn till hans personliga förhällanden. l avvägningen mellan intresset av att skydda enskild person och behovet av en effektiv ft'iretagsupplysningsverksamhet har enligt kollegiets mening alltför stor vikt lagts vid skyddsintressena.

2.3.4 Brottsförebyggande rådets styrgrupp för översynen av lagstiftning mot organiserad och ekonomisk brottslighet:

Regeringen uppdrog den 8 december 1977 ät brottsförebyggande rädet (BRA.) att göra en översyn av lagstiftning mot organiserad och ekonomisk brottslighet. 1 regeringens beslut framhölls att BRÅ för ("översynsarbetet skulle tillsätta en styrgrupp som bl. a. borde behandla sädana övergripande frågor som rättssäkerhet contra effektivitet och kontrollnivän i samhället.

Till grund för regeringens uppdrag låg bl. at. de överväganden och förslag som BRÅ redovisat i ett yttrande till regeringen den 20 september 1977. I detta yttrande diskuterade BRÅ bl. a. de olika kontrollmedel som kunde komma till användning mot den aktuella brottsligheten. Därvid anfördes att samhällets åtgärder på området inte nödvändigtvis behövde bestå i en effektivisering av de repressiva instrumenten. Man kunde sålunda enligt BRÅ överväga om ett visst beteende kunde motverkas med t. ex. civilrättslig lagstiftning. [ yttrandet pekades också på den betydelse som etiska normer har på olika verksamhetsomräden av intresse i sammanhanget. t. ex. när det gäller att utveckla god affärssed inom näringslivet och bankväsendets etik.

1 det pågående översynsarbetet är det alltså för styrgruppen en viktig utgångspunkt att tillvarata de metoder för självkontroll utan repressiva inslag som kan tillämpas t. ex. på kreditmarknaden och på näringslivets område i övrigt. Bland de instrument som därvid kan användas är kreditupplysnings- verksamheten av stort intresse. En effektiv kreditupplysning kan sälunda

Prop. 1980/81: 10 225

vara en viktig faktor för att skydda samhället och näringslivet från osund kreditgivning och icke önskade affärsmetoder. Tillgång till en god kredit- upplysningsverksamhet är även av intresse för olika samhälleliga organ. främst för dem som sysslar med kreditgivning och olika former av stöd till näringsidkare men också för att garantera att statlig och kommunal upphandling av varor och tjänster kan ske i avsedda former. En effektiv kreditupplysningsverksamhet kan också medverka till att begränsa de resurser samhället mäste avsätta för sitt exekutionsväsende.

Kreditupplysningsverksamheten har alltså på flera sätt betydelse för att samhället skall komma till rätta med ekonomisk brottslighet. Även i den internationella diskussionen om ekonomisk brottslighet har framhållits behovet av en effektiv kreditupplysning som en metod att begränsa denna brottslighet. se bl. a. Europarädsrapporten Criminological Aspects of Eco- nomic Crime, Strasbourg 1978. s. 245.

Mot denna bakgrund är den inom justitiedepartementet upprättade promemorian (Ds Ju l979:8) Kreditupplysning och inkasso. som nyligen remissbehandlats. av intresse för styrgruppen. Gruppen vill särskilt upp- märksamma en punkt i förslaget.

l promemorian föreslås bl. a. en ändring i 2 & kreditupplysningslagen som innebär att kreditupplysningar om enskilda näringsidkare (enskilda företa- gare och jordbrukare m. fl.) skall falla under begreppet personupplysning. Förslaget grundas på integritetsskäl samt vissa praktiska skäl. De nämnda företagarna kommer enligt förslaget att omfattas av de stränga regler för kreditupplysning som redan i dag gäller andra enskilda personer. Tillämp- ningsområdet för den effektivare kreditupplysningen. s. k. företagsupplys- ning. avses därmed enligt förslaget att inskränkas till juridiska personer.

I promemorian. s. 71. anförs bl. a. följande: När det gäller näringsidkare och liknande måste emellertid också tas hänsyn till intresset av en tillräckligt effektiv företagsupplysningsverksam- het. lIuruvida en på angivet sätt ändrad gränsdragning mellan personupp- lysningar och företagsupplysningar är godtagbar från den synpunkten beror i hög grad på vilka särskilda bestämmelser som i fortsättningen bör gälla för personupplysningarna.

[ promemorians aVsnitt 3.6. Begränsning av rätten att lagra och vidarebefordra uppgifter om betalningsförsummelser. behandlas bl. a. frågan hur en undantagsregel skall kunna utformas för att man skall kunna undvika att personupplysningar om enskilda företagare blir missvisande. Det föreslås att den nu gällande bestämmelsen i 7 & första stycket kreditupplys- ningslagen. som reglerar vad personupplysning får innehålla. skall komplet- teras med en bestämmelse enligt vilken regeringen eller. efter regeringens bestämmande. datainspektionen får föreskriva undantag från nyss nämnda bestämmelse, om det behövs för att undvika att personupplysning blir uppenbart missvisande. [ specialmotiveringen till bestämmelsen anförs i promemorian att tillämpningen av denna undantagsmöjlighet förutsätts bli restriktiv.

Från de utgångspunkter som styrgruppen har att beakta i översynsarbetet är det angeläget att framhålla vikten av att kreditupplysningslagen inte ändras på sådant sätt att möjligheterna till en effektiv kreditupplysnings- verksamhet i fråga om enskilda näringsidkare blir beskurna. Styrgruppen menar att en effektivt fungerande kreditupplysningsverksamhet med dess värde som brottsförebyggande faktor — kan vara ett smidigare. billigare och mindre ingripande instrument än olika administrativa ktmtrollinstrument som eljest kan behöva tillämpas från samhällets'sida.

Prop.. 1980/81:10 226

Styrgruppen vill ifrågasätta det lämpliga i den föreslagna lagändringen. [ allt fall anser gruppen att de synpunkter som den här anfört noga bör beaktas i samband med att regeringen eller datainspektionen utövar den tänkta möjligheten att utfärda föreskrifter med undantag från begränsningsregeln. Med hänsyn till uttalandet i promemorian att denna möjlighet skall utnyttjas med restriktivitet hyser styrgruppen likväl oro för de effekter för kreditupp- lysningsverksamheten som ett genomförande av förslaget skulle kunna få.

2.3.5 Sveriges advokatsamfund:

12 & föreslås att begreppet personupplysning utvidgas till att omfatta även enskild person som är näringsidkare eller som annars har ett mera väsentligt inflytande över ett företag. Som skäl för ändringsförslaget hari promemorian huvudsakligen åberopats att datainspektionen funnit (len nuvarande gräns— dragningen mellan personupplysning och företagsupplysning vålla praktiska svårigheter.

Samfundet har i sitt yttrande den 2 februari 1973 över delbetänkandet "Kreditupplysning och integritet” (SOU 1972:79) (Se TSA 1973 s. 108 f) uttalat sig för den gränsdragning mellan kreditupplysning och personupplys- ning. som sedermera kommit till uttryck i lagen. Vad samfundet i nämnda yttrande anfört som skäl för sin ståndpunkt synes fortfarande gälla.

Skulle emellertid de av datainspektionen påtalade praktiska svårigheterna med den nuvarande lagstiftningen vara så betydande att en ändring bör ske. ifrågasättes frän samfundets sida. om inte gränsen mellan personupplysning och företagsupplysning bör dragas så. att till företz-tgsupplysning hänföres alla personer med registrerad firma eller med verksamhet under uppgiven. inte registrerad firma. Sättes gränsen mellan företagsupplysning och personupp- lysning vid rörelser. som drives under firma. skulle upplysningar beträffande bl. a. jordbrukare m. fl. komma att betraktas som personupplysningar.

2.3.6 Tjänstemännens centralorganisation (TCO):

TCO kan inte dela utredningens uppfattning om behovet av ett ökat integritetsskydd för enskilda näringsidkare. Som fastslogs i prop. 1973:155 är det oundvikligt att de höga krav på effektivitet som från samhällets och kreditgivarnas sida måste ställas på företagsupplysningsverksamhcten kom- mer att omfatta också de fysiska personer som är näringsidkare eller som står ett företag eller annan näringsverksamhet nära. Ett företags kreditvärdighet äri så hög grad beroende av företagarens skicklighet att det är nödvändigt att vid kreditgivningen ta hänsyn till hans person. Han kan därvid inte garanteras samma skydd för den personliga integriteten som en privatperson. En person kan vidare. utan att själv driva rörelse. ha ett sådant väsentligt inflytande i ett företag att det är nödvändigt med en ingående kännedom om hans förhållanden för att kunna bedöma företagets ekonomiska ställning. TCO kan för sin del inte finna något skäl till att man idag gör en annorlunda bedömning än vid lagens tillkomst. _

Kreditupplysningar inhämtas ofta i samband med att en arbetstagare söker anställning. I en sådan situation är det mindre önskvärt. sett ur arbetstaga- r'ens synpunkt. att kreditupplysningsinstitutet ska behöva lämna ut hans namn till en presumtiv arbetsgivare. Det kan också ifrågasättas om inte kreditgivningen försvåras för personer med inregistrerad firma om en begränsning görs i möjligheterna att erhålla kreditupplysning.

Prop. 1980/81 : 10 227

2.3.7 Svenska arbetsgivareföreningen och Sveriges industriförbund:

Enligt gällande regler skall kreditupplysningsverksamhet bedrivas så att den inte leder till otillbörligt intrång i personlig integritet genom innehållet i de upplysningar som förmedlas eller på annat sätt. Mot denna bakgrund bör näringsidkare naturligen tillförsäkras samma skydd mot otillbörligt intrång i den personliga integriteten som lagstiftningen vill ge andra medborgargrup- per. Som framhälles under avsnittet 3.2.3 (s. 71) saknas även enligt vår uppfattning bärande skäl att i integritetsavseende särbehandla näringsidka- re. Vi tillstyrker därför att 2 s" kreditupplysningslagcn får f("ireslagna lydelse och att m.a.o. begreppet personupplysning i denna lag definieras som kreditupplysning om enskild person.

Vid olika tillfällen har vi erinrat om behovet av lagstiftning, som garanterar också juridiska personer ett nöjaktigt integritetsskydd. Vi konstaterar att man inte heller vid den föreliggande översynen närmare gått in på detta problemområde. där vi saknar ett godtagbart rättsskydd.

2.3.8 Svenska bankföreningen med instämmande av PK-hanken, Sveriges föreningsbankers förbund, Finansieringsföretagens förening och Upplys- ningscentralen UC AB:

Denna paragraf föreslås i promemorian uppta en ny definition på personupplysning. F. n. avser personupplysning endast kreditupplysningar om privatpersoner. Övriga kreditupplysningar vanligen kallade företags- upplysningar avser dels kreditupplysningar om juridiska personer. dels kreditupplysningar om enskilda personer som är näringsidkare eller "annars har så väsentligt inflytande i viss näringsverksamhet att uppgift om hans egna förhållanden behövs för att belysa verksamhetens ekonomiska ställning". Av de två kategorier fysiska personer. som sist nämnts. hänför sig i detta ärende det avgjort största intresset till näringsidkarna. Bankföreningens yttrande tar därför i första hand sikte på de föreslagna nya reglerna sävitt de avser näringsidkarna. [ tillämpliga delar gäller kommentarerna beträffande näringsidkarna emellertid även enskilda personer med väsentligt in flytande i annans näringsverksamhet utan att detta särskilt utsäges vid varje tillfälle där förslaget jämställer dessa båda kategorier av fysiska personer.

Enligt den föreslagna nya definitionen på personupplysning skall sådan upplysning avse inte blott. såsom f. n., rena privatpersoner utan även fysiska personer som är näringsidkare eller har ett väsentligt inflytande i annans näringsverksamhet. I fortsättningen benämnes de bägge sistnämnda katego- rierna gemensamt näringsidkare. Denna ändrade gränsdragning — som alltså innebär att gränsen mellan personupplysningar och företagsupplysningar dras mellan å ena sidan kreditupplysningar om alla fysiska personer och å andra sidan kreditupplysningar om alla juridiska personer anser bankföre— ningen inte böra vidtagas.

Såsom skäl för det nya begreppet personupplysning anföres i promemorian i huvudsak följande:

a) Datainspektionen har funnit att det i praktiken ofta är svårt att dra gränsen mellan vanliga privatpersoner och näringsidkare. I den masshante-, ring det gäller kan man inte göra någon finprövning. Kreditupplysningsfö- retagen måste lita till offentliga register och dessa ger mycket schematiska uppgifter, som ofta utan skäl hänför en fysisk person till kategorin näringsidkare.

Prop. HSO/81:10 228

b) Den nuvarande regeln skapar också svårigheter när den skall tillämpas beträffande personer som växlar mellan att vara näringsidkare och anställ- da.

c.) Med den nuvarande regeln skapas svårigheter i datoriserade kredit— upplysningsregister. eftersom personuppgift i datalagen avser alla fysiska personer. även näringsidkare.

Såvitt bankföreningen förstår är den sålunda redovisade argumenteringen på väg att förlora sin giltighet. En betydande andel av personupplysnings- verksamheten i landet utövas av det för affärsbankerna. Sparbankernas bank och Sveriges föreningsbankers förbund gemensamma bolaget Upplysnings- centralen UC AB. Hos UC pågår ett utvecklingsarbete, som beräknas i stort sett avlägsna svårigheterna att i bolagets verksamhet dra gränsen mellan privatpersoner och näringsidkare. UC räknar med att uppnå detta bl. a. genom att utnyttja uppgifter ur offentliga register om vilka fysiska personer som är innehavare av enskild firma. delägare i handelsbolag. eller medlemmar av aktiebolags styrelse. Den avsedda uppläggningen förutsätter såvitt gäller fysiska personer i aktiebolags ledning att en planerad datm'ise- ring av patentverkets register kommer till- stånd. Vidare bygger UC:s planläggning på en utökad samverkan mellan UC och beställare av kreditupplysningar såvitt gäller att fastställa en omfrägads karaktär av näringsidkare eller privatperson. Bl.a. med hänsyn till konkurrensen i branschen är motsvarande utveckling som UC:s sannolik inom den väsentliga delen av branschen i övrigt. Ett av de i första hand åberopade skälen för den nya definitionen på personupplysning kan därför väntas bortfalla. Svårigheterna att tillämpa nuvarande regel beträffande personer som växlar mellan att vara näringsidkare och anställda kan enligt UC:s uppfattning redan i dag i huvudsak bemästras. Enligt UC:s bedömning innebär det inte heller någon avgörande svårighet att personupplysning i kreditupplysningslagen och personuppgift i datalagen inte definieras på samma sätt. Ytterligare skäl mot den nya definitionen ——— av begreppet personupplysning skall redovisas nedan vid kommentarerna till olika ändringar i andra paragrafer i denna lag.

2.3.9 Svenska sparbanksföreningen:

'Enligt den nuvarande lydelsen av zs kreditupplysningslagen omfattar begreppet personupplysning enbart upplysning om privatpersoner och således inte enskilda näringsidkare och personer med väsentligt inflytande i viss näringsverksamhet. Den föreslagna ändringen innebär att begreppet personupplysning skall omfatta samtliga privatpersoner — således även den sistnämnda personkategorin.

Som motiv för denna ändring har anförts gränsdragningsproblem. Enligt uppgift från det gemensamt bankägda Upplysningscentralen AB (UC) har man i princip löst alla de grz'insdragningsproblem som berörts i promemorian. varför det anförda motivet förlorat sin bärkraft.

Det kan i och för sig tyckas bestiekande och vällovligt att skapa ett ökat integritetsskydd för kategorin näringsidkare och personer med väsentligt inflytande i näringsverksamhet. lläremot vill dock sparbanksföreningen anföra att effektivitetssynpunkter och krav på fullständig redovisning av alla uppgifter som rör ett företags ekonomiska ställning och ledning måste anses väga väsentligt tyngre än integritetssynpunktcrna. Sparbanksföreningen vill vidare peka på att konsekvenserna av den föreslagna ändringen — i första

Prop. HSO/81:10 229

band kravetipå att kopia av kreditupplysning skall tillställas den omfrågade — skulle allvarligt kunna skada svenska företags exportltandcl och förbindelser med utländska banker.

Sparbanksföreningen föreslår på grund härav att nuvarande definition av begreppet personupplysning bibehålls.

Vad beträffar övriga föreslagna. huvudsakligen redaktionella. ändringar i lagen har sparbanksföreningen inget att erinra.

2.3.10 Sveriges grossistförbund:

l departetnentsprotnemorian föreslås att alla kreditupplysningar om enskilda personer. således även i de fall då dessa är näringsidkare. skall betraktas sotn personupplysning. Bakgrunden härtill är att enligt datainspek- tionens erfarenheter gränsdragningen mellan personupplysningar och före- tagsupplysningar vållar praktiska svårigheter. Enligt departementsprome- morian når man den klaraste och i praktiken mest hantcrliga gränsdragning— en om man låter begreppet personupplysning omfatta kreditupplysningar rörande alla enskilda personer oavsett deras status i övrigt.

Enligt vår mening gör man det alltför lätt för sig om man följer detta förslag och därmed begränsar kreditupplysningarna rörande sådana enskilda personer som är näringsidkare. Detta betyder nämligen att man för leverantörerna till dessa näringsidkare begränsar möjligheterna att få erforderlig information om kundens ekonomiska förhållanden.

Kreditgivning är ett naturligt inslag i all affärsverksamhet. En viktig förutsättning för att denna kreditgivning skall kunna fungera smidigt och till rimligt låga kostnader är att kreditgivaren — förutom erforderlig säkerhet kan erhålla sådan information om kredittagaren att den risk som alltid måste vara förenad med kreditgivning blir så liten som möjligt.

Den som bedriver näringsverksamhet måste därför acceptera att uppgifter lämnas om hans verksamhet. Detta gäller även enskilda personer som är näringsidkare. Man kan inte rimligen lägga samma integritetsskyddssyn- punkter på dessa som på privatpersoner. Eventuella gränsdragningsproblem får i stället lösas på annat sätt.

Det hör givetvis också till bilden att en begränsning av kreditupplysningen kan påverka berörda näringsidkares möjligheter att erhålla kredit. Denna aspekt har inte berörts av datainspektionen och har inte heller analyserats i departementspromemorian.

Vi vill i sammanhanget starkt understryka att kreditgivningen till enskilda personer som samtidigt är näringsidkare i vissa branscher är mycket betydande. Som exempel kan nämnas att försäljningen från sådana maskinförsäljningsföretag som levererar anläggningsmaskiner och maskiner för skogsbruk uppgår till ca 2 miljarder kronor inkl. reservdelar. Det beräknas att ca 75 % av avsluten faller på mindre entreprenörer, som tillhör kategorin enskilda personer. De maskiner sotn levereras till dessa betingar en kostnad från 300 ()00 kronor till 1,5 milj. kronor per styck. Detta exempel visar att det rör sig om omfattande affärer. där en väl fungerande kreditupplysning har väsentlig betydelse.

På anförda grunder avstyrker vi därför förslaget att kreditupplysning rörande enskilda personer som är näringsidkare skall betraktas som personupplysning.

Prop. l980/81:10 230

2.3.11 Sveriges köpmannaförbund samt Sveriges hantverks- och industrior- ganisation och Familjeföretagens förening (SHIO/Familjeföretagen):

Se 2.7.6 nedan.

2.3.12 Lantbrukarnas riksförbund (LRF):

Promemorian innehålleri denna del bl. a. förslag om ändrad definition av begreppet personupplysning. För sådana upplysningar gäller särskilda regler till skydd för den personliga integriteten. Sålunda får personupplysningar endast innehålla betalningsanmärkningar som fastslagits genom domstols eller annan myndighets avgörande eller som lett till betalningsinställelse, konkursansökan eller ackord. För närvarande undantas från tillämpning av reglerna om personupplysning. förutom alla juridiska personer. enskilda personer som är näringsidkare eller som annars har ett mera väsentligt inflytande i viss näringsverksamhet. Undantagna är därmed hantverkare. lantbrukare och andra småföretagare. Ändringsförslaget innebär emellertid att som personupplysning skall betraktas alla upplysningar om enskilda personer. oavsett om de är näringsidkare eller dylikt.

Förslaget motiveras med att det enligt underhandsuppgifter från datain- spektionen inte är regel på området för företagsupplysningar att kreditupp- lysningsföretag m. fl. utnyttjar möjligheten att använda uppgifter om andra betalningsförsummelser än sådana som har fastslagits av domstol e. d. "Jenna uppfattning kan inte accepteras av LRF. i vart fall inte på det onyanserade sätt den framförs i promemorian. Genomgående kan sägas att till den del företag inom lantbrukskooperationen har behov av kreditupp- lysningar om enskilda lantbrukare information av typen personupplysning är tillräcklig. Denna kan nämligen i de flesta fall kombineras med personlig kännedom om den kreditsökande. Vad nu anförts gäller främst de kombinerade inköps- och försäljningsföreningarna d. v. s. lantmännenorga- nisationen. För jordbrukets försäljningsföreningar. främst mejeri- och slakteriföreningar. kan samma sak sägas till den del det gäller krediter till enskilda lantbrukare. Föreningarna vänder sig emellertid i sin verksamhet till ett stort antal andra typer av småföretag. såsom restauranger. gatukök och detaljister. Beträffande denna typ av småföretagare inhämtas regelmässigt mer omfattande information än som skulle framkomma i en personupplys- ning. Kompletterande upplysningar beträffande de angivna kategorierna av företagare kan svårligen fås fratn. LRF finner således att småföretagare som hittills inte skall omfattas av reglerna om personupplysning. med undantag för. om så är möjligt. enskilda lantbrukare.

2.3.13 Motorbranschens riksförbund (MRF):

Se 2.1.6 ovan.

2.3.14 Sveriges ackordscentral:

Aekordscentralen ifrågasätter. om inte begreppet "personupplysning" har fått en alltför vidsträckt utformning i förslaget. Framförallt när det gäller mindre företag, sotn drivs av en enskild näringsidkare eller i vilket annan enskild person har ett avgörande inflytande. kan det vara till nackdel för

Prop. 1980/81:10 231

företaget att de uppgifter som får lämnas om nämnda personer blir så förhållandevis begränsade. En presumtiv kreditgivare. som inte genom kreditupplysning får de uppgifter om den enskilde som han finner naturliga och nödvändiga för sin bedömning av vederbörandes kreditvärdighet. kan komma att vägra kredit som han annars skulle ha varit villig att lämna.

2.3.15 Svenska kreditmannaföreningarna i Stockholm, Göteborg och Mal- mö:

Föreslagen ändring av så 2 kommer att medföra ett sämre bedömningsun- derlag. För en kredittagare är det av väsentligt intresse att erhålla behövlig kredit och därför motverkar z'indringsförslaget kredittagarens möjligheter att styrka sin kreditvärdighet.

2.3.16 ABAK-Justitia AB:

Den i promemorian & 2 föreslagna definitionen av näringsidkare respek- tive konsument (enskild person) är enligt vår mening felaktig. varför vi med bestämdhet motsätter oss nämnda kategorisering.

Enligt promemorian skall sålunda företagsupplysning avse enbart juridis— ka personer mcdan övriga näringsidkare i egenskap av enskilda personer skulle komma att tillhöra personupplysningskategorien.

Med den ovan föreslagna kategoriseringen kommer realitet en stor del av svenska näringsidkare. nämligen de som av olika skäl valt annan företags— form än juridisk person. som t. ex. aktiebolag. att hänföras till fel kategori, nämligen konsumentens med ty åtföljande för vederbörande näringsidkares verksamhet negativa effekter.

En klar avgränsning mellan köp på kredit avseende å ena sidan konsuments köp för enskilt bruk och å andra sidan näringsidkares köp av vara eller tjänst för sin verksamhet måste göras.

Vad avser konsumentköp skall beaktas att sådan kredit avser enstaka affärsförbindelse med för säljaren oftast god avkastning och liten kreditrisk. Med hänsyn till det ringa antal transaktioner per konsument det är fråga om är säljarens riskspridning utomordentligt stor och förlusterna totalt sett relativt små. -

Vid motsvarande transaktioner avseende kreditförsäljning till näringsid- kare föreligger motsatta förhållandet. Säljaren har att göra med ett färre antal kunder men med ett flertal kontinuerliga kreditförsäljningar per kund med ty åtföljande mindre riskspridning och större risk för kundförluster. Vid försäljning till andra näringsidkare föreligger i allmänhet betydligt lägre affärsvinst än vid försäljning till slutlig konsument. Detta får till följd att vid kundförluster större skada uppstår både till sin omfattning och i kronor räknat än vid förlust vid försäljning till enskild konsument. Konsekvensen av detta är att en utebliven kreditbevakning av nu nämnda kategori av näringsidkare skulle få för den allmänna handelns räkning förödande konsekvenser. såsom t. ex. konkurser för säljföretag.

Konsekvensen av ovan fört resonemang torde med all tydlig önskvärdhet utvisa nödvändigheten av att även denna typ av näringsidkare (enskild person) måste kontinuerligt bevakas evad avser vederbörandes kreditvär- dighet. Det väsentliga kan icke vara formen vederbörande valt för att driva sin verksamhet utan fastmer det förhållandet att vederbörande rcaliteter

Prop. 1980/81:10 232

bedriver näringsverksamhet och härigenom de facto tillhör samma kategori som den juridiska personen och även både vill och skall behandlas på samma sätt.

Kreditbevakning innebär att säljaren får fortlöpande besked om betal- ningsförsummelse som registrerats på hans kunder bland vilka ingår förutom juridiska personer — också enskilda näringsidkare. Genom att på detta sätt löpande kunna hålla sig informerad om sina kunders aktuella kreditvärdighet har säljaren idag möjlighet att undvika kreditförluster. l dagens affärssamhälle är det både vedertaget och nödvändigt att på detta sätt kreditbevaka samtliga kunder som är näringsidkare.

Enligt vår mening bör därför den som är — och vill verka som — näringsidkare själv avgöra detta genom en viljeyttring. nämligen registrera sin enskilda firma eller sitt enkla bolag. Därmed finns erforderliga förutsättningar för kreditgivaren att avgöra om en begärd kredit avser konsument för huvudsakligen enskilt bruk eller näringsidkare i dennes yrkesmässiga verksamhet och detta oavsett valet av företagsform.

En tillkommande effekt skulle förmodligen bli att enskilda personer med tidigare obsoleta registrerade enskilda firmor omgående avregistrerade sig samt att enskilda firmor som f. n. bedriver näringsverksamhet under oregistrerad firma registrerade densamma. En ytterligare effekt av förslaget torde bli att enskilda näringsidkare diskrimineras genom att de p. g. a. t. ex. bristande möjligheter till kreditbevakning förmenas krediter. En etablerad affärsförbindelse får nämligen oftast till följd flera kreditförsäljningar och ökad kreditvolym som för säljarens del innebär att han vid varje tillfälle måste vara informerad om köparens kreditvärdighet. Skulle det nu föreliggande förslaget antagas skulle kreditgivaren komma att sakna möjlighet att genom kreditbevakning få besked om eventuell inträffad betalningsförsummelse hos hans köpare. Detta torde få mycket svåra konsekvenser för näringslivet och allvarligt äventyra de regler som gäller för företagarekrediter.

En ytterligare konsekvens med föreslagen definition av näringsidkare är när utländskt företag självt eller genom utländskt kreditupplysningsföretag önskar kreditupplysning på enskild näringsidkare i Sverige för en t. ex. tilltänkt agentur eller annan affärsförbindelse. Kreditupplysningsföretaget skulle i det fallet den svenska näringsidkaren inte är juridisk person ha att ta ställning till det legitima behovet av upplysningen och — om upplysningen begärs av den presumtive säljaren genom utländskt kreditupplysningsföretag eller annan — begära uppgift om namnet på kreditgivaren.

lnom affärslivet råder många gånger oklarhet huruvida viss person är näringsidkare eller inte. Fråga kan t. ex. uppkomma om viss person är t. ex. bokföringsskyldig. momspliktig. pliktig att svara för vissa sociala avgifter för annan. pliktig att själv svara för inkomstskatts erläggande m.m. men härvidlag har man accepterat (len av oss föreslagna kategoriseringen. nämligen registreringen av enskild firma. .

Enligt vår mening har man i förslaget sålunda överarbetat integritetsskyd- det för konsument till uppenbart men för enskild näringsidkare och för kreditgivare.

Beträffande registrerade firmor som är aktiebolag. handelsbolag eller ekonomiska föreningar talar enligt vår uppfattning starka skäl för att kreditupplysning om sådan juridisk person skall få innehålla ekonomiska uppgifter om t. ex. styrelseledamot. verkställande. direktör. företagsledare eller annan med väsentligt inflytande över företagets verksamhet.

Prop. 1980/81 : 10 233

2.4 'l'illståndsplikten (3 och 4 åå promemorieförslaget) 3 55 prommnoridörslagcr 2.4.1 Datainspektionen:

Ändringen är som påpekas. en följdänt'lring till företagna ändringar i tryckfrihetsförordningen. För att underlätta för utgivare av tryckta kredit- upplysningsskrifter och av sådana kreditupplysningsskrifter som faller under lkap. 5.5 tryckfrihetsförordningen bör måhända lagtexten innehålla en anvisning om att dessa skrifter — ehuru på olika sätt är underkastade ett flertal av kreditupplysningslagens stat ganden säsom (». 7. 8. 9. lll. ll. Il. 13 och lb åå. Detta kan eljest vara svårt att urskilja för icke—jurister.

4 9” prmnemoricförslaget 2.4.2 Justitiekanslern (JK):

Den föreslagna lagtexten i andra stycket synes mig alltför intetsägande. Uttrycket "förhållande som har haft betydelse för tillståndet” ger ingen som helst upplysning om vad som åligger tillständshavaren. Av motiven framgår att datainspektionen förutsätts i tillståndet ange i vilka hänseenden tillståndshavaren skall vara skyldig anmäla ändringar. Detta bör komma till uttryck i lagtexten.

2.4.3 DatainSpektionen:

Datainspektionen ifrågasätter om behovsprövningen för tillstånd enligt kreditupplysningslagen verkligen behöver bibehållas. Problemen med kre- ditupplysningsbranschcns struktur är ingalunda att alltför många företag är verksamma i branschen utan snarare tendensen till att två är tre företag helt dominerar marknaden. '

De tryckfrihetsrättsliga ramarna för lagreglering av tryckta kreditupplys- ningsskrifter och sådana kreditupplysningsskrifter som omfattas av 1 kap. 5. & tryckfrihetsförordningen innebär. som päpekats. att föreskrifter för hur verksamheten skall bedrivas (4 så sista punkten och 17 s) ej kan meddelas för sådana skrifter. Datainspektionen har uppmärksammat fall där uppkomna integritetsinträng inte kunnat föranleda åtgärder från inspektionens sida till förhindrande därav. Medan i konventionell kreditupplysning person- eller organisationsnummer alltid används för att identifiera den varom upplysning lämnas. förekommer i tryckta kreditupplysningsskrifter inte alltid sädan säker identifiering. llar således en kreditupplysningsskrift publicerat uppgift om att en person med ett vanligt namn och en vag adressangivelse drabbats av en notering om betalningsförsummelse kan detta lätt leda till att personer med samma namn och snarlik adress förvägras kredit av kreditgivare som endast tar del av kreditupplysningsskriften för sin kreditbedömning och som således endera förväxlar den kreditsökande med den betalningsförsumliga eller "tar det säkra för det osäkra".

Det sagda innebär att det kanske bör övervägas om det är lagtekniskt möjligt att föreskriva eller i vart fall rekommendera att uppgift om bctalningsförsummelse som publiceras i skrift skall hänföras till entydigt identifierad juridisk eller fysisk person dvs. namn eller firma bör i möjligaste

Prop. HSO/81:10 234

män åtföljas av person- eller organisationsnummer. Detta kan i och för sig sägas ligga i det generella stadgandet i 5 % kreditupplysningslagen. men att ändra en vedertagen ordning med stöd av en sådan generell regel möter praktiska svårigheter.

Föreslagen ändring i andra stycket är f("iranlcdd av datainspektionens påpekande. Möjligen bör ordet "tillståndet" utbytas mot det mera adekvata "tillståndsprövningen".

Däremot föresläs inte nu —i avbidan på remissbehandling av betänkande (SOU 1978:73) Kontroll av utländsk företagsetablering i Sverige m. m. något annat kriterium för prövning av tillständssökandens "svenskhet" än det gällande. nämligen den numera något snåriga lagen (1916:156) om vissa inskränkningar i rätten att förvärva fast egendom m. m.

2.5 Den allmänna regeln för hur kreditupplysningsverksamhet skall bedrivas (5 & kreditupplysningslagen)

2.5.1 Datainspektionen:

Någon ändring föreslås inte av lagtexten i denna del. där endast sägs att kreditupplysningsverksamhet skall bedrivas så att den ej leder till obehörigt intrång i personlig integritet på skilda sätt. Det innebär att oaktat lagen i övrigt omfattar även kreditupplysningsverksamhet avseende juridiska per- soner upptas inte någon allmän regel till skydd för dessa. Det torde innebära att datainspektionen inte kan föreskriftsvis reglera hanterande av företags- upplysningar även om kreditupplysningsföretagets förfarande kan föranleda skadeståndsskyldighet enligt 21 &. Skälet till de skilda formuleringarna i 5 och 21 55 synes dunkelt.

2.6 Begränsning av rätten att samla in, lagra och vidarebefordra uppgifter om vissa personliga förhållanden (Gå promemorieförsla- get)

2.6.1 Datainspektionen:

Datainspektionen har ingen erinran mot föreslagen ändring. Ändringen synes sakna praktisk betydelse men då uppräkningen av "förbjuden information" avses vara fullständig bör den givetvis kompletteras med nytillkommen lagstiftning. i detta sammanhang bör påpekas att i den mån konkurslagstiftningskommitténs förslag i betänkande (SOU 1979:13) Konkurs och rätten att idka näring om "näringsförbud" resulterar i lagstiftning bör givetvis näringsförbud få registreras och utlämnas i person- upplysningar om vederbörande. Ett särskilt problem uppstår dock i de fall den näringsförbjudne söker en konsumentkredit där ju uppgiften om näringsförbudet saknar direkt betydelse.

2.6.2 Svenska kreditmannaföreningarna i Stockholm. Göteborg och Mal- mö:

Paragraferna 6 och 7 kommer enligt förslaget att innehålla vissa förbud mot uppgiftslämnande om bl. a. kreditspärr. Detta i sin tur innebär, att det inte är tillåtet att varna en kollega för uppenbara kreditbedragare. utan dessa

Prop. 1980/81:10 235

skall alltså kunna "härja fritt" ända till dess någon har kunnat intressera polisen för verksamheten. vilket inte är det lättaste. eller till dess man lyckats få domstolsutslag på något belopp. Konsekvenserna synes strida helt mot övriga åtgärder mot ekonomiska brott. Vidare anser vi. att en möjlighet bör finnas för insamling och registrering av uppgifter enligt paragraf 6 kreditupplysningslagen.

Det måste ju för alla parter och inte minst ur allmänpreventiv synpunkt vara av största betydelse. att inte en förskingrare ges kredit eller en rånare anställs som bankbud. Vederbörandes återanpassning i samhället torde generellt sett snarast förbättras genom en dylik spärr.

2.7 Begränsning av rätten att lagra och vidarebefordra uppgifter om betalningsförsummelser (7 & promemorieförslaget)

2.7.1 Stockholms tingsrätt:

Bestämmelserna i 75 kreditupplysningslagen är avsedda att så långt möjligt garantera. att kreditupplysning inte innehåller någon oriktig eller missvisande information om betalningsförsummelse. Personupplysning får därför. såvitt nu är i fråga. inte innehålla uppgift om annan betalningsför- summelse än sådan som har fastslagits genom domstols avgörande. Det blir i första hand fråga om lagsökningsutslag eller slutbevis i mål om betalnings- föreläggande. Ett sådant avgörande anses utgöra ett indicium på att en person har gjort sig skyldig till betalningsförsummelse. Tingsrätten har inte något förslag till ändring av bestämmelsen i fråga men vill i alla fall framhålla. att det i tingsrättens verksamhet inte sällan visar sig. att ett avgörande av det slag som nämnts inte motsvaras av en betalningsförsummelse i egentlig mening. Bl. a. kan framhållas följande exempel.

Enligt den vid tingsrätterna allmänt använda handboken av B. Liline': Betalningsföreläggande. avsnittet om för sent inkommet svar (s. 237). skall ett bestridande efter förklaringstidens utgång inte beaktas. Stockholms tingsrätt handlar inte i enlighet med denna rekommendation utan tar hänsyn till även senare inkomna bestridanden så långt detta är möjligt praktiskt sett. Skulle tingsrätterna i allmänhet handla, som Lihn'e anser att de bör göra, måste det förekomma att de meddelar slutbevis trots att de har kännedom om att fordrings riktighet har bestritts eller kanske t. o. m. om att fordringen har betalts.

Uppenbart är att många gäldenärer efter ansökan om lagsökning eller betalningsföreläggande betalar vad borgenären fordrar utan att bestrida ansökningen. Detta framgår bl.a. av det stora antalet återkallelscr av ansökningar från borgenärerna. Många gånger kommer återkallelserna för sent till tingsrätten, dvs. efter det att utslag/slutbevis har meddelats. Gäldenärerna förstår ofta inte betydelsen av att de bestrider direkt till domstolen och borgenärerna inte betydelsen av att de återkallar. Ibland kan det vara dålig kommunikation mellan borgenären, som har mottagit betalningen. och hans ombud. Återkallelse i tid kan också förhindras av läng bokföringstid hos borgenären. Det kan i sistnämnda hänseende sägas. att en av de borgenärer som har ett mycket stort antal ansökningar om betalnings- föreläggande vid tingsrätten har framhållit. att det går 14 dagar från inkommen betalning till dess meddelande om den når den avdelning hos borgenären som kan äterkalla ansökningen hos tingsrätten. Detta måste ses i belysning av att förklaringstiden för gäldenären normalt skall vara högst två

Prop. 1980/81:10 236

veckor och generellt är tio dagar vid tingsrätterna i stockholmsområdet.

Ytterligare inträffar att gäldenären i lagsökningsmål framför invändning. som på grund av de begränsade möjligheterna under lagsökningsprocessen att ta hänsyn till invändningar. inte hindrar utslag i lagsökningsmålet men väl senare efter ansökan om återvinning leder till att utslaget undanröjs.

En inte alldeles ovanlig situation är att gäldenär i mål om betalningsföre— läggande bestrider skyldighet att betala del av den fordran ansökningen avser. Vid sådant förhållande skall tingsrätten meddela slutbevis beträffande den obestridda delen. Det framstår för tingsrätten många gånger som tveksamt. om det i dessa fall rör sig om en verklig betalningsförsunnnelse. Det kan i Stället vara så att gäldenären har haft godtagbart skäl att innehålla betalning i väntan på en förhandlingsuppgörclse. Bl. a. beroende på olika gäldenärers sätt att formulera sig kan det närmast vara en slump. om målet kommer i sådant läge. att delslutbevis kommer att utfärdas. Utfärdande av delslutbevis kan vara formellt riktigt av tingsrätten men beviset kan vara högst missvisande som tecken på betalningsft'irsummelse.

Vidare kan sägas att utslag/slutbevis. när det gäller mycket gamla fordringar. kan vara missvisande i kreditupplysningssammanhang. Under de senaste åren har tingsrätten fått alltfler ansökningar. som rör mycket gamla fordringar. tio år och äldre. Det ärju också så att preskriptionstiden inte skall beaktas ex officio av tingsrätten i summarisk process. 1 en hel del fall nås uppenbarligen inte gäldenären av inkassokrav och kanske har han inte före delgivningen av ansökningen om betalningsföreläggandet överhuvudtaget fått kännedom om fordringen. Som exempel kan nämnas fordran på parkeringsavgift. där den på bilrutan fästade lappen inte finns kvar vid bilförarens återkomst när han hämtade bilen. l sådant fall är det en vanlig situation. att gäldenären medger kapitalbeloppet men bestrider skyldighet att betala inkassoavgift. Delslutbevis på kapitalbeloppet utfärdas då. 1 andra liknande fall kan situationen helt enkelt vara den att gäldenären intc snabbt nog hinner få fram pengar för att kunna betala före förklaringstidens utgång. lallmänhet har han naturligtvis heller inte klart för sig registreringseffekten av ett slutbevis.

Tingsrätten har med det upptagna velat visa. att dt.)mstolsavgörande inte sällan är ett dåligt indicium på att betalningsförsummelse i egentlig mening föreligger. Det är därför viktigt att rättelseinstitutet (12 &) fungerar väl.

Tingsrättens enhet för betalningsföreläggandcn och lagsökningar får ofta förfrågningar från personer. som har fått kopia (utdrag) av kreditupplysning beträffande dem själva och som ställer sig helt oförstående till uppgifter i kreditupplysningen om utslag eller slutbevis. Tjänstemännen vid enheten försöker då med ledning av innehållet i kreditupplysningarna kontrollera uppgifterna. Det händer. att innehållet är otillräckligt för spårning inom tingsrätten. Kontakt tas då med kreditupplysningsföretaget. Det har ibland visat sig att någon deluppgift i kreditupplysningen (t. ex. datum) varit felaktig. Fall har också förekommit. där det har visat sig att kreditupplys- ningsföretaget inte har tillgång till tillräckliga uppgifter vare sig i register eller grundmaterialet för att anteckningen i kreditupplysningen i fråga skall kunna verifieras.

Det bör också framhållas. att tjänstemän på enheten för betalningsföre- läggande och lagsökningar ibland ser sig föranledda att hänvisa personer till datainspektionen för råd och hjälp i kreditupplysningsfrågor. Tyvärr är det nog så att datainspektionens uppgift på det området är mindre känd för den stora allmänheten. Det borde övervägas, om inte genom meddelanden i

Prop. 1980/81: 10 237

t. ex. TV och radio datainspektionens roll bättre skulle kunna bckantgö- ras.

Tingsrätten vill avslutningsvis i denna del framhålla vikten av att krcditupplysningsföretag i sina register eller i bakgrundsmaterial har sådant material. att uppgifter i kreditupplysning kan identifieras och kontrolleras.

att de personer som för kreditupplysningsföretagens del samlar in uppgifter ur tingsrätternas diarier ät företagen ges sädan utbildning. att de förstår innebörden av sin verksamhet. och

att, som 'förutskickas i promemorian (s. 122—123). åtgärder vidtas av datainspektionen i syfte att åstadkomma att meddelande om rättelse i ett kreditupplysningsföretags register kommer att tillställas även andra kredit- upplysningsföretag.

2.7.2 Datainspektionen:

Formuleringen i andra stycket innebär inte bara en redaktionell ändring av ktmstitutionella skäl utan får också ses som en konsekvensändring till följd av det föreslagna nya personupplysningsbegreppct. Enligt departementspro- memorian avses formuleringen syfta till en restriktivare praxis än f.n. Eftersom ansökningsuppgifter f. n. inte förekommer i kreditupplysning som avser "personupplysningssubjekt" enligt gällande rätt. skulle de här avsedda undantagen gälla enbart de nytillkomna "personupplysningssubjekten” dvs. näringsidkare etc. Troligen kan undantagen formuleras så operativt att svårigheter inte uppstår. Under förutsättning att 7.5 kreditupplysnings- kungörelsen (19741326) ej ändras. innebär andra stycket att delegation sker till datainspektionen att utfärda undantagen i och med lagändringens ikraftträdande.

lnspektionen finner att undantag från förbudet mot ansökningsuppgifter torde komma att gälla i princip endast för företagare som faller under det nya personupplysningsbcgreppet för sådana fall där flera ansökningsuppgifter noterats inom en jämförelsevis kort tidsrymd. Följs inte denna ansöknings- anhopning av mer konkreta b