SOU 2012:46

Dammsäkerhet, Tydliga regler och effektiv tillsyn

Till statsrådet och chefen för Näringsdepartementet

Regeringen beslutade vid sitt sammanträde den 22 juni 2011 att tillkalla en särskild utredare med uppdrag att se över de statliga insatserna för dammsäkerhet. Den 29 juni 2011 förordnades hovrättsrådet Henrik Löv som särskild utredare för detta uppdrag.

Som experter i utredningen förordnades fr.o.m. den 8 september 2011 ämnesrådet Bengt Agartz, Näringsdepartementet, ämnessakkunnige Lars Andersson, Näringsdepartementet, teknologie licentiat Maria Bartsch, Svenska kraftnät, klimatexperten Sten Bergström, Sveriges meteorologiska och hydrologiska institut, dåvarande handläggaren Marcus Cato, Sveriges Kommuner och Landsting, utredaren Lars Ekberg, Myndigheten för Samhällsskydd och Beredskap, departementssekreteraren Keijo Ekelund, Försvarsdepartementet, departementssekreteraren Anna Josefsson, Miljödepartementet, civilingenjören Lars-Åke Lindahl, vid förordnandet SveMin, civilekonomen Eva Liljegren, Energimyndigheten, länsrådet Björn Sandborgh, Länsstyrelsen i Värmlands län och civilingenjören Gun Åhrling-Rundström, Svensk Energi. Eva Liljegren var förordnad till januari 2012.

Som sekreterare i utredningen anställdes fr.o.m. den 15 augusti 2011 civilingenjören Anna Engström Meyer och fr.o.m. den 22 augusti 2011 länsassessorn Kristina Dreijer.

Särskilt yttrande har lämnats av Maria Bartsch. Utredningen överlämnar härmed betänkandet. Uppdraget är härmed slutfört.

Stockholm i juni 2012

Henrik Löv

/Kristina Dreijer och Anna Engström Meyer

Förkortningar

DHB Dimensionerande hotbeskrivning DTU-manual Manual för drift, tillståndskontroll och underhåll Egenkontrollförordningen

Förordningen (1998:901) om verksamhetsutövares egenkontroll

FAPT Förordningen (1998:940) om avgifter för prövning och tillsyn enligt miljöbalken FDU Fördjupad dammsäkerhetsutvärdering FSO Förordningen (2003:789) om skydd mot olyckor GIS Geografiskt informationssystem GruvRIDAS Gruvindustrins riktlinjer för dammsäkerhet HaV Havs- och Vattenmyndigheten ICOLD International Commission on Large Dams - forum för att främja utbyte av kunskap och erfarenhet inom planering, projektering, byggande, skötsel och underhåll av höga dammar. LSO Lagen (2003:778) om skydd mot olyckor LSV Lagen (1998:812) med särskilda bestämmelser om vattenverksamhet MB Miljöbalken (1998:808) MSB Myndigheten för Samhällsskydd och Beredskap

Miljötillsynsförordningen

Miljötillsynsförordningen (2011:13)

NVE Norges Vassdrags- og Energidirektorat OSL Offentlighets- och sekretesslagen (2009:400) PBL Plan- och bygglagen (2010:900) Plan- och byggförordningen

Plan- och byggförordningen (2011:338)

RAKEL Radiokommunikation för effektiv ledning RF Regeringsformen RIDAS Kraftindustrins riktlinjer för dammsäkerhet Sevesolagen Lagen (1999:381) om åtgärder för att förebygga och begränsa följderna av allvarliga kemikalieolyckor Sevesoförordningen

Förordningen (1999:382) om åtgärder för att förebygga och begränsa följderna av allvarliga kemikalieolyckor

SKL Sveriges Kommuner och Landsting SMHI Sveriges Meteorologiska och Hydrologiska Institut STF Säkerhetstekniska driftsförutsättningar SVAR Svenska vattenarkiv SVC Svenskt vattenkraftcentrum SwedCOLD Swedish Committee on Large Dams - svenska nationalkommittén för höga dammar Utvinningsavfallsförordningen

Förordningen (2008:722) om utvinningsavfall

VAST Kraftindustrins stiftelse för tekniskt utvecklingsarbete VISS Vatteninformationssystem Sverige VL Vattenlag (1983:291)

VÄS Verksamhets- och ärendestruktur Århuskonventionen

FN/ECE:s (Förenta Nationernas ekonomiska Kommission för Europa) konventionen om tillgång till information, allmänhetens deltagande i beslutsprocesser och tillgång till överprövning i miljöfrågor

ÄVL Vattenlag (1918:523)

Sammanfattning

Utredningens direktiv

Utredningen ska lämna förslag till ett förtydligat regelverk för dammsäkerhet som komplement till de övergripande bestämmelser som finns i bl.a. miljöbalken. Regelverket ska stödja en utveckling av dammsäkerhetsarbetet hos dammägarna, en samordnad beredskap för dammbrott, samt en stärkt tillsyn av dammsäkerheten, särskilt avseende de dammar som i händelse av dammbrott förutom fara för många människors liv och hälsa, skulle kunna förorsaka allvarliga störningar i samhällsviktiga verksamheter. Utredaren ska bl.a.:

  • lämna förslag till utformning av ett obligatoriskt klassificeringssystem för alla dammanläggningar utifrån de konsekvenser som ett dammbrott skulle kunna orsaka,
  • lämna förslag till lagstiftning och andra åtgärder som krävs för att möjliggöra en strukturerad rapportering från dammägare till tillsynsmyndigheterna vars omfattning ska anpassas efter vilken kategori dammarna tillhör,
  • utreda om tillsynsvägledningen för dammsäkerhet och åtgärder för att främja dammsäkerheten i landet sker i tillräcklig omfattning och genom lämplig organisation eller om den bör inordnas i någon annan myndighets organisation.

Nuläge

I Sverige finns uppskattningsvis 10 000 dammar av varierande storlek och ålder. Av dessa utgör 190 vattenkraftdammar som man internationellt betecknar som höga dammar, dvs. de är högre än 15 m. Utöver de 190 höga vattenkraftdammarna finns det cirka 15 gruvdammar som är högre än 15 m. Dammarna är till stor del belägna i

reglerade vattendrag. De flesta byggdes under perioden 1940 – 1970 men det finns dammar som är äldre.

Ett dammbrott i en damm med stor indämd volym kan orsaka mycket stora konsekvenser. Människor kan omkomma och viktiga samhällsfunktioner såsom vägar, järnvägar, el-, tele-, vatten-, och avloppssystem kan slås ut eller allvarligt förstöras. Drygt 500 av dammarna i landet skulle medföra betydande konsekvenser för samhället och dammens omgivning vid ett dammbrott.

En vanlig dammbrottsorsak är överströmning av dammkrönet. Andra orsaker till dammbrott kan vara läckage eller otillräcklig stabilitet.

Det finns inte någon särskild lag om dammsäkerhet i Sverige. Dammsäkerheten regleras i flera regelverk där miljöbalken (MB) och lagen om skydd mot olyckor (LSO) är de mest centrala. Enligt dessa regelverk är verksamhetsutövaren skyldig att skaffa den kunskap som behövs, undersöka och bedöma riskerna med verksamheten från hälso- och miljösynpunkt, utarbeta och följa rutiner för egenkontroll samt i övrigt vidta erforderliga åtgärder och ha beredskap för att undvika skador. Regelverkens mer generella karaktär innebär dock att tillämpningen av bestämmelserna varierar.

Gruvdammar omfattas av bestämmelserna i förordningen (2008:722) om utvinningsavfall. Förordningen ställer redan i dag uttryckliga krav på verksamhetsutövaren att bl.a. upprätta ett säkerhetsledningssystem och en intern beredskapsplan.

Dammsäkerhet utgör en del av tillsynsområdet vattenverksamheter enligt MB för vilket länsstyrelsen är tillsynsmyndighet. Länsstyrelsernas tillsyn över dammsäkerhet har skett i begränsad omfattning, med ingen eller mycket liten tid till egeninitierad tillsyn.

Uppgiften att främja dammsäkerheten i landet, vilket även omfattar att vara tillsynsvägledande för länsstyrelserna, åvilar sedan år 1998 Svenska kraftnät.

Förslag om system för dammsäkerhetsklassificering

För samhället är det viktigt att ha kännedom om sådana objekt som kan utgöra en risk för omgivningen eller samhället i stort. Dammanläggningar kan vid ett haveri utgöra en sådan risk med stora konsekvenser för samhället som följd. För att identifiera dessa dammar har utredningen föreslagit att bestämmelser om ett

klassificeringssystem för dammar införs i MB. Som grund för klassificeringssystemet bör följande styrande principer gälla för dammar där dammbrott kan orsaka konsekvenser för samhället, dvs. mer än små lokala konsekvenser:

  • Sannolikheten för dammbrott ska hållas på lägsta rimliga nivå med hänsyn till föreliggande kunskaper och tillgänglig teknik.
  • Konsekvenserna av dammbrott ska så långt möjligt reduceras eller förhindras.

Beroende på de konsekvenser som ett dammbrott skulle kunna förorsaka ska principerna tillämpas olika. Utöver att utgöra grund för klassificeringssystemet utgör tillämpningen av principerna en grund för den differentiering av såväl dammägarens säkerhetsarbete och rapportering som den myndighetstillsyn som föreslås.

Klassificeringen ska utgå från en bedömning av ett dammbrotts sammanlagda konsekvenser. Med konsekvenser på omgivningen innefattas bl.a. förlust av människoliv, förstörelse av bostäder, kulturmiljö och byggnader, förstörelse av eller störningar på samhällsviktiga funktioner och infrastruktur såsom elförsörjningen, dammanläggningar, vatten- och avloppsanläggningar, broar, vägar, järnvägar, telekommunikation m.m., miljöskada och ekonomisk skada.

Systemet ska innehålla tre dammsäkerhetsklasser, A till C, där klass A är de dammar som bedöms ha störst konsekvenser vid ett dammbrott. Dammanläggningar där dammbrott inte bedöms ha mer än små lokala konsekvenser ges ingen dammsäkerhetsklass och några särskilda dammsäkerhetskrav ställs inte på dessa.

Vattenanläggningar som innehåller eller utestänger vatten, blandningar av vatten och annat material, t.ex. anrikningssand ska omfattas av det föreslagna klassificeringssystemet. Kraftverksdammar, regleringsdammar, gruvdammar, slussar och skyddsvallar utgör exempel på vad som ska omfattas av klassificeringssystemet. Såväl nya som befintliga anläggningar ska omfattas av klassificeringssystemet.

Dammägaren ska upprätta en konsekvensutredning med en redogörelse för bedömningen av sammanlagda konsekvenser i händelse av dammbrott. Utifrån utredningen ska ägaren lämna förslag till tillsynsmyndigheten om vilken klass dammen anses tillhöra. Tillsynsmyndigheten fattar därefter beslut om dammsäkerhetsklass. Beslutet ska endast kunna överklagas av ägaren.

Utredningen föreslår att klassificeringsprocessen bedrivs som ett särskilt projekt hos tillsynsmyndigheten under en period på tre år, där dammarna med störst vattenvolym som kan frisläppas vid

dammbrott klassificeras först. Svenska kraftnät ska enligt förslaget bemyndigas att meddela närmare föreskrifter avseende konsekvensutredningarnas innehåll.

Förslag om rutiner för egenkontroll och rapportering

För MB:s efterlevnad är en väl fungerande egenkontroll hos verksamhetsutövaren central. Tillsynsmyndigheten ska kontrollera efterlevnaden genom att följa upp att egenkontrollen är ändamålsenligt utformad och vid behov påtala brister i verksamheten. Utredningen föreslår att det för dammanläggningar med dammar i dammsäkerhetsklass A, B och C införs ett krav på att verksamhetsutövaren ska upprätta och arbeta efter ett säkerhetsledningssystem. Systemet ska bl.a. beskriva hur verksamhetens ansvarsområden är fördelade, allvarliga risker som kan leda till dammbrott, rutiner för drift, tillståndskontroll och underhåll, rutiner för hur ändringar hanteras, planering för nödsituationer och hur säkerhetsledningssystemet ska revideras. Förslaget omfattar även ett krav på att ägaren ska utföra en helhetsbedömning av respektive anläggnings säkerhet samt lämna en årlig dammsäkerhetsrapport till tillsynsmyndigheten. Underlåtenhet att ge in dammsäkerhetsrapporten inom angiven tid ska enligt förslaget vara förenat med en miljösanktionsavgift. Syftet med de preciserade kraven är att möjliggöra en bättre insyn i ägarnas dammsäkerhetsarbete för tillsynsmyndigheten men också att stärka ägarnas egenkontroll.

Gruvdammar omfattas som redan nämnts av utvinningsavfallsförordningen där vissa krav finns på verksamhetsutövarens säkerhetsarbete. För att undvika en dubbelreglering för gruvdammar ska en ägare till sådana gruvdammar som utgör en riskanläggning enligt förordningen endast genomföra en helhetsbedömning av anläggningens säkerhet med ett visst tidsintervall och årligen lämna en dammsäkerhetsrapport till tillsynsmyndigheten.

Svenska kraftnät föreslås att genom bemyndigande meddela föreskrifter om det närmare innehållet i säkerhetsledningssystemet samt innehåll i och frekvens av helhetsbedömningen och rapporteringen.

Förslag om dammsäkerhetstillsyn

Utredningen har bedömt att länsstyrelsernas dammsäkerhetstillsyn varit otillräcklig. Det har berott på länsstyrelsernas begränsade resurser för tillsyn av vattenverksamheter i allmänhet och dammsäkerhet i synnerhet. Den dammsäkerhetstillsyn som bedrivits har inte i tillräcklig utsträckning kunnat säkerställa att dammägarna i sin egenkontroll upptäcker och åtgärdar allvarliga svagheter och brister. Utredningen har därför bedömt att dammsäkerhetstillsynen behöver förstärkas med såväl resurser som kompetens.

Länsstyrelsen ska enligt utredningens förslag även fortsättningsvis vara tillsynsmyndighet för dammsäkerhet. I fråga om dammar omfattar länsstyrelsernas uppdrag vattenverksamhetstillsyn vari dammsäkerhetstillsyn ingår. Utöver det har länsstyrelsen ett omfattande ansvar för samordningen av beredskap inom länet. Myndigheten har goda förutsättningar för att samordna de olika ansvarområdena. Möjligheten att göra avvägningar mellan dessa ansvarsområden kan enligt utredningen lättare uppnås om dammsäkerhetstillsynen ligger kvar på länsstyrelsen.

I de län där det finns en damm i dammsäkerhetsklass A bör det enligt utredningens förslag finnas en dammsäkerhetshandläggare som uteslutande arbetar med dammsäkerhetstillsyn och andra ärenden som berör dammsäkerhet. Det kommer troligen att beröra Norrbottens län, Västerbottens län, Västernorrlands län, Jämtlands län, Dalarnas län, Värmlands län och Västra Götalands län. I dessa län finns utöver dammanläggningarna med dammar i dammsäkerhetsklass A även över 70 procent av dammanläggningarna med dammar i dammsäkerhetsklass B och C.

Även Länsstyrelsen i Gävleborgs län bör förstärkas med en dammsäkerhetshandläggare trots att det inom länet troligtvis inte finns någon damm i dammsäkerhetsklass A. Det finns dock många dammar i B och C inom länet. Gävleborgs län ligger i nedre delen av Ljusnan. Om även Länsstyrelsen i Gävleborgs län förstärks med en dammsäkerhetshandläggare kommer de tio stora kraftverksälvarna ligga i län vars länsstyrelser har en särskild dammsäkerhetskompetens. Det är en fördel för genomförande och uppföljning av samordnad beredskapsplanering för dammbrott som bedrivs älvsvis i de stora reglerade älvarna.

I övriga 13 län kan dammsäkerhetstillsynen över dammanläggningar med dammar i dammsäkerhetsklass B och C bedrivas av vattenhandläggare som även ansvarar för tillsynen över vattenverksamheten vid anläggningarna. Dessa länsstyrelser kan få råd

och stöd av dammsäkerhetshandläggarna på de åtta utpekade länsstyrelserna ovan eller på Svenska kraftnät.

Utredningen förslår att en särskild kod för dammsäkerhetstillsyn införs i länsstyrelsernas tidredovisningssystem. Om en sådan kod finns tillgänglig möjliggörs uppföljning och planering av dammsäkerhetstillsyn.

Utredningen föreslår att ett nätverk för dammsäkerhetshandläggare bildas där dammsäkerhetshandläggarna på länsstyrelserna i de åtta länen angivna ovan ingår tillsammans med dammsäkerhetshandläggarna på den centrala myndighetsfunktionen för dammsäkerhet på Svenska kraftnät. Nätverket ska engagera sig för utökad samverkan och utveckling av dammsäkerhetstillsynen. Ett handläggarnätverk möjliggör att likvärdiga tillsynsmetoder och bedömningar utarbetas vilket är förutsättningen för en effektiv och likvärdig tillsyn.

Det behövs sammanlagt sju–nio årsarbetskrafter för den löpande operativa dammsäkerhetstillsynen av dammanläggningar med dammar i dammsäkerhetsklass A, B och C i hela landet.

Tillsynen baseras lämpligen på den årliga dammsäkerhetsrapporteringen som utredningen föreslår. Pågående utvecklingsarbete inom ramen för Svenska kraftnäts regeringsuppdrag om tillsynsvägledning avseende dammar med särskilt stora konsekvenser i händelse av dammbrott ska enligt utredningen vara vägledande för den tillsyn som ska bedrivas för dessa dammar i framtiden.

För att säkerställa att tillsynen bedrivs likriktat, i tillräcklig omfattning samt följer regelverk och föreskrifter krävs uppföljning av den utförda tillsynen. Utredningen föreslår att länsstyrelserna ska upprätta årliga rapporter om dammsäkerhetstillsynen som genomförts. Rapporterna ska ges in till Svenska kraftnät.

Dammsäkerhetshandläggare behöver ha kompetens inom framförallt dammbyggnad och dammsäkerhetsarbete. Därutöver behöver en handläggare kompetens inom tillsynsmetodik och juridik.

Förslag om tillsynsvägledning och främjande av dammsäkerhet

Utredningen har bedömt att även tillsynsvägledningen avseende dammsäkerhet har varit otillräcklig. Tillgången till elberedskapsmedel har gjort att Svenska kraftnät kunnat göra goda insatser för dammsäkerheten i landet genom att stödja forsknings- och utvecklings-

projekt. Däremot har verket enligt utredningen inte satsat tillräckliga resurser på tillsynsvägledning.

Uppgiften att främja dammsäkerheten inkluderat den tillsynsvägledande rollen avseende dammsäkerhet ska enligt utredningen ligga kvar på Svenska kraftnät. Utredningen har inte kunnat finna några övervägande skäl att för närvarande föra över ansvaret för främjande och tillsynsvägledning av dammsäkerheten till annan myndighet.

En organisatoriskt sammanhållen enhet med ansvar för säkerhet och beredskap inom elområdet är gynnsam. Svenska kraftnät har som organisation möjlighet att ansvara för och fokusera på alla arbetsuppgifter som den centrala myndighetsfunktionen för dammsäkerhet bör driva. Det är enligt utredningen en förutsättning för god utveckling inom området. Möjligheterna att rekrytera personer med dammsäkerhetskompetens till Svenska kraftnät bedöms som goda.

Finansieringen med elberedskapsmedel är av stor betydelse för hur den centrala myndighetsfunktionen för dammsäkerhet har kommit att utvecklas. Det är också en förutsättning för att främjandet av dammsäkerheten i landet ska kunna fortsätta att utvecklas. Det är därför positivt för dammsäkerheten att frågorna hanteras i nära anslutning till elberedskapsmyndigheten på Svenska kraftnät.

Svenska kraftnät ska som central myndighetsfunktion för dammsäkerhet fortsätta utföra de tillsynsvägledande och främjande arbetsuppgifterna som Svenska kraftnät utför i dag i enlighet med verkets instruktion. Instruktionen för Svenska kraftnät ska justeras för att bl.a. förtydliga samverkan med länsstyrelser för att åstadkomma ett effektivt tillsynsarbete.

Utredningen föreslår att den centrala myndighetsfunktionen för dammsäkerhet på Svenska kraftnät ges i uppdrag att utreda formerna för samt utveckla och administrera en dammsäkerhetsdatabas med erforderliga uppgifter om dammarna som behövs för en god dammsäkerhetstillsyn. Dammsäkerhetsdatabasen bör i förlängningen innehålla alla dammar i landet där dammens dammsäkerhetsklass har fastställts. Utformningen av databasen bör medge att dammägaren själv ska kunna rapportera direkt in i databasen och också kunna se information om sina dammar. Den webbaserade databasen ska även utgöra underlag för länsstyrelsernas tillsyn. Länsstyrelsen ska ha möjlighet att se uppgifter om dammar i sina län och rapportera in genomförda tillsynsinsatser. Utredningen menar att en dammsäkerhetsdatabas är en förutsättning för en effektiv dammsäkerhetstillsyn eftersom den förenklar inrapporterings-

processen av årsrapporter, underlättar för länsstyrelserna att planera och följa upp tillsynsinsatser samt underlättar för Svenska kraftnät att följa upp inrapportering och genomförd tillsyn.

De utökade arbetsuppgifterna medför att den totala arbetsbördan för den centrala myndighetsfunktionen för dammsäkerhet på Svenska kraftnät bör uppgå till sex årsarbetskrafter.

Dammsäkerhetshandläggare på Svenska kraftnät behöver liksom motsvarande handläggare på länsstyrelsen ha kompetens inom dammbyggnad och dammsäkerhetsarbete. Därutöver behöver en handläggare kompetens inom tillsynsmetodik och juridik.

Finansiering av tillsyn och tillsynsvägledning

Utredningen föreslår att ägare av dammar i dammsäkerhetsklass A– C ska betala en årlig schablonavgift för tillsyn. Schablonavgiften ska utgöra en grundavgift för den dammsäkerhetstillsyn som länsstyrelsen ska utföra utifrån de krav som ställs i MB och som följer av utredningens förslag till förtydligat regelverk. Avgiftens storlek ska motsvara den dammsäkerhetstillsyn som utförs av länsstyrelsen. Det är därför viktigt att utförd tillsyn följs upp.

Utredningen föreslår att den årliga tillsynsavgiften ska uppgå till 96 000 kr för en damm i dammsäkerhetsklass A, 32 000 kr för en damm i dammsäkerhetsklass B och 6 400 kr för en damm i dammsäkerhetsklass C. Om tillsynsmyndigheten behöver vidta tillsynsåtgärder som ligger utanför det grundläggande tillsynsbehovet ska det finnas möjlighet att debitera en tilläggsavgift i form av timavgift. Har en dammanläggning mer än en damm bör jämkning av tillsynsavgiften göras.

Finansieringen av tillsynsvägledningen för dammsäkerhet ska ske genom ett eget anslag. Anslaget för tillsynsvägledning samt utveckling av metoder för tillsyn och egenkontroll inklusive personalkostnader bör uppgå till 10 miljoner kr.

Finansiering av främjande av dammsäkerhet ska även fortsättningsvis ske genom elberedskapsanslaget. Anslaget bör uppgå till 10–12 miljoner kr.

Innan berörda dammar klassificerats finns inget system för att avgränsa avgiftskollektivet. Det går därmed inte att börja ta ut tillsynsavgifter baserade på vilken klass dammen i fråga hänför sig till förrän ett klassificeringsbeslut har fattats. Utredningen föreslår därför att länsstyrelsen genomför klassificeringen inom ramen för

finansieringen av tillsynsvägledningen för dammsäkerhet. Det innebär att det årliga anslag för tillsynsvägledning om 10 miljoner kr som nämns ovan även ska finansiera länsstyrelsens arbete med klassificering. Under de tre år som klassificeringsprocessen enligt utredningens bedömning kommer att pågå, fördelar Svenska kraftnät ut medel till länsstyrelserna efter en fördelningsnyckel. Nyckeln bör baseras på antal dammanläggningar som ska konsekvensutredas i respektive län.

Beredskapsplanering för dammbrott

Beredskapsplanering för dammbrott bör enligt utredningen ske per vattendrag. Den samordnade beredskapsplanering som pågår eller planeras i samtliga större reglerade vattendrag bör därför enligt utredningen fullföljas. Av befintlig reglering framgår att länsstyrelsen ska samordna och utveckla beredskapsplaneringen för dammbrott inom länet. Länsstyrelsen är enligt utredningen en lämplig aktör att fortsätta ansvara för samordningen och att utveckla densamma i fråga om dammbrott.

Såväl kommuner som länsstyrelser ska planera sin räddningstjänst och krisorganisation på ett sådant sätt att effektiva räddningsinsatser vid dammbrott blir möjliga. Samtliga berörda aktörer ska som stöd för sin egen planering kommunicera med varandra. Ett lämpligt forum för det är älvgrupperna. Älvgruppernas betydelse bör därför understrykas. MSB i samverkan med Svenska kraftnät bör utforma vägledning och ta fram goda exempel i fråga om beredskap för dammbrott.

Anläggningens ägare eller den som utövar verksamhet på en anläggning där verksamheten har bedömts farlig enligt 2 kap. 4 § LSO ska analysera riskerna med verksamheten. Utifrån analysen ska ägaren eller verksamhetsutövaren föra en dialog med kommunen om hur kommunens beredskap kan kompletteras. System för varning av allmänheten är en lämplig och rimlig beredskapsåtgärd som skulle kunna bekostas av dammägaren. Även andra åtgärder kan dock komma ifråga.

För att kunna ställa krav på kompletterande beredskapsåtgärder krävs att anläggningen i fråga omfattas av 2 kap. 4 § LSO. Det är därför viktigt att länsstyrelserna fattar beslut om vid vilka dammar i länet som verksamheten ska anses vara farlig i den mening som denna paragraf anger. Dammanläggningar med dammar i klass A och B bör omfattas av bestämmelsen om farlig verksamhet.

Skydd, säkerhet och elberedskap

Energisektorn är sårbar och antagonistiska aktioner riktade mot den kan orsaka stor eller mycket stor effekt med små medel. Hotbilden är i dag inte statisk utan varierar med hänsyn till förändringar både innanför och utanför landets gränser. Säkerheten för elförsörjningen omfattar även dammar. Kravet i elberedskapslagen på verksamhetsutövares risk- och sårbarhetsanalyser avseende säkerheten i den egna verksamheten samt information om störningar i elförsörjningen innebär en möjlighet för staten att få en större inblick i hur säkerheten i elförsörjningen ser ut. Dammar bör särskilt beaktas i de föreskrifter som upprättas.

Utredningen bedömer att det finns ett behov av att klarlägga vilka dammanläggningar som bör utgöra skyddsobjekt enligt skyddslagen. En dammanläggning i utredningens föreslagna dammsäkerhetsklass A bör enligt utredningen vara ett skyddsobjekt.

Det föreligger även ett behov av att klarlägga vilka dammanläggningar som ska omfattas av kraven i säkerhetsskyddslagen. Utredningen menar att ett dammbrott i en dammanläggning med en damm i dammsäkerhetsklass A kan ha en sådan påverkan på rikets säkerhet och omgivningen i övrigt att ägarföretagen ska omfattas av säkerhetsskyddslagens krav i aktuella delar.

Utredningen anser att vägledning och goda exempel med avseende på fysiskt skydd av dammanläggningar bör tas fram av Svenska kraftnät i samråd med branschen. Utredningen anser dock att det inte är lämpligt att specificera det i föreskrifter.

Summary

The Inquiry’s terms of reference

The Inquiry is to present proposals for a clearer regulatory framework on dam safety to supplement the general provisions given in the Swedish Environmental Code and elsewhere. The regulatory framework is to support enhanced work on dam safety on the part of dam owners, coordinated emergency preparedness planning for dam failure, and augmented supervision of dam safety, particularly with respect to dams where a failure, apart from endangering the life and health of many people, could cause serious disruptions to vital public services.

Among other things, the Inquiry is to:

  • present proposals on the design of a mandatory classification system for all dam facilities, based on the potential consequences of a dam failure;
  • present proposals on legislation and other measures needed to enable dam owners to submit systematic reports to the supervisory authorities, the scope of which will be adapted according to the category to which the dams belong;
  • investigate whether the supervisory guidance for dam safety and measures to promote dam safety in Sweden is of sufficient scope and is appropriately organised or whether it should be brought under the organisation of some other government agency.

Current situation

There are an estimated 10 000 dams in Sweden, of varying size and age. Of these, 190 are hydropower dams classified internationally as large dams, which means they are more than 15 m high. Apart from the 190 large hydropower dams, about 15 tailings dams are more than 15 m high. The dams are largely located on regulated rivers. Most were built between 1940 and 1970, though some dams are older.

A dam failure in a dam holding a large dammed up volume can have very grave consequences. Lives may be lost and important public services such as roads, railways, electricity, telecommunications, water and waste water systems can be destroyed or seriously disrupted. In the case of more than 500 dams in Sweden, a dam failure would entail far-reaching consequences for society and the area surrounding the dam.

A common cause of dam failure is overtopping of the dam crest. Other causes include leakage or inadequate stability.

Sweden has no special law on dam safety. There are regulations on dam safety in several regulatory frameworks, the most central of which are the Environmental Code and the Civil Protection Act. Under these regulations, the operator is required to obtain the necessary knowledge, investigate and assess the risks involved in the operations from environmental and health perspectives, draw up and follow routines for self-regulation and otherwise take requisite measures and be prepared to prevent damage. However, because the regulatory frameworks are of a relatively general nature, the application of the provisions varies.

Tailings dams are covered by the provisions of the Extractive Waste Ordinance (2008:722). This Ordinance already makes the operator subject to explicit requirements, including establishing a safety management system and an internal emergency plan.

Dam safety is a part of the ‘water activities’ supervisory area in the Environmental Code, for which the county administrative board is the supervisory authority. The county administrative boards have exercised limited supervision of dam safety, with very little or no time for self-initiated supervision.

Since 1998, Svenska kraftnät (The Swedish National Grid) has been responsible for promoting dam safety in Sweden, which includes providing supervisory guidance to the county administrative boards.

Proposed system of dam safety classification

It is important for society to be aware of objects that may pose a risk to the surrounding area or society at large. In the event of a failure, dam facilities may pose such a risk, leading to major consequences for society. To identify these dams, the Inquiry has proposed the introduction into the Environmental Code of provisions on a classification system for dams. The classification system should be based on the following guiding principles regarding dams where dam failure could cause consequences for society, i.e. more than minor local consequences:

  • The probability of a dam failure shall be kept at the lowest reasonable level taking existing knowledge and available technology into account.
  • As far as possible, the consequences of a dam failure shall be reduced or prevented.

The principles are to be applied differently depending on the potential consequences of a dam failure. In addition to providing a basis for the classification system, the application of the principles will enable differentiation of both the dam owner’s safety measures and reporting routines, and the supervision by authorities that is proposed.

The classification will be based on an assessment of the combined consequences of a dam failure. Consequences for the surrounding community are taken to include loss of human lives, destruction of homes, cultural sites and buildings, destruction of or disruptions to vital public services and infrastructure, such as the electricity supply, dam facilities, water and waste water facilities, bridges, roads, railways, telecommunications, etc., and environmental and economic damage.

The system will comprise three dam safety classes, A to C, with class A consisting of the dams estimated to have the largest consequences in the event of a dam failure. Dam facilities where a dam failure is not estimated to have more than minor local consequences will not be classified and will not be subject to any special dam safety requirements.

Water installations that retain or keep out water, mixtures of water and other materials, e.g. tailings, will be covered by the proposed classification system. Hydropower dams, regulating dams, tailings dams, locks and levees are examples of structures that will

be covered by the classification system. The classification system will include both new and existing installations.

The dam owner will be required to produce a consequence study with an account of the assessment of the combined consequences in the event of a dam failure. Based on the study, the owner is to submit a proposal to the supervisory authority on the class to which the dam should be considered to belong. The supervisory authority will then take a decision on the dam safety class. Only the owner will be entitled to appeal against the decision.

The Inquiry proposes that the classification process be conducted as a special project at the supervisory authority over a period of three years, with the dams that have the largest volumes of water that could be released in the event of a dam failure being classified first. Under the proposal, Svenska kraftnät will be authorised to issue more detailed regulations concerning the contents of the consequence study.

Proposed routines for self-regulation and reporting

Effective self-regulation by the operator is vital to compliance with the Environmental Code. The supervisory authority is to monitor compliance by checking that the self-regulation is appropriately designed and calling attention to deficiencies in the operations, if necessary. The Inquiry proposes the introduction of a requirement for operators of dam facilities with dams in safety class A, B or C to establish and work in accordance with a safety management system. The system is to describe the division of operational responsibilities, serious risks that can lead to dam failure, operation, conditions monitoring and maintenance routines, routines for managing changes, planning for emergency situations and how the safety management system is to be revised. The proposal also includes a requirement that the owner conduct a safety review of the dam facility concerned and submit an annual dam safety report to the supervisory authority. Under the proposal, failure to submit the dam safety report within the specified time will entail an environmental sanction charge. The purpose of the more detailed requirements is to provide better transparency into the owners’ dam safety work for the supervisory authority, but also to strengthen owners’ self-regulation.

As already mentioned, tailings dams are regulated by the Extractive Waste Ordinance, which contains certain requirements concerning operators’ safety work. To avoid double regulation of tailings dams, an owner of tailings dams that constitute a hazardous activity under the Ordinance will only be required to carry out a safety review of the dam facility at certain intervals and to submit an annual dam safety report to the supervisory authority.

It is proposed that Svenska kraftnät be authorised to issue regulations on the more detailed contents of the safety management system and the contents and frequency of the safety review and reports.

Proposal on supervision of dam safety

The Inquiry has found that the supervision of dam safety exercised by the county administrative boards has been inadequate. This has been due to the limited resources available to the county administrative boards for supervision of water activities in general and dam safety in particular. The supervision of dam safety that has been exercised has been unable to adequately ensure that dam owners, through their self-regulation, discover and correct serious weaknesses and deficiencies. The Inquiry has therefore concluded that supervision of dam safety needs to be strengthened in terms of both resources and skills.

Under the Inquiry’s proposals, the county administrative board will continue to be the supervisory authority for dam safety. With regard to dams, the tasks of the county administrative boards include supervision of water activities, which includes supervision of dam safety. In addition to this, the county administrative board has a broad responsibility for coordinating emergency preparedness in the county. The board is in a good position to coordinate the various areas of responsibility. In the Inquiry’s opinion, there is a greater potential for trade-offs between these areas of responsibility if the supervision of dam safety remains the responsibility of the county administrative board.

Under the Inquiry’s proposals, counties where there is a dam in safety class A should have a dam safety officer working exclusively on dam safety supervision and other matters related to dam safety. This will probably concern the counties of Norrbotten, Västerbotten, Västernorrland, Jämtland, Dalarna, Värmland and Västra Götaland. In addition to the dam facilities with dams in safety class A, more

than 70 per cent of the dam facilities with dams in safety classes B and C are also located in these counties.

Even though there are probably no dams in safety class A in the county of Gävleborg, the county administrative board there should also be reinforced with a dam safety officer. There are many class B and C dams in the county. The county of Gävleborg lies on the lower reaches of the River Ljusnan. If the Gävleborg County Administrative Board is also reinforced with a dam safety officer, the ten large hydropower rivers will lie in counties whose county administrative boards possess special dam safety skills. This will be an advantage for the implementation and follow-up of coordinated emergency preparedness planning for dam failures that is conducted on a river-by-river basis in the major regulated rivers.

In the other 13 counties, the supervision of dam safety for dam facilities with class B and C dams can be conducted by water officers who are also responsible for supervising water activities at the facilities. These county administrative boards can receive advice and support from the dam safety officers at the eight designated county administrative boards or at Svenska kraftnät.

The Inquiry proposes that a special code for supervision of dam safety be introduced in the county administrative boards’ time reporting systems. The availability of such a code will facilitate the planning and monitoring of dam safety supervision.

The Inquiry proposes that a network of dam safety officers be established, consisting of the officers at the county administrative boards in the eight counties specified above and the officers at the central unit for dam safety at Svenska kraftnät. The network’s role will be to promote increased coordination and further development of dam safety supervision. A network of officers will make it possible to develop equivalent supervisory methods and assessments, which is a prerequisite for effective and equivalent supervision.

A total of seven to nine annual full-year equivalent positions are required for ongoing operational dam safety supervision of facilities with dams in safety classes A, B and C throughout the country.

It will be appropriate to base the supervision on the annual dam safety reports proposed by the Inquiry. The Inquiry proposes that in the future, the supervision of dams with particularly far-reaching consequences in the event of a failure should be guided by ongoing development work within the framework of Svenska kraftnät’s

government assignment to provide supervisory guidance concerning these dams.

To ensure that this supervision follows consistent lines, is sufficiently extensive and complies with regulatory frameworks and regulations, the supervision conducted must be followed up. The Inquiry proposes that the county administrative boards draw up annual reports on the supervision of dam safety that has been carried out. The reports will be submitted to Svenska kraftnät.

Dam safety officers need skills primarily in dam design and construction and dam safety management. In addition, an officer needs skills in supervision methods and law.

Proposals on supervisory guidance and promotion of dam safety

The Inquiry has also found that the supervisory guidance provided for dam safety has been inadequate. Access to electricity preparedness appropriations has enabled Svenska kraftnät to make positive contributions to dam safety in Sweden by supporting research and development projects. On the other hand, the Inquiry considers that the authority has devoted insufficient resources to supervisory guidance.

In the Inquiry’s view, Svenska kraftnät should retain responsibility for promoting dam safety, including the role of providing guidance on the supervision of dam safety. The Inquiry has not found any decisive grounds for transferring the responsibility for promoting dam safety and providing supervisory guidance to another authority at the present time.

A body organised as a cohesive entity responsible for safety and preparedness in the electricity area has distinct advantages. As an organisation, Svenska kraftnät can take responsibility for and focus on all the tasks that the central unit for dam safety ought to pursue. The Inquiry sees this as an essential condition for favourable developments in the area. Svenska kraftnät is considered likely to be able to recruit people with dam safety skills.

The financing provided from electricity preparedness appropriations has been highly significant for the development of the central unit for dam safety at Svenska kraftnät. It is also a prerequisite for the continued development of dam safety promotion. Consequently, it is positive for dam safety that the issues are handled in close association with the electricity preparedness authority at Svenska kraftnät.

As the central unit for dam safety, Svenska kraftnät should continue to carry out the tasks of supervisory guidance and promotion that it currently performs in accordance with its instructions. The instructions for Svenska kraftnät should be adjusted to clarify coordination with county administrative boards to achieve effective supervision.

The Inquiry proposes that the central unit for dam safety at Svenska kraftnät be tasked with examining the conditions for a dam safety database containing the information about dams needed for good supervision of dam safety, and with developing and administering such a database. In time, the dam safety database should contain all dams in Sweden for which a dam safety class has been determined. The database should be designed so as to allow the dam owners themselves to report directly in the database and view information about their dams. The internet-based database should also furnish material for the supervision exercised by the county administrative boards. Each county administrative board should be able to view information about the dams in its county and to report supervisory measures carried out. The Inquiry is of the opinion that a dam safety database is a prerequisite for effective dam safety supervision, since it simplifies the submission process for annual reports, makes it easier for county administrative boards to plan and follow up supervisory measures and makes it easier for Svenska kraftnät to monitor reports submitted and supervision conducted.

In view of the increased duties, the total workload for the central unit for dam safety at Svenska kraftnät should amount to six annual full-year equivalents.

Like equivalent officers at the county administrative boards, dam safety officers at Svenska kraftnät need skills in dam design and construction and dam safety management. In addition, officers need skills in supervision methods and law.

Financing of supervision and supervisory guidance

The Inquiry proposes that owners of dams in safety classes A–C should pay a standard annual fee for supervision. The standard fee will constitute a basic fee for the supervision of dam safety that the county administrative board is required to conduct on the basis of the requirements of the Environmental Code and the clarified regulations proposed by the Inquiry. The size of the fee will corre-

spond to the supervision of dam safety conducted by the county administrative board. This makes it important to monitor the supervision carried out.

The Inquiry proposes that the annual supervision fee be set at SEK 96 000 for a dam in safety class A, SEK 32 000 for a dam in safety class B and SEK 6 400 for a dam in safety class C. If the supervisory authority needs to take supervisory measures beyond the basic necessary supervision, the possibility should be allowed of charging an additional fee at an hourly rate. If a dam facility has more than one dam the supervision fee should be adjusted.

The supervisory guidance for dam safety should be financed by a separate appropriation. The appropriation for supervisory guidance and development of methods for supervision and self-regulation should amount to SEK 10 million.

The promotion of dam safety should continue to be financed out of the appropriation for electricity preparedness. This appropriation should amount to SEK 10–12 million.

Until the dams concerned have been classified, there will be no system for defining the fee-paying group. Consequently, it is impossible to begin charging supervision fees based on the class to which the dam concerned belongs before a decision on classification has been taken. The Inquiry therefore proposes that the county administrative boards conduct the classification within the framework of the budget for supervisory guidance for dam safety. This means that the above-mentioned annual appropriation of SEK 10 million for supervisory guidance will also be required to pay for the work of the county administrative boards on classification. During the three years that the Inquiry estimates the classification process will take, Svenska kraftnät will distribute funds to the county administrative boards in accordance with a distribution key. The key should be based on the number of dam facilities for which consequence studies are required in each county.

Emergency preparedness planning for dam failures

In the Inquiry’s opinion, emergency preparedness planning for dam failures should be conducted on a river-by-river basis. The Inquiry therefore finds that the coordinated emergency preparedness planning that is in progress or is planned for all major regulated rivers should be completed. Current regulations make it clear that the county administrative board is responsible for coordinating and

developing emergency preparedness planning for dam failures in the county. The Inquiry considers that the county administrative board is an appropriate actor to take continued responsibility for such coordination and its further development with regard to dam failures.

Both municipalities and county administrative boards are required to plan their rescue services and emergency organisation to enable effective rescue operations in the event of a dam failure. For the sake of their own planning, all actors concerned are to communicate with one another. The river groups are a suitable forum for this and their importance should therefore be underlined. The Swedish Civil Contingencies Agency, in coordination with Svenska kraftnät, should develop guidance and highlight best practice concerning preparedness for dam failures.

The owner or operator of a facility where operations have been assessed as hazardous under Chapter 2, Section 4 of the Civil Protection Act is required to analyse the risks involved in the operations. Based on this analysis, the owner or operator is to hold a dialogue with the municipality on how the municipality’s emergency preparedness can be supplemented. A system for public warning is an appropriate and reasonable preparedness measure that could be paid for by the dam owner. However, other measures may also be appropriate.

In order to require supplementary emergency preparedness measures, the facility concerned must come under Chapter 2, Section 4 of the Civil Protection Act. It is therefore important that the county administrative boards decide at which dams in their county operations are to be considered hazardous within the meaning of this Section. Dam facilities with class A and B dams should come under the provision on hazardous activities.

Protection, security and electricity preparedness

The energy sector is vulnerable and antagonistic actions towards it can cause a great or very great impact with limited means. The current threat picture is not static; it varies in view of changes inside and outside Sweden’s borders. The security of the electric power supply includes dams. The requirement of the Electricity Preparedness Act that operators conduct risk and vulnerability analyses concerning the security of their own operations and provide

information about disruptions to the electric power supply provides an opportunity for the state to obtain greater insight into the security of the electric power supply. Particular attention should be paid to dams in the regulations that are established.

The Inquiry considers that there is a need to identify which dam facilities should be protected objects under the Protection Act. In the opinion of the Inquiry, a dam facility in the proposed dam safety class A should be a protected object.

There is also a need to clarify which dam facilities should come under the requirements of the Protective Security Act. In the Inquiry’s opinion, a dam failure in a facility with a dam in safety class A could have such an impact on national security and on the surrounding area generally that the company that owns the facility should come under the relevant requirements of the Protective Security Act.

The Inquiry considers that guidance and best practice on the design of security protection for dams should be made available by Svenska kraftnät in consultation with the industry. The Inquiry does, however, not consider it appropriate to specify it in regulations.

Författningsförslag

1. Förslag till lag om ändring i miljöbalken

Härigenom föreskrivs i fråga om miljöbalken

dels att 11 kap. 4 § ska upphöra att gälla,

dels att 11 kap. 2 och 3 §§ ska betecknas 11 kap. 3 och 4 §§,

dels att de nya 11 kap. 3 och 4 §§ samt 11 kap. 5 och 18 §§ ska ha följande lydelse,

dels att det i balken ska införas fem nya paragrafer, 11 kap. 2 och 24–26 §§ och 26 kap. 20 a §, samt närmast före 11 kap. 24 § en ny rubrik av följande lydelse.

Nuvarande lydelse Föreslagen lydelse

11 kap.

2 §

I detta kapitel avses med vattenområde: ett område som täcks av vatten vid högsta förutsebara vattenstånd, och

markavvattning: en åtgärd som vidtas för att avvattna mark, när det inte är fråga om avledande av avloppsvatten, eller som utförs för att sänka eller tappa ur ett vattenområde eller för att skydda mot vatten, när syftet med åtgärden är att varaktigt öka en fastighets lämplighet för något visst ändamål.

2 § Med vattenverksamhet avses

1. uppförande, ändring, lagning och utrivning av dammar eller andra anläggningar i vattenområden, fyllning och pålning i vattenområden, bortledande av vatten från eller grävning, sprängning och rensning i vattenområden samt andra åtgärder i vattenområden om åtgärden syftar till att förändra vattnets djup eller läge,

2. bortledande av grundvatten och utförande av anläggningar för detta,

3. tillförsel av vatten för att öka grundvattenmängden samt utförande av anläggningar och åtgärder för detta, och

4. åtgärder som utförs för att avvattna mark, när det inte är fråga om avledande av avloppsvatten, eller som utförs för att sänka eller tappa ur ett vattenområde eller för att skydda mot vatten, när syftet med åtgärden är att varaktigt öka en fastighets lämplighet för något visst ändamål (markavvattning).

3 §

Med vattenverksamhet avses i detta kapitel

1. uppförande, ändring, lagning eller utrivning av en damm eller annan anläggning i ett vattenområde,

2. fyllning eller pålning i ett vattenområde,

3. bortledande av vatten från ett vattenområde,

4. grävning, sprängning eller rensning i ett vattenområde,

5. vidtagande av en annan åtgärd i ett vattenområde som syftar till att förändra vattnets djup eller läge,

6. bortledande av grundvatten eller utförande av en anläggning för detta,

7. tillförsel av vatten för att öka grundvattenmängden eller utförande av en anläggning eller vidtagande av en åtgärd för detta, eller

8. markavvattning.

3 §

Med vattenanläggning avses en sådan anläggning som har kommit till genom en vattenverksamhet, tillsammans med manöveranordningar som hör till anläggningen.

4 § I detta kapitel avses med vattenanläggning: en anläggning som har kommit till genom en vattenverksamhet tillsammans med manöveranordningar som hör till en sådan anläggning,

damm: en vattenanläggning vars syfte är att innehålla eller utestänga vatten eller blandningar av vatten och annat material,

dammhaveri: ett genombrott av dammen som leder till ett okontrollerat utströmmande av det vatten eller blandning av vatten och annat material som dammen är avsedd att innehålla eller utestänga, och

dammsäkerhet: dammens egenskaper och de åtgärder som vid drift och underhåll av dammen vidtas för att förhindra ett dammhaveri och för att begränsa skador till följd av ett sådant haveri.

5 §

Med vattentäkt avses bortledande av yt- eller grundvatten för vattenförsörjning, värmeutvinning eller bevattning.

Med vattenreglering avses ändring av vattenföringen i ett vattendrag till förmån för annan vattenverksamhet.

Med vattenöverledning avses vattenreglering genom överföring av ytvatten från ett vattenområde till ett annat.

I detta kapitel avses med vattentäkt: bortledande av yt eller grundvatten för vattenförsörjning, värmeutvinning eller bevattning,

vattenreglering: ändring av vattenföringen i ett vattendrag till förmån för annan vattenverksamhet, och

vattenöverledning: vattenreglering genom överföring av ytvatten från ett vattenområde till ett annat.

18 §

Den som är skyldig att underhålla en dammanläggning för vattenreglering skall ersätta skada som orsakas av att anläggningen inte ger avsett skydd mot utströmmande vatten (dammhaveri). Detta gäller även om varken den underhållsskyldige eller någon som den underhållsskyldige svarar för har vållat skadan.

Den som är skyldig att underhålla en damm för vattenreglering ska ersätta skada som orsakas av att anläggningen inte ger avsett skydd mot utströmmande vatten. Detta gäller även om varken den underhållsskyldige eller någon som den underhållsskyldige svarar för har vållat skadan.

En underhållsskyldig som visar att dammhaveriet orsakats av en krigshandling eller liknande handling under väpnad konflikt, inbördeskrig eller uppror är dock fri från ansvar.

Dammsäkerhet

24 §

En damm ska vara klassificerad i en dammsäkerhetsklass, om dammen vid ett dammhaveri kan medföra

1. förlust av människoliv,

2. förstörelse av kulturmiljö eller byggnader,

3. störning i elförsörjning,

4. förstörelse av infrastruktur,

5. förstörelse av eller störning i samhällsviktig verksamhet,

6. miljöskada, eller

7. ekonomisk skada. Första stycket 2–7 gäller inte konsekvenser som har liten bety-

delse från samhällelig synpunkt.

25 §

Vid klassificering enligt 24 § ska dammen vara klassificerad i

1. dammsäkerhetsklass A, om ett dammhaveri skulle kunna leda

till en kris som drabbar många människor och stora delar av samhället samt hota grundläggande värden och funktioner,

2. dammsäkerhetsklass B, om ett dammhaveri skulle kunna leda till långvariga störningar eller stora regionala konsekvenser och dammen inte ska vara klassificerad i dammsäkerhetsklass A, och

3. dammsäkerhetsklass C, om dammen inte ska vara klassificerad i dammsäkerhetsklass A eller B.

Första stycket gäller inte dammar som har uppförts för att tillfälligt torrlägga ett område i samband med ett bygg- eller anläggningsarbete.

26 §

Klassificeringen enligt 24 och 25 §§ ska göras av den myndighet som utövar tillsyn över dammens säkerhet.

Ett beslut om dammsäkerhetsklass får endast överklagas av den som är skyldig att underhålla dammen.

26 kap.

20 a §

Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om att den som är skyldig att underhålla en damm som avses i 11 kap. ska

1. se till att det alltid finns en dokumenterad aktuell utredning och bedömning av vilka konse-

kvenser som ett dammhaveri vid dammen kan medföra,

2. lämna dokumentationen till tillsynsmyndigheten tillsammans med ett förslag till klassificering enligt 11 kap. 24 och 25 §§, och

3. rapportera avseende dammsäkerhet till den myndighet som utövar tillsyn över dammens säkerhet.

1. Denna lag träder i kraft den 1 juli 2013.

2. I fråga om en damm som vid ikraftträdandet inte är klassificerade i någon dammsäkerhetsklass ska 24 och 25 §§ tillämpas

a) från och med den 1 juli 2014, om ett dammhaveri skulle innebära att det vid haveritidpunkten okontrollerat strömmar ut mer än 5 miljoner kubikmeter vatten eller blandning av vatten och annat material,

b) från och med den 1 juli 2015, om ett dammhaveri skulle innebära att det vid haveritidpunkten okontrollerat strömmar ut mer än 500 000 kubikmeter men inte mer än 5 miljoner kubikmeter vatten eller blandning av vatten och annat material, och

c) från och med den 1 juli 2016, om ett dammhaveri skulle innebära att det vid haveritidpunkten okontrollerat inte strömmar ut mer än 500 000 kubikmeter vatten eller blandning av vatten och annat material.

2. Förslag till förordning om ändring i förordningen (1998:940) om avgifter för prövning och tillsyn enligt miljöbalken

Härigenom föreskrivs att det i förordningen (1998:940) om avgifter för prövning och tillsyn enligt miljöbalken ska införas en ny paragraf, 3 kap. 11 a §, av följande lydelse.

3 kap.

11 a §

Avgift för länsstyrelsens tillsyn över dammsäkerhet ska betalas av den som är skyldig att underhålla en damm som är klassificerad enligt 11 kap. 24 och 25 §§ miljöbalken . Avgiften ska betalas årligen

1. med 96 000 kronor, om dammen är klassificerad i dammsäkerhetsklass A,

2. med 32 000 kronor, om dammen är klassificerad i dammsäkerhetsklass B, och

3. med 6 400 kronor, om dammen är klassificerad i dammsäkerhetsklass C.

Denna förordning träder i kraft den 1 juli 2013.

3. Förslag till förordning om ändring i förordningen (2007:1119) med instruktion för Affärsverket svenska kraftnät

Härigenom föreskrivs att 5 och 14 §§ förordningen (2007:1119) med instruktion för Affärsverket svenska kraftnät ska ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

5 §

Svenska kraftnät ska i fråga om dammsäkerhet

1. följa klimatförändringarnas påverkan samt följa och medverka i utvecklingen i landet,

2. verka för att möjligheterna att minska skador till följd av höga flöden utvecklas och tas till vara,

3. regelbundet rapportera till regeringen om utvecklingen och vid behov föreslå åtgärder,

4. uppmärksamma behovet av forskning,

1. svara för tillsynsvägledning enligt miljötillsynsförordningen (2011:13) och samverka med länsstyrelserna för att åstadkomma ett effektivt tillsynsarbete,

2. identifiera behov, stödja och medverka i kunskapsutveckling och kompetensförsörjning,

3. följa klimatförändringarnas påverkan samt följa och medverka i utvecklingen i landet,

4. verka för att riskerna för en allvarlig störning på samhället genom dammhaveri eller höga flöden i reglerade vattendrag minskar,

5. vid behov samråda med berörda myndigheter och organisationer, och

6. regelbundet rapportera till regeringen om utvecklingen och vid behov föreslå åtgärder.

5. svara för tillsynsvägledning enligt miljötillsynsförordningen (2011:13), och

6. vid behov samråda med berörda myndigheter och organisationer.

14 §

Vid Svenska kraftnät ska det finnas ett råd som ska biträda affärsverket i arbetet med dammsäkerhetsfrågor (Dammsäkerhetsrådet).

Vid Svenska kraftnät ska det finnas ett råd som ska biträda affärsverket i arbetet med dammsäkerhetsfrågor (Dammsäkerhetsrådet). Rådet är ett informations- och samrådsorgan för frågor relaterade till dammsäkerhet.

Denna förordning träder i kraft den 1 juli 2013.

4. Förslag till förordning om ändring i förordningen om miljötillsynsförordning (2011:13)

Härigenom föreskrivs att 3 kap. 3 § miljötillsynsförordningen (2011:13) ska ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

3 kap.

3 §

Affärsverket svenska kraftnät ska ge tillsynsvägledning i frågor om dammsäkerhet enligt 11 kap. miljöbalken.

Affärsverket svenska kraftnät ska ge tillsynsvägledning i frågor om dammsäkerhet.

Denna förordning träder i kraft den 1 juli 2013.

5. Förslag till förordning om ändring i förordningen (2012:259) om miljösanktionsavgifter

Härigenom förskrivs att det i förordningen (2012:259) om miljösanktionsavgifter ska införas en ny paragraf, 12 kap. 6 §, samt närmast före 12 kap. 6 § en ny rubrik av följande lydelse.

Nuvarande lydelse Föreslagen lydelse

12 kap.

Svenska kraftnäts föreskrifter om dammsäkerhetsrapporter

6 § För en överträdelse av 0 § Svenska kraftnäts föreskrifter (SvKFS 0000:0) om dammsäkerhetsrapporter genom att inte i rätt tid ge in föreskriven dammsäkerhetsrapport till tillsynsmyndigheten ska en miljösanktionsavgift betalas

1. med 2 000 kronor, om dammen är klassificerad i dammsäkerhetsklass A, och

2. med 1 000 kronor, om dammen är klassificerad i dammsäkerhetsklass B eller C

Denna förordning träder i kraft den 1 juli 2013.

6. Förslag till dammsäkerhetsförordning (0000:00)

Härigenom föreskrivs följande

Inledande bestämmelser

1§ Denna förordning gäller dammar som ska vara klassificerade enligt 11 kap.24 och 25 §§miljöbalken.

Förordningen är meddelad

1. med stöd av 26 kap. 19 § miljöbalken i fråga om 6, 7, 8 §§ och 10 § 2 och 3,

3. med stöd av 26 kap. 20 a § miljöbalken i fråga om 3, 4, 5 och 9 §§ och 10 § 1 och 4, och

4. i övrigt med stöd av 8 kap. 7 § regeringsformen.

Definitioner

2 § I denna förordning avses med allvarlig miljöskada: en allvarlig miljöskada enligt 10 kap. 1 § miljöbalken, och dammhaveri: dammhaveri enligt 11 kap. 4 § miljöbalken.

Konsekvensutredning

3 § Den som är skyldig att underhålla en damm ska se till att det alltid finns en dokumenterad aktuell utredning och bedömning av vilka konsekvenser som ett dammhaveri kan medföra (konsekvensutredning).

En konsekvensutredning ska beskriva

1. hur ett dammhaveri antas ske,

2. vilka områden som kan översvämmas vid ett dammhaveri,

3. vad som kan skadas i de områden som skulle översvämmas.

4 § Skyldigheten att utföra en konsekvensutredning omfattar inte den som är skyldig att underhålla en damm om ett dammhaveri vid dammen skulle kunna

1. innebära att det vid haveritidpunkten okontrollerat strömmar ut mindre än 10 000 kubikmeter vatten eller blandning av vatten och annat material, eller

2. innebära att det vid haveritidpunkten okontrollerat strömmar ut 10 000 kubikmeter eller mer men mindre än 50 000 kubikmeter vatten eller blandning av vatten och annat material och där sådana konsekvenser som anges i 11 kap. 24 första stycket 1–7 miljöbalken inte kan uppkomma.

5 § Den som är skyldig att underhålla en damm som omfattas av kravet enligt 3 § ska lämna konsekvensutredningen till tillsynsmyndigheten tillsammans med ett förslag till klassificering enligt 11 kap.24 och 25 §§miljöbalken.

Säkerhetsledningssystem och rutiner för egenkontroll

6 § Den som är skyldig att underhålla en damm ska för verksamheten upprätta och arbeta efter ett säkerhetsledningssystem. Säkerhetsledningssystemet ska omfatta de metoder, rutiner och instruktioner som behöver fastställas och tillämpas i fråga om

1. organisation och definierade uppgifter, ansvarsområden och kompetenskrav för den personal som deltar i arbetet med dammsäkerhet,

2. identifiering och bedömning av allvarliga risker,

3. drift, tillståndskontroll och underhåll,

4. hantering av förändringar,

5. planering för nödsituationer, och

6. revision och översyn. Den som är skyldig att underhålla en damm ska upprätta ett dokument som översiktligt beskriver säkerhetsledningssystemet. Beskrivningen ska även innehålla de övergripande målen och handlingsprinciperna för verksamhetens arbete med säkerhet.

7 § Bestämmelsen i 6 § omfattar inte den som är underhållsskyldig för dammar som utgör en riskanläggning enligt 5 § förordningen (2008:722)om utvinningsavfall.

8 § Den som är skyldig att underhålla en damm ska vart tionde år utföra en helhetsbedömning av dammens säkerhet. Bedömningen ska även avse verksamhetens organisation. Resultatet av bedömningen ska dokumenteras.

Dammsäkerhetsrapport

9 § Den som är skyldig att underhålla en damm ska årligen till tillsynsmyndigheten lämna en rapport om dammens egenskaper och de åtgärder som vid drift och underhåll av dammen vidtas för att förhindra ett dammhaveri och för att begränsa skador till följd av ett sådant haveri.

Bemyndigande för Affärsverket svenska kraftnät

10 § Affärsverket svenska kraftnät får meddela föreskrifter om innehållet i samt omfattningen och dokumentationen av

1. konsekvensutredningen enligt 3 §,

2. säkerhetsledningssystemet enligt 6 §,

3. helhetsbedömningen enligt 7 §, och

4. rapporten enligt 8 §.

Överklagande

11 § Bestämmelser om överklagande finns i 19 kap. 1 § miljöbalken och 5 kap. 5 § lag (2010:921) om mark- och miljödomstolar.

1. Denna förordning träder i kraft den 1 juli 2013.

2. I fråga om en damm där den som är skyldig att underhålla dammen vid ikraftträdandet inte har lämnat konsekvensutredningen tillsammans med ett förslag om dammsäkerhetsklass ska 3 och 5 §§ tillämpas

a) från och med den 31 december 2013, om ett dammhaveri skulle innebära att det vid haveritidpunkten okontrollerat strömmar ut mer än 5 miljoner kubikmeter vatten eller blandning av vatten och annat material,

b) från och med den 31 december 2014, om ett dammhaveri skulle innebära att det vid haveritidpunkten okontrollerat strömmar ut mer än 500 000 kubikmeter men inte mer än 5 miljoner kubikmeter vatten eller blandning av vatten och annat material, och

c) från och med den 31 december 2015, om ett dammhaveri skulle innebära att det vid haveritidpunkten okontrollerat inte strömmar ut mer än 500 000 kubikmeter vatten eller blandning av vatten och annat material.

1. Utredningens uppdrag och arbete

1.1. Uppdraget

Utredningens uppdrag beskrivs i sin helhet i direktiv 2011:57, se bilaga 1.

Utredaren ska lämna förslag till ett förtydligat regelverk för dammsäkerhet som komplement till miljöbalkens övergripande bestämmelser samt övriga författningar som reglerar dammsäkerhetsfrågor. Förslaget ska bl.a. avse en utformning av ett obligatoriskt klassificeringssystem för alla dammanläggningar utifrån de konsekvenser som ett dammbrott skulle kunna orsaka. Utredningsuppdraget avser även att lämna förslag till preciserade krav på verksamhetsutövarnas strategi och ledningssystem för dammsäkerhet och dokumenterade rutiner för egenkontroll. Därutöver ska utredaren lämna förslag till lagstiftning och andra åtgärder som krävs för att möjliggöra en strukturerad rapportering från dammägare till tillsynsmyndigheterna.

Utifrån de krav på dammsäkerhet som samhället bör ställa ska utredaren utreda om tillsyn samt tillsynsvägledningen för dammsäkerhet och åtgärder för att främja dammsäkerheten i landet sker i tillräcklig omfattning. Utredningen ska även avse om tillsynsvägledningen och övriga uppgifter inom Svenska kraftnäts samlade uppdrag att främja dammsäkerheten i landet bedrivs genom lämplig organisation eller om den bör inordnas i någon annan myndighets organisation i syfte att stärka dammsäkerhetsutvecklingen, effektiviteten och eventuellt renodla Svenska kraftnäts uppgifter till sådana som avser deras kärnverksamhet att driva stamnätet för el och vara systemansvarig för elförsörjningen.

Utredaren ska vidare utreda hur ansvarsfördelningen mellan den tillsynsvägledande myndigheten och tillsynsmyndigheten lämpligen bör ordnas vad gäller tillsynen av dammar med särskilt stora

konsekvenser i händelse av dammbrott. Förslag till finansiering av myndighetsuppgifterna ska lämnas, t.ex. genom avgiftsfinansiering, samt resursbehovet bedömas. Om utredaren bedömer det lämpligt ska förslag lämnas om en överföring av tillsyn, tillsynsvägledningen och relaterade främjandeuppgifter avseende dammsäkerhet till en annan myndighet.

Av direktivet framgår även att utredaren ska klarlägga vem som bör leda utvecklingen av samordnad beredskap för dammbrott och hur dammägare ska komplettera kommuners beredskap för att möjliggöra effektiva räddningsinsatser.

Vidare ska utredaren klargöra om och i sådant fall hur skyddslagen (2010:305) och sekretesslagstiftningen kan tillämpas för dammar som kan orsaka stora konsekvenser vid händelse av dammbrott samt samspelet med övrig relaterad lagstiftning i syfte att stärka säkerheten i elförsörjningen.

1.2. Så har vi arbetat

Utredningen genomfördes under hösten 2011 och våren 2012. Under utredningens gång har sammanlagt sex expertmöten hållits med de tolv experter som utsetts. Utöver expertmöten har den särskilda utredaren och sekreterarna träffat vissa experter särskilt för diskussion avseende enskilda sakfrågor.

Utredningen har även träffat olika aktörer för att få deras syn på behovet och utformningen av ett förtydligat regelverk samt tänkbara förändringar av myndighetsorganisationen. Utredningen har besökt Länsstyrelserna i Norrbottens, Västerbottens, Dalarnas och Kronobergs län. Dessutom har utredningen haft ett möte med företrädare för Jämtlands Räddningstjänstförbund. Därutöver har utredningen besökt följande centrala myndigheter: Svenska kraftnät, Myndigheten för Samhällsskydd och Beredskap, Havs- och Vattenmyndigheten, Strålsäkerhetsmyndigheten, och Kammarkollegiet.

Under hösten 2011 ordnade Svenska kraftnät en work-shop om stärkt dammsäkerhet – utvecklad tillsynsvägledning, tillsyn och beredskap i vilken utredningen deltog. Utöver representanter från Svenska kraftnät deltog även företrädare för flera länsstyrelser, Myndigheten för Samhällsskydd och Beredskap, Svensk Energi och de större kraftverksbolagen.

I enlighet med kommittédirektivet har samråd skett med Säkerhetspolisen avseende utredningens förslag till utformning av klassificeringssystem och eventuella förslag till säkerhetsskyddsåtgärder till skydd mot terrorism.

Svensk Energi bjöd in utredningen till en work-shop med representanter för kraftverksbolagen. Utredningen har också haft möten med Svensk Energis dammsäkerhetskommitté där de större kraftverksbolagen är representerade. Utredningen har även kontaktats av Vattenfall och Fortum som vid olika tillfällen redogjort för företagens dammsäkerhetsarbete och deras syn på ett framtida regelverk för dammsäkerhet. Tillsammans med utredaren och sekretariatet besökte experterna Höljes kraftverk som ägs av Fortum.

Utredningen har även besökt Norges vassdrags- og energidirektorat (NVE) i Oslo som utgör Norges dammsäkerhetsmyndighet. Genom sin expertgrupp har utredningen haft god insyn i internationella förhållanden på dammsäkerhetsområdet.

Utredningen har samrått med Utredningen om statlig regional förvaltning och Utredningen om miljöbestämmelser för jordbruksföretag och djurhållning.

I enlighet med kommittédirektivet har utredningen samrått med Näringslivets regelnämnd angående förslagens konsekvenser för företag. Beträffande redovisning av förslagens konsekvenser har samråd också skett med Regelrådet.

1.3. Avgränsningar

Av direktivet framgår att utredaren med utgångspunkt i Svenska kraftnäts översyn av de statliga insatserna för dammsäkerhet (dnr N2010/4863/E) ska lämna förslag till ett förtydligat regelverk för dammsäkerhet. Utredningen har emellertid inte sett sig bunden av de förslag som lämnas i översynsrapporten utan förutsättningslöst utrett frågorna i enlighet med sitt uppdrag.

Utredningen har att utreda frågor om dammsäkerhet. Dammsäkerhet är definierat i direktivet på ett sådant sätt att utredningens arbete är avgränsat till säkerhet med avseende på dammbrott. Allmänhetens säkerhet vid dammar och längs med vattendrag under normala driftförhållanden är också en säkerhetsfråga men omfattats inte av utredningens uppdrag. Dessa säkerhetsfrågor har därför inte behandlats i betänkandet.

Ansvarsgenombrott vid ett dammhaveri omfattas inte heller av utredningens uppdrag enligt direktivet. Utredningen har trots det mycket kortfattat behandlat problematiken och redogjort för tidigare utredningars slutsatser i frågan, se avsnitt 3.3.4.

1.4. Tidigare utredningar

Frågor om dammsäkerhet och översvämningar har varit ämnen för två tidigare utredningar, SOU 1987:641 och SOU 1995:402, som i avsnitt 2.6 redovisas ytterligare.

Såsom framgår av utredningens direktiv och som utvecklas i avsnitt 2.6 har dammsäkerheten under senare år behandlats av Riksrevisionen3, Klimat- och Sårbarhetsutredningen4 samt av Svenska kraftnät5.

Vidare fann Miljöprocessutredningen6 att tillsynen över vattenverksamheter samt arbetet med omprövningar hittills har prioriterats lågt. Utredningen ansåg vidare att det finns brist i kunskap om hur många icke tillståndsprövade verksamheter som finns. Inte heller finns kunskap om antalet vattenverksamheter som saknar tydlig reglering av drift- eller underhållsansvar.

1.5. Pågående utredningar med betydelse för denna utrednings uppdrag

Regeringen beslutade den 16 juni 2009 om direktiv till en översyn av den statliga regionala förvaltningen7. Utredningen (Fi 2009:07) har i uppdrag att ge förslag på hur den statliga regionala förvaltningens utformning kan bli tydligare, mer samordnad och ändamålsenlig. Översynen omfattar såväl länsstyrelseorganisationen som hur länsstyrelsens uppgift att, inom myndighetens ansvarsområde, samordna olika samhällsintressen och hur statliga myndigheters insatser i länet ska vidareutvecklas och stärkas. Utredaren ska även se över på vilket sätt länsstyrelsens roll som

1 Dammsäkerhet och skydd mot översvämningar, SOU 1987:64. 2 Älvsäkerhet, SOU 1995:40. 3 Säkerheten vid vattenkraftdammar. Riksrevisionen 2007:9. 4 Sverige inför klimatförändringarna – hot och möjligheter, SOU 2007:60. 5 Översyn av de statliga insatserna för dammsäkerhet, Svenska kraftnät, (2010). 6 Vattenverksamhet, SOU 2009:42. 7 Översyn av statlig regional förvaltning m.m. Kommittédirektiv 2009:62.

regional samordnare av statlig tillsyn kan vidareutvecklas. För länsstyrelsens del skulle en sådan förändring kunna innebära att antalet länsstyrelser blir betydligt färre jämfört med dagens antal. Utredningen ska redovisa sitt uppdrag den 15 december 2012.

Säkerhetsskyddslagen är sedan december 2011 föremål för utredning8 i vissa delar. Utredaren ska bl.a. analysera vilka verksamheter som är av betydelse för rikets säkerhet eller som behöver skyddas mot terrorism och som därför är i behov av säkerhetsskydd. Utredningens direktiv uppmärksammar även begränsningarna i säkerhetsskyddslagens möjlighet att skydda IT-systemen som sådana. Utredaren ska därför föreslå hur reglerna om informationssäkerhet, som en del av säkerhetsskyddet, bör vara utformade. Utredaren ska även se över bl.a. bestämmelserna om registerkontroll till skydd mot terrorism. Likaså ska utredaren analysera hur Säkerhetspolisens och Försvarsmaktens tillsyn över säkerhetsskyddet bör vara utformat, bl.a. i förhållande till de sektorsansvariga myndigheternas kontroll. Uppdraget ska redovisas senast den 30 april 2014.

En särskild utredare ska se över reglerna om vattenverksamhet i miljöbalken och lagen (1998:812) med särskilda bestämmelser om vattenverksamhet, den s.k. restvattenlagen9. Utredaren ska föreslå de ändringar i reglerna som behövs för att miljörättens grundläggande principer – såsom principen om att förorenaren betalar och principen att bästa möjliga teknik ska användas – får genomslag även i den vattenrättsliga regleringen. Utredaren ska bl.a. analysera systemet för omprövning av vattenverksamheter och föreslå de ändringar som behövs för att åstadkomma ett effektivt system för omprövning av vattenverksamheter med den frekvens av omprövningar som krävs för att se till att verksamheter bedrivs på ett sådant sätt att de lever upp till miljöbalkens hänsynsregler och EUrättens krav i fråga om vattenkvalitet och påverkan på djur- och växtliv. Utredningen ska även omfatta analys av fastighetsägarens ansvar för löpande underhåll och vidtagande av andra åtgärder vid s.k. herrelösa dammar inom dennes fastighet. Uppdraget ska redovisas senast den 30 juni 2013.

8 Utredningen om säkerhetsskyddslagen Ju 2011:14, direktiv 2011:94. 9 Vattenverksamheter, direktiv 2012:29.

1.6. Betänkandets disposition

Betänkandet är uppdelat i tre delar.

Den första delen omfattar förord, sammanfattning på svenska och engelska samt författningsförslag.

Den andra delen omfattar en bakgrunds- och nulägesbeskrivning avseende dammsäkerhetsverksamheten i Sverige. I kapitel 2 ger utredningen en kort historik, beskrivningar av för utredningen relevanta begrepp, samt en beskrivning av dammbeståndet i Sverige. Orsaker till dammbrott och konsekvenser av dammbrott är också beskrivna. Tillämpliga bestämmelser i miljöbalken och tillhörande förordningar beskrivs i kapitel 3. Reglering för jämförbara verksamheter, såsom kärnkraftverk och Sevesoanläggningar, beskrivs i kapitel 4. Där ges även en internationell utblick avseende regelverk för dammsäkerhet, klassificering, egenkontroll, rapportering och tillsynsansvar. Svenska kraftnäts och länsstyrelsernas dammsäkerhetsarbete beskrivs i kapitel 5. Det är främst Svenska kraftnäts roll som central myndighetsfunktion för dammsäkerhet samt länsstyrelsen roll som tillsynsmyndighet som skildras. Dessutom beskrivs samverkansorgan och ett antal viktiga utvecklingsprojekt som genomförts på senare år. I kapitlet redogörs även för utredningens bedömning om tillsynens och tillsynsvägledningens omfattning. Kapitel 6 redogör för dammägarnas riktlinjer och dammsäkerhetsarbete. I kapitel 7 redovisar utredningen de utgångspunkter avseende dammsäkerheten i Sverige som utredningen har tagit avstamp ifrån.

Den tredje delen av betänkandet omfattar utredningens överväganden och förslag. I kapitel 8 beskrives utredningens förslag om styrande principer som utgör grund för det klassificeringssystem och det regelverk för egenkontroll och tillsyn som utredningen föreslår. Kapitlet beskriver även det dammsäkerhetsklassificeringssystem som utredningen föreslår samt processen för klassificeringen. I kapitel 9 ger utredningen sitt förslag på regelverk avseende rutiner för verksamhetsutövarnas egenkontroll och rapportering till tillsynsmyndigheten. Förslaget omfattar de verksamhetsutövare som äger dammar som i klassificeringsprocessen bedömts ha konsekvenser för samhället i händelse av dammbrott. I kapitel 10 ger utredningen sitt förslag på vilken myndighet som ska utöva dammsäkerhetstillsyn och hur den bör bedrivas. Resurs- och kompetensbehov för tillsyn behandlas också. Kapitel 11 redovisar utredningens förslag avseende ansvar för och utformningen av

tillsynsvägledning och främjande av dammsäkerhet. I kapitel 12 ger utredningen sina överväganden till hur beredskapen för dammbrott kan utvecklas. Kapitel 13 innehåller utredningens överväganden avseende säkerhets- och sekretesslagstiftningens tillämpning för dammar. Kapitel 14 behandlar utredningens förslag avseende finansiering av dammsäkerhetstillsyn. Kapitlet beskriver även utredningens förslag avseende finansiering av tillsynsvägledning och främjande av dammsäkerheten. Konsekvenser av utredningens förslag tas upp i kapitel 15. Slutligen i kapitel 16 redovisas kommentarer till de författningsförslag som utredningen lämnar.

2. Dammar och dammsäkerhet i Sverige

2.1. Inledning

Detta kapitel belyser övergripande olika aspekter beträffande dammar och dammsäkerhet i syfte att ge en bakgrund till det som utredningen tar upp senare i betänkandet. Kapitlet inleds med en beskrivning av dammbeståndet i Sverige, orsaker till och konsekvenser av dammbrott. Exempel ges på några dammbrott som skett i Sverige och internationellt. Därefter beskrivs begreppet dammsäkerhet och hur dammsäkerhetsarbetet har utvecklats i Sverige.

2.2. Dammar i Sverige

I Sverige finns uppskattningsvis 10 000 dammar av varierande storlek och ålder. Flertalet av dessa dammar används inte för någon form av vattenutnyttjande men kan ha stort kulturhistoriskt värde. 190 av dessa dammar är vattenkraftdammar som man internationellt betecknar som höga dammar, dvs. de har en största höjd från grundläggningsnivån till krönet på 15 m eller mer. Utöver de höga vattenkraftdammarna finns det cirka 15 gruvdammar som är högre än 15 m i landet. Av de höga dammarna är den stora majoriteten mellan 15 och 30 m höga. Ett fåtal dammar är över 30 m höga och enbart tre dammar i Sverige är högre än 100 m.

Som jämförelse kan nämnas att Norge och Finland har 330 respektive 55 höga dammar. ICOLD:s1 register över höga dammar i världen omfattar knappt 38 000 dammar.

1 ICOLD, International Commission on Large Dams.

2.2.1. Orientering om dammar

I dagligt tal och även i skrift används ofta begreppet damm synonymt med dammbyggnad. I denna framställning används orden ”damm” och ”dammbyggnad” omväxlande som benämning för ett byggnadsverk som utgör barriär över en terrängsänka och med syfte att lagra, kontrollera och/eller avleda vatten eller vattenblandningar. Ordet damm kan i vissa sammanhang även beteckna det uppdämda vattnet. Här används dock andra benämningar för detta såsom regleringsmagasin, dämningsområde, etc. Ofta förkortas regleringsmagasin till bara magasin.

Dammar kan indelas på många olika sätt. I Svenska kraftnäts handbok Dammsäkerhet2 görs en indelning med avseende på ändamål, användning och byggnadsmaterial, vilket beskrivs i det följande. Indelning med avseende på ändamålet eller syftet med dammen, exempelvis:

  • Vattenkraftdamm
  • Kvarndamm
  • Gruvdamm, industridamm
  • Vattenförsörjningsdamm
  • Invallningsdamm
  • Flottningsdamm
  • Damm för sjöfart

Indelning med hänsyn till den direkta användningen av dammen, t.ex.

  • Kraftverksdamm – damm som sammanför fallhöjd för ett kraftverk
  • Regleringsdamm – damm som magasinerar vatten och är försedd med utskov
  • Intagsdamm – damm som magasinerar vatten och är försedd med ett kraftverksintag
  • Gruvdamm – damm som magasinerar restprodukter från malmhantering

2 Handbok Dammsäkerhet – egenkontroll och tillsyn, Svenska kraftnät, 2007.

  • Spärrdamm – damm över lågpunkt i terrängen som saknar utskov och intag
  • Spegeldamm – damm vars syfte är att skapa en vattenspegel
  • Fångdamm – tillfällig damm vars syfte är att kunna utföra arbeten i torrhet
  • Invallningsdamm – damm vars syfte är att hindra vatten att översvämma ett markområde
  • Kanaldamm – damm, ofta långsträckt, som håller upp vattenytan i en kanal och hindrar vattnet att strömma ut över omgivande mark. Kanaldammar för transportändamål innehåller oftast en eller flera slussar.

Indelning kan vidare göras med avseende på huvudsakligt byggnadsmaterial, t.ex.

  • Fyllningsdamm
  • Betongdamm
  • Murverksdamm
  • Trädamm

Fyllningsdammar indelas i sin tur i jordfyllningsdammar och stenfyllningsdammar beroende på om stödfyllningen består av jord (grus) eller sten (sprängsten). Betongdammar indelas efter konstruktionsprincip, såsom valvdamm, lamelldamm och gravitationsdamm.

2.2.2. Dammar för vattenkraftproduktion

De större dammarna i Sverige har huvudsakligen byggts för vattenkraftändamål och de

flesta av

dessa finns i de stora reglerade

älvarna i Norrland. Totalt finns det ungefär 2 000 vattenkraftverk i Sverige. De flesta av de storskaliga vattenkraftverken med en dammhöjd över 15 m byggdes under 1950- 1960 och 1970-talen, se diagram 2.1 och 2.2.

Källa: Svensk Energis dammregister.

Källa: Svensk Energis dammregister.

Vattenkraftindustrin är i dag inne i en förvaltningsfas. Sedan 20 år tillbaka har det i stort sett inte byggts några nya stora dammar för vattenkraftproduktion. Någon betydande förändring av antalet stora dammar för vattenkraftproduktion kan inte förutses inom

överskådlig tid.

Dammar byggs för att kunna lagra vatten och för att öka fallhöjden. Vattnet lagras i magasin som däms upp av en eller flera dammar. Vattnet används för att producera el. Dammarna ingår vanligen i en större helhet, av branschen kallad ”anläggning”, bestående av:

  • magasin, där vatten magasineras för flerårs-, års-, vecko- eller dygnsreglering,
  • en eller flera dammar, som dämmer upp magasinet,
  • kraftverk, där el produceras (kraftverket kan vara förlagt i direkt anslutning till dammen eller på större avstånd från dammen)
  • avbördningssystem, där vatten kan ledas förbi stationen vid höga flöden eller vid driftsproblem/service av kraftverket.

Längs de stora reglerade älvarna är de största regleringsmagasinen oftast högt upp i vattendraget för att kunna fånga upp vårfloden från fjällen. Sådana dammar ägs vanligen av vattenregleringsföretag som bildats av alla kraftverksägarna i en älv. I regleringsföretagens arbetsuppgifter ingår bl.a. att samordna och sköta vattenhushållningen i älvarna, skadereglera, underhålla egna och delägarens anläggningar samt i övrigt samordna frågor som berör vattenkraftverksamheten. Nedströms de stora regleringsmagasinen ligger vattenkraftanläggningar med mindre magasin som utnyttjar fallhöjden ner till havet. En schematisk bild över Ljusnan och Voxnan visar komplexiteten i de stora reglerade vattendragen, diagram 2.3.

Källa: Vattenregleringsföretagen.

2.2.3. Dammar inom gruvindustrin

Den svenska gruvindustrin är främst lokaliserad till Norr- och Västerbottens län, och det är också där man finner merparten av landets gruvdammar. Det finns även ett antal gruvor i drift i Bergslagen. Där finns också ett stort antal mindre dammar som utgör lämningar från historisk gruvdrift.

Gruvindustrins dammar anläggs för deponering av gruvavfall, s.k. anrikningssand. Gruvdammar innesluter sandmagasin, dvs. magasin där anrikningssanden magasineras.

Den

aktiva drift-

perioden för en gruvdamm kan uppskattas till mellan 10 och 50 år. I Sverige finns ett tjugotal gruvdammar som i dag är i drift. Gruvindustrin omfattar även andra magasinstyper nämligen klarningsmagasin och vattenmagasin för produktionsvatten.

När gruvverksamheten på en plats avvecklas eller när en deponi slutfyllts efterbehandlas deponin på lämpligt sätt. Det finns två huvudprinciper för deponiers avslutning och efterbehandling, nämligen dränering, torrtäckning och vegetering alternativt vattenöverdämning. Vid dränering, torrtäckning och vegetering ordnas dränering för att undvika dämning av vatten och dammarna har inte längre någon funktion som dammar förutsatt att dräneringen fungerar som avsett. Vid vattenöverdämning (eller förhöjd grundvattenyta) är syftet att etablera en förhöjd vattennivå som är stabil i ett mycket långt tidsperspektiv.

Antalet aktiva gruvföretag med gruvdammar är begränsat och samtliga företag är medlemmar i branschorganisationen SveMin. Därutöver finns det ett antal historiska gruvdammar som ägs av markägare, samfälligheter eller andra parter som i många fall saknar erfarenhet och kompetens i dammsäkerhetsfrågor.

2.2.4. Ägarnas konsekvensklassificering

I vattenkraft- och gruvbranschen tillämpas ett egenutvecklat system för indelning av dammarna i olika s.k. konsekvensklasser. Systemet beskrivs i RIDAS3 och GruvRIDAS4, kraftindustrins respektive gruvindustrins riktlinjer för dammsäkerhet, se kapitel 6. Systemet är baserat på en bedömning av vilka konsekvenser ett dammbrott skulle medföra. I riktlinjerna relateras krav på dammsäkerhet till

3 RIDAS Kraftindustrins riktlinjer för dammsäkerhet, Svensk Energi, 2008 och 2012. 4 GruvRIDAS Gruvindustrins riktlinjer för dammsäkerhet, SveMin, 2010.

dammens konsekvensklass. Motsvarande system är vanligt förekommande också i andra länder. Klassificeringssystemet består av följande fyra konsekvensklasser i RIDAS 2008 och GruvRIDAS 2010.

  • 1A och 1B – ett dammbrott skulle kunna leda till förlust av människoliv eller allvarlig skada på viktiga samhällsanläggningar, förlust av betydande miljövärde eller stor ekonomisk skadegörelse. Kategorin 1A avser dammar med hög sannolikhet för förlust av många liv, mycket allvarliga skador osv.
  • 2 – ett dammbrott skulle kunna leda till beaktansvärda skador på samhällsanläggningar, miljövärde eller beaktansvärd ekonomisk skadegörelse, men sannolikheten för förlust av människoliv är försumbar.
  • 3 – ett dammbrott skulle inte leda till skadeutfall enligt ovan

I RIDAS 2012 har klassificeringen ändrats, se vidare om detta i kapitel 6.

2.2.5. Farlig verksamhet

Länsstyrelsen beslutar om verksamheten vid dammanläggningar är farlig verksamhet enligt 2 kap. 4 § LSO. Verksamheten vid drygt 100 av dammanläggningarna i landet omfattas av bestämmelserna om farlig verksamhet enligt beslut av länsstyrelsen. Detta avser nästan uteslutande anläggningar med dammar i konsekvensklass 1A och 1B. Se vidare om farlig verksamhet i avsnitt 12.2.

2.2.6. Dammregister

Ett nationellt dammregister för arbete med dammsäkerhet skapades vid SMHI under åren 1994 och 1995 baserat på länsstyrelsernas damminventering som genomfördes under 1980-talet. Dammregistret förvaltas inom Svenskt Vattenarkiv och innehåller uppgifter om cirka 5 000 dammbyggnader. Under 2010 inleddes ett omfattande arbete med att strukturera om och uppdatera dammregistret för att det bättre ska svara mot samhällsbehoven. Dammregistret avses innehålla uppgifter om dammarnas läge, verksamhet, egenskaper, m.m.

Länsstyrelserna ska hålla register över sina tillsynsobjekt, se avsnitt 3.5.2. Länsstyrelsernas dammregister ses över i samband med SMHI:s pågående utvecklingsarbete.

Vidare har kraftindustrin och gruvindustrin upprättat egna dammregister över medlemmarnas dammar.

Svenska kraftnät sammanställer regelbundet uppgifter om det svenska dammbeståndet5. Sammanställningen utgår ifrån en årlig rapportering om dammsäkerhet från dammägare till länsstyrelsen. Verkets senaste sammanställning, som grundades på rapportering avseende år 2010, omfattar 219 dammanläggningar i konsekvensklass 1A och 1B samt 293 dammanläggningar i konsekvensklass 2. Dammanläggningarna i sammanställningen består av en eller flera dammar, totalt sett utgör sammanställningen cirka 700 dammar i 1A, 1B eller 2.

2.3. Dammsäkerhet – vad är det?

Dammsäkerhet är inte definierat i någon reglering och det finns inte heller någon entydig definition av dammsäkerhet. Svenska kraftnät har i sin översynsrapport6 definierat dammsäkerhet som dels förebyggande av dammbrott, felaktig drift och andra händelser som kan resultera i okontrollerad och hastig utströmning av uppdämt vatten, dels åtgärder för att begränsa skador till följd av sådana händelser (beredskap för dammbrott). Svensk Energi definierar i RIDAS dammsäkerhet som säkerhet mot uppkomst av okontrollerad utströmning från magasinet (dammbrott) som kan medföra skador.

Kortfattat kan sägas att tre viktiga faktorer för god dammsäkerhet är:

  • Säker dammkonstruktion
  • Säkert handhavande (drift och tillståndskontroll)
  • Beredskap för dammbrott och allvarliga problem

Utredningen har utarbetat en definition av dammsäkerhet, se vidare i avsnitt 8.1.4.

5 Sammanställning av rapportering avseende dammsäkerhet år 2010, Svenska kraftnät, dnr. 2011/78. 6 Översyn av de statliga insatserna för dammsäkerhet, Svenska kraftnät, dnr. 2010/877.

2.4. Dammbrott – orsaker och konsekvenser

2.4.1. Orsaker till dammbrott

Internationell statistik över inträffade dammbrott för stora dammar visar att sannolikheten för dammbrott är i storleksordningen 10-4/år. Den allmänna bedömningen är att denna siffra är minskande p.g.a. att kunskapen utvecklas och förstärkning av befintliga dammar görs. I världen finns totalt ca 50 000 stora dammar, vilket betyder att i genomsnitt någon eller några få av dessa rasar varje år.

De två huvudsakliga orsakerna till inträffade dammbrott är bristande avbördningsförmåga vid höga flöden respektive läckageproblem i dammkroppen eller i grundläggningen. En stor andel av dammbrotten har inträffat under byggtiden, dämningsupptagningen eller under de första åren efter idrifttagningen. Indirekta orsaker till dammbrott kan vara t.ex. brister i underhåll, avsaknad av reservkraft, igensättning av utskov med drivgods eller otillräcklig bemanning. Risken för dammbrott på grund av skadegörelse och sabotage går inte heller att utesluta.

2.4.2. Konsekvenser av dammbrott

Konsekvenser av dammbrott beror på faktorer som uppdämd vattenvolym, dammhöjd och -längd, samt skadeobjekt i översvämningsområdet.

Ett dammbrott leder till okontrollerad utströmning från magasinet. Förutom översvämningsskador kan det uppkomma ras och skred i slänter upp- och nedströms dammen, andra erosionsskador samt brott på nedströmsliggande dammar. Fenomenet att dammbrott i en damm förorsakar haveri i nedströmsliggande dammanläggningar, s.k. sekundärdammbrott, benämns ”dominoeffekt”. Ett dammbrott i en damm belägen högt upp i ett vattendrag med stor indämd volym kan orsaka stora konsekvenser och översvämningsområdet kan sträcka sig ända ner till havet. Under olyckliga omständigheter får man räkna med att hundratals personer kan omkomma och att materiella skador för tiotals miljarder kronor kan uppstå.

De allvarligaste konsekvenserna av ett dammbrott är förlust av människoliv eller allvarliga personskador. Dessa konsekvenser kan uppkomma direkt av det utströmmande vattnet eller som en följd av andra skador, såsom ras och skred, omfattande skador på bygg-

nader där människor uppehåller sig, samt skador på vägar och järnvägar.

Viktiga samhällsfunktioner kan slås ut eller allvarligt störas av ett dammbrott. Det kan röra sig om förstörelse av samhällsviktig infrastruktur eller störningar på samhällsviktiga funktioner såsom elförsörjningen, dammanläggningar, vatten- och avloppsanläggningar, broar, vägar, järnvägar och telekommunikation. I vissa fall kan ett dammbrott leda till att infrastrukturen längs en älvdal slås ut på ett långvarigt och omfattande sätt.

Miljöskador av olika slag kan uppkomma. Det kan vara dels miljöskador till följd av att vattnet orsakar utströmning eller urlakning av miljöfarliga ämnen, dels direkta skador på värdefull naturmiljö. Om ett magasin innehåller annat än vatten, såsom är fallet med gruvdammar för anrikningssand, uppkommer vid dammbrott, förutom översvämning, ibland även andra skador. Om det deponerade materialet kommer ut i vattendrag eller sedimenterar i nedanförliggande terräng kan skador uppkomma genom t.ex. grumling, försurning och annan kemisk påverkan på vatten, mark och levande organismer. Konsekvenserna beror på det deponerade materialets egenskaper som i sin tur beror på vilken sorts malm som brutits och vilken process som använts.

Egendomsskador kan bli svårartade vid ett dammbrott. Både enskild och allmän egendom kan skadas och omfattningen beror på de lokala förhållandena och dammbrottets karaktär. Även värdefulla kulturmiljöer kan skadas av ett dammbrott.

För majoriteten av Sveriges cirka 10 000 dammar skulle ett dammbrott enbart medföra mindre lokala konsekvenser. För drygt 200 dammanläggningar skulle ett dammbrott medföra betydande konsekvenser för samhället och fara för förlust av människoliv. För några tiotal dammar skulle ett dammbrott innebära en svår påfrestning för samhället.

2.4.3. Dammbrott i Sverige

Ett flertal dammbrott har inträffat i Sverige men inga med katastrofala följder. Några av dammbrotten som inträffat beskrivs nedan:

  • År 1973 överströmmades en liten damm, endast cirka 2,5 m hög, i Näckån, i Sysslebäck, Värmland, vilket medförde att cirka

12 000 m3 vatten frigjordes. De materiella skadorna blev små men en person omkom.

  • I samband med den extremt höga nederbörden i Dalarna och Hälsingland hösten 1985 steg vattenytan över dammen vid Noppikoski i Oreälv till följd av att en utskovslucka inte kunde öppnas. Ett parti av dammen spolades bort och cirka 1 miljon m3 vatten strömmade ut. Ingen människa skadades vid dammbrottet. Flera mindre dammbrott inträffade samtidigt i samband med de höga flödena.
  • Sommaren 2000 inträffade ett dammbrott i en gruvdamm för deponering av anrikningssand vid Bolidens anläggning i Aitik i Norrbotten. Följderna kunde ha blivit omfattande, men blev av lyckliga omständigheter relativt begränsade p.g.a. att klarningsmagasinets damm belägen nedströms inte gick till brott.
  • 28 september 2010 inträffade ett dammbrott vid Granö kraftverk i Mörrumsån i Kronobergs län. Dammbrottet skedde i en fyllningsdamm med träspont i anslutningen till en betongkonstruktion vid intaget till kraftverket. Utöver länsstyrelsens uppföljning av händelsen utredde E.ON dammbrottet och återuppbygger dammen. Konsekvenserna av dammbrottet blev lokala.
  • 7 november 2010 skedde ett dammbrott vid Hästberga kraftverk i Helge å i Skåne län. Konsekvenserna av dammbrottet blev lokala. Cirka en miljon m3 vatten strömmade ut från magasinet, en bro nedströms rasade, en närliggande väg och några fastigheter nedströms översvämmades. Utöver länsstyrelsens uppföljning av händelsen har dammbrottet utretts av ägaren, polisen och Statens Haverikommission7. Haverikommissionens utredning pekar på brister hos såväl dammen, som egenkontrollen och tillsynen.

2.4.4. Dammbrott i andra länder

Dammbrott med stora konsekvenser har inträffat i ett flertal länder. En sammanställning över några större dammbrott under 2000-talet ges nedan.

7 Slutrapport RO 2011:01, Dammbrott, Hästberga, Hässleholms kommun, Skåne län, den 7 november 2010, Dnr O-12/10, Statens Haverikommission, 2011.

ě

Källa: Wikipedia.

2.5. Dammanläggningar med konsekvenser för samhället i händelse av dammbrott

Den geografiska fördelningen av dammanläggningar samt fördelningen av dammanläggningar på ägare och verksamhet som redogörs för i detta avsnitt utgår från Svenska kraftnäts sammanställning av årsrapportering 20108.

8 Sammanställning av rapportering avseende dammsäkerhet år 2010, Svenska kraftnät, dnr. 2011/78.

Såsom redan berörts finns det uppskattningsvis drygt 500 dammanläggningar i landet där en eller flera dammar i konsekvensklass 1A, 1B eller 2 enligt RIDAS ingår. Förutom vattenkraftdammar och dammar som används inom gruvproduktionen ingår här även några kanaldammar, som används för sjöfart, samt ett antal dammar som används till skydd för översvämningar. Majoriteten av dammanläggningar tillhör företag inom vattenkraft- och gruvindustrin.

2.5.1. Geografisk fördelning av dammanläggningar

De flesta dammanläggningarna i konsekvensklasserna 1A, 1B och 2 finns i Norrbotten, Västerbotten, Jämtland, Västernorrland, Dalarna, Gävleborg, Värmland och Örebro. Även Västra Götaland har relativt många dammar i dessa konsekvensklasser.

138 av totalt 219 dammanläggningar i de högsta konsekvensklasserna (1A och 1B) är belägna längs de tio stora reglerade älvarna i landet; Luleälven, Skellefteälven, Ångermanälven, Indalsälven, Umeälven, Ljungan, Ljusnan, Dalälven, Klarälven och Göta älv. Dammanläggningar i konsekvensklass 2 är relativt jämt fördelade mellan de stora älvarna och ett flertal mindre vattendrag i landet. Gruvindustrins dammar motsvarar bara några procent av dammbeståndet.

Källa: Svenska kraftnät.

Anläggningarnas fördelning över landet framgår av Diagram 2.4 och 2.5.

Källa: Svenska kraftnät.

Källa: Svenska kraftnät.

2.5.2. Dammanläggningar fördelade på ägare och verksamhet

Totalt sett ägs dammanläggningarna i konsekvensklass 1A, 1B och 2 av 70 företag, privatpersoner och kommuner. Av dessa rapporterar 28 dammägare att de har dammar i konsekvensklass 1A och/eller 1B. Ägarna är främst företag inom vattenkraftindustrin men även gruvindustrin äger ett antal dammar, se tabell 2.3.

Källa: Svenska kraftnät.

Sex företag inom vattenkraftindustrin äger flertalet av de större dammanläggningarna i konsekvensklass 1A, 1B och 2. Dessa ägare är Fortum, Vattenfall, Vattenregleringsföretagen, Statkraft, E.ON och Skellefteå Kraft. Tillsammans äger de 69 procent (351 av 510) av anläggningarna som är med i sammanställningen. Tittar man på fördelningen av dammanläggningar i konsekvensklass 1A och 1B kan noteras att motsvarande företag äger 82 procent av anläggningarna.

Utöver dessa större dammägare finns det 56 mindre ägare inom vattenkraftindustrin och vattenreglering med färre antal dammar per ägare. Totalt rör det sig om 132 dammanläggningar varav 23 stycken är i konsekvensklass 1A eller 1B. Ägarna är främst privata företag men även kommunalägda företag och privatpersoner. De

största av de mindre företagen är Mälarenergi, Tekniska Verken i Linköping, Olofströms Energiservice, Sveaskog och Jämtkraft.

Inom gruvindustrin är det sex dammägare som är med i sammanställningen med totalt 24 dammanläggningar i konsekvensklass 1A, 1B och 2, vilket motsvarar 5 procent av dammbeståndet. Boliden Mineral är den största ägaren av gruvdammar och den enda med dammar i konsekvensklass 1A.

Övriga dammar för invallning, slussar och kanaler omfattar endast en bråkdel av dammarna.

Källa: Svenska kraftnät.

2.5.3. Dammar där dammbrott skulle innebära stor påfrestning på samhället

För ett antal av dammarna inom konsekvensklass 1A skulle ett dammbrott få särskilt svåra konsekvenser. Det skulle kunna leda till extraordinära händelser och kris i samhället t.ex. genom allvarliga störningar i elförsörjningen. Sammantaget skulle ett dammbrott kunna medföra en svår påfrestning på samhället, dvs. ge sådana konsekvenser som kan äventyra människors liv och hälsa, samhällets funktionalitet och grundläggande värden.

Det kan vara fråga om att den sammanlagda effekten av alla skadorna längs en älv eller att någon eller några enstaka skador åstadkommer svåra påfrestningar som följdverkan. Dessa dammar skiljer sig från övriga dammar i den högsta konsekvensklassen 1A genom den stora utbredningen på skadeområdet längs älvdalen nedströms och de följder detta skulle få för regionen och landet.

Det är i flera fall fråga om vattenkraft- eller regleringsdammar belägna i den övre delen av någon av de tio stora kraftverksälvarna och för vilka ett dammbrott skulle leda till dammbrott även i nedströms liggande dammar. Den okontrollerade utströmningen av uppdämt vatten skulle då medföra översvämningar längs större delen av älvens lopp med risk för

  • förlust av många människoliv,
  • förstörelse av många människors hem och egendom, kulturmiljö och arbetsplatser,
  • omfattande störningar i landets elförsörjning p.g.a. skador på elnätet och förstörda vattenkraftstationer,
  • omfattande störningar av transporter till följd av förstörda broar på älvsträckan och skador i övrigt på vägar och järnvägar,
  • förstörelse av infrastruktur och omfattande störningar i andra samhällsviktiga verksamheter, t.ex. anläggningar för vattenförsörjning, radio- och telekommunikationer,
  • allvarliga miljöskador som för lång framtid inte kan återställas samt
  • mycket stor ekonomisk skada.

Flertalet av dammanläggningarna där dammbrott skulle innebära stor påfrestning på samhället finns i Norrbottens, Västerbottens,

Jämtlands, Västernorrlands och Dalarnas län. Men även i Värmlands och Västra Götalands län finns dammar med stora potentiella konsekvenser av dammbrott.

2.6. Kort historik

I detta avsnitt lämnas en kortfattad redogörelse över viktiga skeenden för dammsäkerhetsutvecklingen i landet.

2.6.1. Utbyggnadsepoken

Den tidsperiod då många av landets stora vattenkraftverk och regleringsmagasin tillkom brukar betecknas som utbyggnadsepoken. Den började vid tiden efter andra världskriget och kulminerade, som nämnts i avsnitt 2.2.2, under 1950- och 1960-talen.

Under denna tid fanns regler om byggande i vatten, t.ex. uppförande av dammbyggnader, i vattenlagen (1918:523) som började gälla redan år 1919. Några särskilda regler om dammsäkerhet fanns inte i 1918 års vattenlag. Det var dammägaren som i huvudsak avgjorde hur dammen skulle konstrueras och övervakas. Statens Vattenfallsverk (Vattenfall) utarbetade dock tidigt olika anvisningar för utformning och byggande av dammar vilka även nyttiggjordes av andra företag. Svenska ingenjörer var tidigt aktiva i internationell kommittéverksamhet inom dammområdet, och Sverige blev medlem i ICOLD9 redan 1931. Under utbyggnadsepoken fanns även teknisk expertis och hydrauliskt laboratorium vid Kungliga Tekniska Högskolan. Efter vattenkraftutbyggnadens kulmen och sedan slutet av 1980-talet har inte nybyggnation av vattenkraft skett i någon större omfattning.

2.6.2. Skydd av dammar i händelse av krig

Staten har sedan 1920-talet uppmärksammat behovet av åtgärder för att minska sårbarheten i elförsörjningen i krig. Under andra världskriget stiftades lagen (1942:335) om särskilda skyddsåtgärder för vissa kraftanläggningar (den s.k. krigsskyddslagen), som senare ersatts av elberedskapslagen (1997:288). Enligt krigsskyddslagen

9 International Commission on Large Dams.

försågs bl.a. kraftverk och regleringsdammar med bombskydd. Bombningen av en damm i Ruhrområdet i andra världskrigets slutskede 1945 ledde till en flodvåg som slog ut viktig industri för Tyskland och tog många människoliv. Händelsen fick stor uppmärksamhet och visade att dammar i sig utgör ett potentiellt hot som kan utlösas genom t.ex. krigshandlingar.

2.6.3. Kraftindustrins gemensamma anvisningar, forskning och utveckling

Sedermera har man allt mer uppmärksammat att dammar även kan haverera p.g.a. väderlaster, brister i konstruktion och handhavande etc, och dammsäkerhetsarbete har utvecklats till en egen disciplin. För kraftindustrin branschgemensamma anvisningar för dammsäkerhet började utarbetas i slutet av 1960-talet. Kraftindustrins stiftelse för tekniskt utvecklingsarbete, VAST, gav 1968 ut anvisningar om tillståndskontroll av dammbyggnaders underhåll och säkerhet. Dessa anvisningar följdes av flera uppdateringar fram till 1990. VAST initierade och finansierade även olika forsknings- och utvecklingsprojekt om bl.a. avbördningssäkerhet som redovisades i en rapportserie. 1993 övergick VAST i Elforsk AB, som i dag ägs av Svensk Energi (75 %) och Svenska kraftnät (25 %). Sedan 1999 stödjer Svenska kraftnät även valda FoU-projekt inom älv- och dammsäkerhetsområdet, i huvudsak genom delfinansiering tillsammans med medlemsföretagen i Svensk Energi via Elforsk.

2.6.4. Dammbrott och förtydligat tillsynsansvar för länsstyrelser

Sverige var under många år förskonat från dammolyckor med allvarligare konsekvenser. Efter händelsen år 1973 vid Sysslebäck som orsakade ett dödsfall (se avsnitt 2.4.3) uppmärksammades frågan om säkerheten vid dammar och kom att behandlas av regering och riksdag. Länsstyrelserna gavs, genom en ny bestämmelse i 1918 års vattenlag, laglig möjlighet att ingripa vid eftersatt underhåll mot försumliga dammägare. Vidare fick den pågående Vattenlagsutredningen direktiv att lägga fram förslag om tillsyn av vattenanläggningar, bl.a. dammbyggnader. Detta ledde fram till att den nya vattenlagen (1983:291, VL), som trädde i kraft den

1 januari 1984, innehöll bestämmelser om att länsstyrelserna skulle vara tillsynsmyndigheter för vattenföretag och vattenanläggningar vari tillsyn av dammsäkerhet ingår som en del.

2.6.5. Dammsäkerhetsnämnden

Kraftverksföreningen och Vattenfall inrättade 1978 en särskild nämnd, Dammsäkerhetsnämnden, vars uppgift skulle vara att som expertorgan för rådgivning i ärenden om tillsyns- och säkerhetsfrågor beträffande dammar lämna skriftliga rekommendationer för dammsäkerhetskontroll. Efter gemensam framställning från initiativtagarna 1982 förordnade regeringen ledamöterna i nämnden. Dammsäkerhetsnämnden gav bl.a. ut riktlinjer för länsstyrelsernas tillsyn över medelstora och mindre dammar. Nämnden tillhandahöll också en förteckning över personer med kompetens inom dammsäkerhetsområdet vilka kunde anlitas av länsstyrelserna t.ex. för besiktning.

2.6.6. Dammbrott och utredning

Under 1980-talet förekom höga flöden och översvämningar på olika håll i landet. Dammbrott vid Noppikoski kraftverk (se avsnitt 2.4.3), medförde skador på skog, vägar och ett nedströms liggande kraftverk, men inga personskador. Regeringen tillsatte i december 1985 en utredning som antog namnet Dammsäkerhet och skydd mot översvämningar. I sitt betänkande (SOU 1987:64) konstaterade utredningen att ”dammsäkerheten i landet är i stort sett god och att den är på väg att ytterligare förbättras”. Dock lämnades förslag om bl.a. ändring av vattenlagen så att säkerhetsaspekter skulle ges ökad tyngd vid tillståndsprövning (se avsnitt 3.4.1) och att regeringen skulle uppdra åt vissa länsstyrelser att genomföra damminventeringar. Utredaren ansåg vidare att länsstyrelserna borde utnyttja Dammsäkerhetsnämndens kompetens mera än vad som skett.

2.6.7. Dimensionerande flöden för dammanläggningar

Våren 1985 bildades den så kallade Flödeskommittén. Flödeskommittén var ett samarbete mellan kraftindustrin och SMHI för att utarbeta riktlinjer för dimensionerande flöden för dammanläggningar. Resultatet av kommitténs arbete presenterades i en slutrapport10 år 1990 och var resultat av ett omfattande forsknings- och utvecklingsarbete, se avsnitt 6.2.3. Regeringen informerades samma år om kraftindustrins ställningstagande att ta ett aktivt ansvar för tillämpningen av de nya riktlinjerna.

Genom samråd mellan riktlinjernas huvudmän inom ramen för vad som kallas Flödeskonferensen sker uppföljning av riktlinjernas relevans och hur dammägarnas anpassningsarbete fortskrider. Under 2007 har en nyutgåva av riktlinjerna11 getts ut. Innebörden är i huvudsak oförändrad och det har inte funnits anledning att revidera metoderna med hänsyn till förväntade framtida klimatförändringar, men frågan om riktlinjernas tillämpning i ett föränderligt klimat behandlas i nyutgåvan. Huvudmannaskapet för nyutgåvan delas av Svenska kraftnät, Svensk Energi och SveMin.

2.6.8. Höga flöden, utredningar och miljöbalken

Även under 1990-talet var förekomsten av höga flöden frekvent och omfattande översvämningar drabbade olika delar av landet. År 1994 tillsatte regeringen en särskild utredare med uppdrag att utreda frågor om dammsäkerhet och skydd mot översvämningar. Utredningen redovisade sina resultat år 1995 i betänkandet Älvsäkerhet.12 Utredningen konstaterade att samhället saknar en sammanhållande styrning och kontroll över dammsäkerhet och åtgärder mot översvämningar. Utredningen föreslog därför bl.a. att det som komplement till Dammsäkerhetsnämnden skulle inrättas ett centralt organ för myndighetsuppgifter, kallat Dammsäkerhetsdelegationen. Vidare konstaterade utredningen att för att vidmakthålla och utveckla kunskaper och kompetens inom området behövs en långsiktigt bedriven forskning och att staten på ett målmedvetet sätt bör se till att sådan forskning kommer till stånd.

10 Riktlinjer för bestämning av dimensionerande flöden för dammanläggningar. Slutrapport från Flödeskommittén. Statens Vattenfallsverk, Svenska Kraftverksföreningen, Sveriges Meteorologiska och Hydrologiska Institut (1990). 11 Riktlinjer för bestämning av dimensionerande flöden för dammanläggningar, Svensk Energi, SveMin, Svenska kraftnät, 2007. 12 Älvsäkerhet, SOU 1995:40.

Efter att frågan om ersättning för översvämningsskador på grund av dammbrott hade aktualiserats av svenska försäkringsbolag tillfördes vattenlagen år 1997 en ny paragraf om att dammägare har strikt ansvar för skada vid dammhaveri.

Tillsammans med ungefär hälften av vattenlagens övriga bestämmelser överfördes denna skadeståndspräglade paragraf år 1999 till miljöbalken (MB). MB:s generellt gällande allmänna hänsynsregler och bestämmelserna om egenkontroll jämte den tidigare vattenlagens bestämmelser om bl.a. underhållskyldighet för vattenanläggningar utgör sedan dess det huvudsakliga regelverket för dammsäkerhet, se vidare i kapitel 3.

2.6.9. Ny myndighet och kraftindustrins riktlinjer för dammsäkerhet

Med utgångspunkt från förslaget i betänkandet Älvsäkerhet om ett centralt organ för myndighetsuppgifter gav regeringen från den 1 januari 1998 Svenska kraftnät en central myndighetsroll inom dammsäkerhetsområdet med uppgift att främja dammsäkerheten i landet. Tillsynsvägledning, stimulerad utveckling av samordnad beredskap för dammbrott samt stöd för kunskapsutveckling och kompetensförsörjning är viktiga områden för Svenska kraftnäts dammsäkerhetsverksamhet. Ett rådgivande organ, Dammsäkerhetsrådet, med uppgift att biträda Svenska kraftnät i arbetet med dammsäkerhetsfrågor finns i enlighet med regeringens instruktion för affärsverket.

Inom kraftindustrin uppmärksammades dammsäkerhetsfrågan alltmer under 1990-talet och man kom till insikt om behovet av gemensamma dammsäkerhetsriktlinjer. Ett omfattande utrednings- och utvecklingsarbete ledde fram till att kraftindustrin 1997 antog ”Kraftföretagens riktlinjer för dammsäkerhet”, benämnda RIDAS13. Riktlinjerna beskriver bland annat rutiner för dammägarnas egenkontroll inom området. Riktlinjerna uppdateras vid behov med hänsyn till fortlöpande utvecklingsarbete och för tilllämpningen av riktlinjerna finns särskilda tilllämpningsvägledningar. Svensk Energi ordnar bland annat sedan slutet av 1990-talet årliga tvåveckorskurser om dammar och dammsäkerhet. Kursen

13 RIDAS – Kraftföretagens riktlinjer för dammsäkerhet. Svensk Energi (1997, reviderad 2002, 2008 och 2012).

vänder sig i första hand till ingenjörer verksamma inom kraftindustrin och hos konsultföretag.

2.6.10. Dammbrott i gruvdamm och riktlinjer för säkerhet vid gruvdammar

Följderna av dammbrottet år 2000 i Aitik (se avsnitt 2.4.3) kunde ha blivit omfattande, men blev av lyckliga omständigheter relativt begränsade. Gruvnäringens branschorganisation SveMin tog 2002 beslut om att med RIDAS som utgångspunkt utveckla särskilda riktlinjer för gruvdammar, GruvRIDAS14. En gemensam dammsäkerhetspolicy antogs 2005 och GruvRIDAS färdigställdes 2007. Flera gruvföretag hade då i samband med miljötillståndsprövningar sedan en tid gjort åtaganden att i tillämpliga delar följa RIDAS. På motsvarande sätt som Svensk Energi anordnar SveMin årliga kurser inriktade mot dammsäkerhet för gruvdammar, med ingenjörer verksamma inom gruvindustrin och hos konsultföretag som huvudsaklig målgrupp, men välkomnar även representanter för myndigheter, etc.

2.6.11. Kompetensbrist uppmärksammas

Efterfrågan på nya vattenbyggnadsingenjörer avtog på 1970-talet och fram till 90-talet, eftersom det fanns en överkapacitet av erfarna ingenjörer från utbyggnadsepoken. Detta fick till följd att högskolornas verksamhet inom vattenbyggnadsområdet successivt försvagades. Under 2000-talet har kraftigt ökad efterfrågan på ingenjörskompetens inom området uppkommit som följd av en allmän ambitionshöjning och pågående utveckling av dammsäkerhetsarbetet liksom förnyelse av vattenkraftanläggningar. Vidare har svensk gruvindustri under det senaste decenniet varit under stark tillväxt med omfattande ny- och tillbyggnad av gruvdammar och därmed ett växande kompetensbehov. Samtidigt har många av ingenjörerna som var verksamma under utbyggnadsepoken gått i pension.

Sammantaget har detta lett fram till kapacitetsbrist inom kompetensområdet vattenbyggnad och vattenkraft. Insikten har

14 GruvRIDAS – Gruvindustrins riktlinjer för dammsäkerhet. SveMin (2007, reviderad 2010).

vuxit fram om att det finns behov av särskilda satsningar för att långsiktigt säkerställa tillgången på ingenjörskompetens. I detta syfte bildades år 2005 Svenskt Vattenkraftcentrum, SVC, som är en gemensam satsning på utbildning och forskning inom vattenkraft och dammbyggnad av Kraft- och gruvindustri, Energimyndigheten och Svenska kraftnät samt fyra högskolor.

2.6.12. Riksrevisionen och Klimat- och sårbarhetsutredningen rekommenderar översyn av de statliga insatserna för dammsäkerhet

Riksrevisionen genomförde under 2006–2007 en granskning av de statliga insatserna för dammsäkerhet. I Riksrevisionens rapport15som överlämnades till regeringen i maj 2007 föreslogs bland annat att regeringen skulle ta initiativ till en översyn av de statliga insatserna för dammsäkerhet.

Klimat- och sårbarhetsutredningen instämde i sitt slutbetänkande16 i Riksrevisionens förslag om översyn. I samma slutbetänkande lämnades också fyra förslag till uppdrag till Svenska kraftnät att hantera i samverkan med berörda intressenter om klimatförändring och dammsäkerhet.

2.6.13. Klimatfrågans betydelse för dammsäkerhet analyseras

2008 bildade Svenska kraftnät, SMHI, Svenska Energi och SveMin ”Kommittén för dimensionerande flöden för dammar i ett klimatperspektiv.” Kommitténs uppdrag var att leda ett program för att fortlöpande analysera och värdera klimatfrågans betydelse för dammsäkerheten med avseende på flödesdimensionering och ta initiativ till att erforderliga studier kommer till stånd. Uppdraget omfattade bl.a. de frågor rörande klimatets påverkan på dimensionerande flöden och dammsäkerhet som Svenska kraftnät fått i uppdrag av regeringen att följa och analysera i samarbete med kraftbranschen, gruvindustrin och SMHI. Kommittén skulle vidare utarbeta en vägledning för hur klimatförändring bör beaktas vid

15 Säkerheten vid vattenkraftdammar. Riksrevisionen 2007:9. 16 Sverige inför klimatförändringarna – hot och möjligheter. Slutbetänkande av klimat- och sårbarhetsutredningen, SOU 2007:60.

flödesdimensionering av dammar. Kommittén rapporterade uppdraget 201117, se vidare i avsnitt 5.2.5.

2.6.14. Svenska kraftnäts översyn av de statliga insatserna för dammsäkerhet

Efter uppdrag i regleringsbrev lämnade Svenska kraftnät år 2010 rapporten Översyn av de statliga insatserna för dammsäkerhet18 till regeringen. Svenska kraftnät ansåg att dammsäkerheten behöver utvecklas och att nuvarande system för dammsäkerhet inte motsvarar de krav på säkerhet som samhället i dag måste ställa. Svenska kraftnät ansåg vidare att stärkta statliga insatser främst motiveras av förekomsten av dammar som i händelse av dammbrott, förutom fara för många människors liv och hälsa, skulle kunna förorsaka allvarliga störningar i samhällsviktiga verksamheter. För dessa anläggningar är det särskilt angeläget att samhället har sakkunnig insyn i och kontroll av säkerheten.

Enligt Svenska kraftnät är tillsynen av dammsäkerheten i dag svag och det saknas styrande principer och mer utförliga regler för dammsäkerhetsarbetet. Vidare saknas ett tydliggörande av vad dammägarnas egenkontrollansvar egentligen ska innebära.

Svenska kraftnät bedömde att tillgången på dammsäkerhetskompetens i landet är begränsande för utvecklingen av säkerheten och för uppbyggnaden av beredskap avseende dammbrott. Det är angeläget med fortsatta insatser i minst nuvarande omfattning för att främja och stödja kunskapsutvecklingen och kompetensförsörjningen.

För att främja dammsäkerheten och stimulera utvecklingstakten föreslog Svenska kraftnät att ett särskilt regelverk skulle införas som förtydligar miljöbalkens innebörd för dammsäkerhetsområdet. Detta är särskilt angeläget med hänsyn till de dammar där ett dammbrott skulle kunna leda till mycket stora konsekvenser.

Under 2010 lämnade regeringen översynsrapporten på remiss till berörda myndigheter och branschorganisationer. Remissvaren gav i stort sett stöd till Svenska kraftnäts beskrivning av dammsäkerhetssituationen i landet. De flesta remissinstanser ställde sig

17 Dammsäkerhet och klimatförändringar, Slutrapport från Kommittén för dimensionerande flöden för dammanläggningar i ett klimatförändringsperspektiv, Svenska kraftnät, Svensk Energi, SveMin, SMHI (2011). 18 Översyn av de statliga insatserna för dammsäkerhet, Rapport till regeringen, Svenska kraftnät, (2010).

positiva till de rekommendationer som Svenska kraftnät gav i rapporten men flera ansåg att vissa rekommendationer borde analyseras ytterligare.

Baserat på de synpunkter som framkom om statens insatser för dammsäkerheten i både Riksrevisionens rapport och Svenska kraftnäts översynsrapport tillsatte staten sommaren 2011 denna utredning.

3. Miljöbalken – förtydliganden avseende dammsäkerhet

3.1. Regler om dammar och dammsäkerhet

Det finns som redan nämnts inte någon särskild lag om dammsäkerhet i Sverige. I stället är flera olika författningar tillämpliga på dammsäkerhetsområdet. Miljöbalken (1998:808) (MB) innehåller bestämmelser om tillståndsprövning av dammar samt annan reglering om hur verksamheten vid dammarna ska bedrivas. För gruvdammar finns sedan 2008 en särskild reglering om bl.a. säkerhet i förordningen (2008:722) om utvinningsavfall. I sammanhanget kommer utredningen även mycket kort redogöra för de delar av plan- och bygglagen (2010:900) (PBL) som berör dammars säkerhet.

Lagen (2003:778) om skydd mot olyckor (LSO) innehåller bestämmelser som reglerar hur räddningstjänsten och beredskapen ska vara organiserad och planerad för att möjliggöra effektiva räddningsinsatser, se kapitel 12. Därutöver finns bestämmelser i elberedskapslagen (1997:288) om åtgärder för beredskap i elförsörjningen samt säkerhetsskyddslagen (1996:627) och skyddslagen (2010:305) om åtgärder för säkerhetsskydd, skydd mot sabotage, terrorism och spioneri, se kapitel 13.

Den huvudsakliga regleringen kring dammar och den verksamhet som bedrivs i anslutning till dammen finns i MB. Utredningen inleder därför med en redogörelse för MB för att sedan i kommande kapitel redogöra för övrig relevant lagstiftning.

3.2. Övergripande regler i miljöbalken

Efter ett omfattande och långvarigt lagstiftningsarbete som inleddes år 1989 trädde MB i kraft den 1 januari 1999. Den centrala miljörättsliga lagstiftningen hade då samlats i ett regelverk som

ersatte sexton mer eller mindre utpräglade miljölagar, bl.a. miljöskyddslagen (1969:387), hälsoskyddslagen (1982:1080) och vattenlagen (1983:291). Vissa delar av den redan omfångsrika vattenlagen infogades inte i MB då de enligt förarbetena inte ansågs ha anknytning till de centrala miljöfrågorna. Vattenrättsligt specifika regler sammanfördes i stället i den nya lagen (1998:812) med särskilda bestämmelser om vattenverksamhet (LSV) där frågor om t.ex. rådighet över vatten, vattenrättsliga samfälligheter och avgifter regleras. I detta sammanhang kan det erinras om att vattenrättsliga regler inarbetades i MB under ett ganska sent skede av arbetet med en samlad miljölagstiftning (se bl.a. prop. 1997/98:45 del 1 s. 364 ff). Vattenlagens regler fördes sålunda in i sitt nya sammanhang i MB utan någon mera genomgripande bearbetning. Den mest synbara förändringen var att vattenlagens term vattenföretag byttes till vattenverksamhet i MB utan betydelse för den sakliga innebörden.

Efter en översiktlig genomgång av MB:s centrala samt allmängiltiga och övergripande bestämmelser i balkens första avdelning återkommer utredningen till regler om vattenverksamhet med särskilt intresse för frågan om dammsäkerhet. Det ska sägas att regler om specifika institut, t.ex. miljökonsekvensbeskrivningar, inte bedömt behöva tas upp här.

Innan utredningen redogör för de rättsliga regleringar som berör dammsäkerhet behöver vissa begrepp klargöras. I betänkandet används bl.a. begreppet dammägare och verksamhetsutövare synonymt. Med dessa begrepp avses den som äger eller annars är underhållsskyldig enligt 11 kap. 17 § MB. Likaså används begreppen dammbrott och dammhaveri synonymt med varandra i texten. Se mer om dessa begrepp och vad som avses i avsnitt 8.1.

3.2.1. Miljöbalkens mål

MB:s mål och hur det ska nås anges med mycket allmänt hållna formuleringar i 1 kap. 1 §. Samtliga bestämmelser i MB ska tillämpas på ett sådant sätt att balkens mål och syfte bäst tillgodoses. Det innebär att även de regler i MB som är av relevans för dammsäkerheten ska tolkas i ljuset av denna portalparagraf.

3.2.2. Allmänna hänsynsregler

2 kap. MB innehåller bl.a. allmänna hänsynsregler som anger de grundläggande materiella miljökraven och talar om vad som krävs i sak för att skydda miljön. Reglerna omfattar både verksamheter och åtgärder som på något sätt inverkar på de intressen som anges i målregeln. Åtgärder som är av försumbar betydelse i det enskilda fallet omfattas inte av de allmänna hänsynsreglerna. Vad som rent allmänt är verksamhet eller åtgärd definieras inte i balken, men som senare ska redovisas definieras exempelvis vattenverksamhet. Åtgärd bör emellertid vara något som inträffar momentant. Till skillnad från begreppet åtgärd är en verksamhet något som bedrivs mer varaktigt, antingen kontinuerligt eller återkommande.1 Med verksamhet avses både näringsverksamhet och sådan verksamhet som inte bedrivs yrkesmässigt.

Reglerna är allmänt hållna och ska beaktas vid all tillämpning av balken. Tillsynsåtgärder kan vidtas med stöd direkt av hänsynsreglerna. Vad en verksamhetsutövare behöver vidta för åtgärder eller kunna om sin verksamhet får avgöras i varje enskilt fall efter vad som är rimligt i förhållande till nytta och kostnad.

Kapitlet inleds med en s.k. bevisbörderegel som gäller vid frågor om tillåtlighet, tillstånd, godkännande och dispens. Bevisbörderegeln gäller även vid tillsyn. En verksamhetsutövare ska alltså kunna visa för tillsynsmyndigheten att den verksamhet som bedrivs eller den åtgärd som vidtas inte medför effekter eller på annat sätt motverkar miljöbalkens mål. Man brukar här prata om omvänd bevisbörda.

De egentliga hänsynsreglerna inleds med kunskapskravet i 2 kap. 2 §. I fråga om dammar bör kravet på kunskap vara lika oavsett om det är en större eller mindre ägare. Det är dammens effekt på omgivningen som avgör. Kunskapskravet är allmänt hållet men konkretiseras genom bestämmelsen om verksamhetsutövarens egenkontroll i 26 kap. 19 §. Av den bestämmelsen följer att en verksamhetsutövare ska fortlöpande planera och kontrollera sin verksamhet för att motverka eller förebygga olägenheter för människors hälsa eller miljön. Detta ska uppnås genom att verksamhetsutövaren genomför egna undersökningar eller på annat sätt håller sig underrättad om verksamhetens eller åtgärdens påverkan. Likaså kan tillsynsmyndigheten förelägga verksamhetsutövaren om att utreda vissa frågor och begära in uppgifter. Kunskapskravet kan

1 Michaneck, Den svenska miljörätten, 2:a uppl., s. 115.

också motivera att ett företag som sysslar med påtagligt miljöfarlig verksamhet åläggs att fortlöpande hålla sig med viss kompetens2. Miljööverdomstolen fann i avgörandet MÖD 2011:45 att en tillsynsmyndighet kunde förelägga en verksamhetsutövare att tillse att undersökningar utförs av en oberoende ackrediterad provtagare. Tillsynsmyndigheten i fråga hade anfört att föreläggandet var motiverat i de fall verksamhetsutövaren inte har tillräcklig kompetens för att utföra utredningarna eller att det finns risk för att någon vars trovärdighet kan ifrågasättas utför utredningen. Kunskapskravet kan däremot inte läggas till grund för ett föreläggande om att verksamhetsutövaren ska inkomma med konkreta förslag på åtgärder, jfr MÖD 2004:23.

MB:s grundläggande hänsynsregel brukar kallas försiktighetsprincipen och regleras i 2 kap. 3 §. Förenklat uttryckt ska de försiktighetsmått vidtas som behövs för att undvika olägenhet eller skada för människors hälsa eller miljön. Vilka försiktighetsmått som ska vidtas får avgöras i varje enskilt fall. I förarbetena till MB exemplifieras ett antal försiktighetsmått. För vattenanläggningar anges att bl.a. att dammar ska byggas så att de uppfyller säkerhetskrav.3

Samma paragraf innehåller även ett stadgande om att bästa möjliga teknik ska användas vid yrkesmässig verksamhet. Vad som är bästa möjliga teknik utgör grund för prövningen av frågan om skyddsåtgärder och försiktighetsmått enligt försiktighetsprincipen.

Till de allmänna hänsynsreglerna hör hushållnings- och kretsloppsprincipen samt regler i 2 kap. 6 § om vilka krav som ska ställas på lokaliseringen av en verksamhet eller åtgärd som tar i anspråk mark– eller vattenområde.

De krav som hänsynsreglerna skapar ska genomgå en rimlighetsavvägning enligt skälighetsregeln i 2 kap. 7 §. Proportionen mellan den nytta för människors hälsa och miljön som skyddsåtgärden eller försiktighetsmåttet medför får inte vara orimlig med hänsyn till de kostnader som åtgärderna föranleder. Som framgår av lagtexten är det verksamhetens utövare, eller den som vill vidta en åtgärd, som ska visa att ett krav på skyddsåtgärd eller andra försiktighetsmått i det enskilda fallet är orimligt.

Slutligen finns i 2 kap. 9 § en särskild s.k. stoppregel. Med stöd av den kan sådana verksamheter eller åtgärder förbjudas som riske-

2 Bengtsson m.fl., Miljöbalken (1 jan. 2011, Zeteo) kommentaren 2 kap. 2 §. 3Prop. 1997/98:45 del 2, s. 18.

rar att föranleda skada eller olägenhet av väsentlig betydelse för människors hälsa eller miljön.

3.3. Vattenverksamhet

Regler om vattenverksamhet finns i 11 kap. MB, LSV samt i förordningen (1998:1388) om vattenverksamhet.

Definitionen av vattenverksamhet framgår av 11 kap. 2 § MB och innebär t.ex. att uppförande av dammbyggnader, vägbankar, bropelare, kabeldragning liksom ändring, lagning och utrivning av sådana anläggningar utgör sådan verksamhet.

Vattenanläggning

En anläggning som kommit till genom en vattenverksamhet utgör en vattenanläggning enligt 11 kap. 3 § MB. Enligt samma paragraf ingår i begreppet vattenanläggningen även manöveranordningar till anläggningen. Manöveranordningarna behöver inte befinna sig på den plats där det fysiska ingreppet i vattenförhållandena sker för att anses ingå i vattenanläggningen.

Vattenområde

Med vattenområde avses enligt 11 kap. 4 § MB ett område som täcks av vatten vid högsta, förutsebara vattenstånd. Det avser ytvattenområden, såsom sjöar, vattendrag, diken och kärr, liksom vissa konstgjorda vattensamlingar, bl.a. regleringsmagasin och bevattningsdammar.

Punkten 4 i 11 kap. 2 § MB avser markavvattning. Hit räknas sänkning och urtappning av ett vattenområde. Detta gäller inte bara sjöar utan även andra vattenområden. Reglering, liksom fördjupning, utvidgning och rätning av ett vattendrag för att skydda mot översvämning, är också att hänföra till markavvattning. Anläggande av vallar och liknande anläggningar i eller invid ett vattenområde till skydd mot vattnet (invallning) är också att hänföra till markavvattning.4

4 Bengtsson m.fl., Miljöbalken (1 jan. 2011, Zeteo) kommentaren 11 kap. 2 §.

För att utgöra en markavvattning i MB:s mening ska syftet med åtgärden vara att varaktigt öka markens lämplighet för något visst ändamål, såsom odling, bebyggelse eller torvtäkt. Det är effekten av markavvattningen som ska vara varaktig. Av varaktighetskravet följer vidare att en invallning i samband med en tillfällig översvämning inte är markavvattning. Kravet på varaktighet är dock uppfyllt när invallningen avses bli kvar för att skydda även mot framtida översvämningar.5

Vattenreglering

Vattenreglering är enligt 11 kap. 5 § MB en ändring av vattenföringen i ett vattendrag till förmån för annan vattenverksamhet. En sådan annan vattenverksamhet kan vara bortledning (avledning) av vattnet för ett kraftutnyttjande (jfr avsnitt 2.2.2).

Vattenreglering kan delas in i tre typer, nämligen flerårsreglering, årsreglering och korttidsreglering. Med en flerårsreglering avser man att spara vatten i ett magasin under ett vattenrikt år för att ta ut det under senare, vattenfattiga år. Årsreglering innebär att vatten hålls inne i magasinet under vattenrika delar av ett år – framför allt i samband med vårfloden – för att avtappas senare under samma regleringsår, när vattenföringen är otillräcklig. Korttidsreglering sker genom att vatten sparas på sådana tider av veckan eller dygnet – huvudsakligen söndags- och helgdygn resp. nattetid – då kraftverkens belastning är minst för att utnyttjas när kraftbehovet är större och kraften således har ett högre värde.6

3.3.1. Tillstånds- eller anmälningsplikt

Av 11 kap. 9 § MB följer att som huvudregel krävs tillstånd för vattenverksamhet. Tillstånd söks enligt 11 kap. 9 b § hos mark- och miljödomstolen med undantag för tillstånd till markavvattning för vilket tillstånd söks hos länsstyrelsen med vissa i paragrafen angivna undantag.

I stället för tillståndsplikt gäller anmälningsplikt enligt 11 kap. 9 a § för vissa verksamheter som finns angivna i 19 § i förordningen (1998:1388) om vattenverksamhet. Anmälan ska ges in till läns-

5 Bengtsson m.fl., Miljöbalken (1 jan. 2011, Zeteo) kommentaren 11 kap. 2 §. 6 Bengtsson m.fl., Miljöbalken (1 jan. 2011, Zeteo) kommentaren 11 kap. 5 §.

styrelsen i dess egenskap av tillsynsmyndighet. Även om det inte krävs tillstånd kan den som vill bedriva vattenverksamhet ändå ansöka om tillstånd för verksamheten. Likaså kan tillsynsmyndigheten förelägga verksamhetsutövaren att ansöka om tillstånd om det behövs med hänsyn till verksamhetens påverkan på miljön eller enskilda intressen, se 23 § första stycket 2b och andra stycket förordningen om vattenverksamhet. Möjligheten att förelägga om tillståndsplikt gäller i detta sammanhang endast anmälningspliktig verksamhet, se dock avsnitt 3.6.3 om föreläggande med stöd av 26 kap. 9 § MB.

Till skillnad från miljöfarlig verksamhet behövs enligt 11 kap. 12 § inte tillstånd eller anmälan om det är uppenbart att varken allmänna eller enskilda intressen skadas genom vattenverksamhetens inverkan på vattenförhållandena. Det är verksamhetsutövaren som har bevisbördan för att förutsättningarna i paragrafen är uppfyllda och beviskravet är strängt.

Kravet på att förhållandet ska vara uppenbart innebär att tillstånds- eller anmälningsplikten omfattar i princip all slags verksamhet av någon betydelse. För dammar är kravet på tillstånd undantagslöst.7

3.3.2. Underhållsansvar

Enligt 11 kap. 17 § MB är den som äger en vattenanläggning skyldig att underhålla den så att det inte uppkommer skada för allmänna eller enskilda intressen genom ändringar i vattenförhållandena. Underhållsskyldigheten gäller vattenanläggningar, oavsett om tillstånd till dem har lämnats eller inte. Kraven på skötsel och underhåll varierar med hänsyn till vattenverksamhetens och anläggningens art och omfattning. Störst krav bör enligt MB:s förarbeten ställas på dammar. Även relativt små kraftverks- och regleringsdammar kan orsaka svåra skador om de brister.8 Underhållsskyldigheten gäller så länge anläggningen finns kvar.

Underhållsansvaret innebär att ägaren är skyldig inte bara att utföra löpande reparationer utan även att bygga om en anläggning som har tjänat ut. Sådana delar av anläggningen som saknar betydelse för någon annan än ägaren behöver däremot inte behållas. Redan vid anläggningens tillkomst är ägaren skyldig att se till att

7Prop. 1997/98:45 del 2, s. 135. 8Prop. 1997/98:45 del 2, s. 139.

det inte uppkommer någon fara för skada på motstående intressen genom ett felaktigt utförande eller användning av bristfälligt material. Även om anläggningen inte vidare ska användas får den inte lämnas i ett sådant skick att det är risk för att den orsakar skada.9

Om vattenanläggningen med stöd av en särskild rättighet utförts på någon annans mark och äganderätten till anläggningen övergått till markägaren till följd av att rättigheten upphört, kvarstår ändå underhållsskyldigheten för den som en gång var rättighetshavare.

Vilka anläggningar som en underhållsansvarig kan tänkas svara för har belysts i ett avgörande från Miljööverdomstolen, MÖD 2007:45. En dammägare ansågs underhållsansvarig för vägbana och räcken på en bro trots att dessa ingick i en gemensamhetsanläggning som förvaltades av en samfällighetsförening. Dammägaren hade i samband med tillståndsprövningen ålagts såsom kompensationsåtgärd att uppföra en bro över en älv för att vinterväg och färja inte kunde användas till följd av vattenreglering. Dessa delar hörde därför enligt domstolen till anläggningen och omfattades därmed av dammägarens underhållsansvar.

Utredningen kommer att återkomma till bestämmelsens tilllämpning i fråga om dammsäkerhet i avsnitt 3.7.2.

En dammägare eller den som annars är underhållsskyldig enligt 11 kap. 17 § MB kan ansöka hos mark- och miljödomstolen om utrivning av dammen med stöd av 11 kap. 19 § MB. Dammägaren kanske inte längre har användning av dammen och vill inte längre ha underhållsansvaret för densamma.

För utrivningen gäller mål- och hänsynsreglerna i 1 och 2 kap. MB. T.ex. ska försiktighetsmått vidtas för att skador och olägenheter förebyggs vid själva utrivningen och för framtiden. Domstolen ska när den lämnar tillstånd även meddela villkor om bl.a. återställningsåtgärder.

Enligt paragrafens ordalydelse ska tillstånd till utrivning alltid lämnas om inte ett förordnande om överflyttning av underhållsskyldigheten meddelas enligt 11 kap. 20 § MB. Sistnämnd paragraf innehåller bestämmelser om möjlighet för ägaren av en fastighet som skulle skadas av utrivningen att genom förordnande av domstol ta över underhållsansvaret för en vattenanläggning som ägaren eller annan underhållsskyldig vill riva ut. Till skydd för allmänna intressen får ett sådant förordnande också meddelas för staten, en

9 Bengtsson m.fl., Miljöbalken (1 jan. 2011, Zeteo) kommentaren 11 kap. 17 §.

kommun eller ett vattenförbund. Miljööverdomstolen har emellertid i ett visst fall, MÖD 2008:46, ansett att rätten till utrivning inte är ovillkorlig.

3.3.3. Dammägarens ansvar vid dammhaveri

Enligt 11 kap. 18 § MB ska den som är skyldig att underhålla en dammanläggning för vattenreglering ersätta skada som orsakas av att anläggningen inte ger avsett skydd mot utströmmande vatten (dammhaveri). Det gäller även om varken den underhållsskyldige eller någon som den underhållsskyldige svarar för har vållat skadan. Det föreligger således ett strikt skadeersättningsansvar. Bakgrunden till regeln har kort berörts i avsnitt 2.6.8.

Skadeståndsskyldigheten omfattar endast dammanläggningar för vattenreglering, varvid kraftverksdammar för strömkraftdrift kan omfattas. Sådana dammar som annars avser att skydda mot vatten, t.ex. i händelse av översvämning, eller tidigare satts upp för att underlätta flottning faller däremot inte under bestämmelsen.10Även gruvdammar faller utanför bestämmelsen.

Det innebär att ägaren av dessa anläggningar har ett ansvar oberoende av eget vållande. Skadorna vid ett dammhaveri samt kostnaderna för att åtgärda dem kan bli omfattande. Ansvaret såsom det är reglerat i MB är inte begränsat till något belopp.

Ansvaret förutsätter att dammen inte ger ett avsett skydd mot utströmmande vatten, dammhaveri. Ett dammhaveri föreligger både om dammen hastigt havererar och om den så småningom eroderas och skador uppkommer nedströms. Även när dammen på grund av felmanövrering inte skyddar på avsett sätt föreligger ett dammhaveri i bestämmelsens mening. Dammhaveri föreligger däremot inte när dammen fullgör sin funktion men vattnet ändå strömmar över den och orsakar skada. I det sistnämnda fallet blir inte dammägaren ansvarig enligt bestämmelsen men kan ändå vara ersättningsskyldig på annan grund, t.ex. enligt skadeståndslagen. Är dammen t.ex. i så dåligt skick att ett fordon kör av den ned i vattnet eller en sten faller ned på personer som uppehåller sig under dammen, får skadeståndsfrågan bedömas enligt allmänna regler. Ofta föreligger då vållande på dammägarens sida.11

10Prop. 1997/98:45 del 2, s. 140. 11Prop. 1996/97:46 s. 15.

Lagtexten och förarbetena tyder på att lagstiftaren avsett skador nedströms dammen. Dammhaveriet kan emellertid också ha orsakat skador uppströms, t.ex. ras och skred, samt på tekniska föremål. Även sådana skador brukar inbegripas i dammsäkerhetsfrågorna.12

Om en skada uppstår genom ett dammhaveri, blir den underhållsskyldige ansvarig oberoende av vållande, såvida han eller hon inte kan visa att ett sådant undantag föreligger som anges i andra stycket. Ansvaret omfattar skador av alla slag – alltså även ren förmögenhetsskada, t.ex. när någon drar på sig kostnader för att föra undan hotad egendom eller får avbryta en förvärvsverksamhet utan att någon sak- eller personskada inträffar. Skadeståndet bestäms enligt de allmänna reglerna i 5 och 6 kap. skadeståndslagen (jfr 1 kap. 1 § skadeståndslagen) och inte enligt 32 kap. MB. Talan om skadestånd för dammhaveri handläggs av mark- och miljödomstol som stämningsmål, se 7 kap. 2 § 10 LSV.

Andra stycket undantar den underhållsskyldige från ansvar, om denne visar att dammhaveriet orsakats av en krigshandling eller liknande handling under väpnad konflikt, inbördeskrig eller uppror. Sabotage eller skador till följd av fordon eller andra transportmedel omfattas inte av undantaget.

Trots att en skada inte omfattas av det strikta ansvaret i 11 kap. 18 § MB kan skadeståndsskyldighet ändå föreligga enligt allmänna skadeståndsrättsliga principer.

3.3.4. Ansvarsgenombrott

Ett obegränsat skadeståndsansvar är emellertid inte någon garanti för att de skadelidande får full täckning för sina skador. Oavsett om strikt ansvar föreligger eller inte begränsas möjligheten att erhålla ersättning av ägarens ekonomiska förutsättningar och försäkringar.

En ägare som omfattas av strikt ansvar kan vara ett aktiebolag ingående i en koncern med moderbolag i Sverige eller i annat land. Om dammägarföretagets ekonomiska förmåga, med eller utan försäkring, inte räcker till för att täcka skadorna kan det bli fråga om att kräva styrelserepresentanter eller aktieägarna på ersättning, s.k. ansvarsgenombrott.

12 Bengtsson m.fl., Miljöbalken (1 jan. 2011, Zeteo) kommentaren 11 kap. 18 §.

En grundläggande princip inom aktiebolagsrätten är att aktieägarna i ett aktiebolag inte har något personligt betalningsansvar för bolagets förpliktelser och att det endast kan förekomma i undantagsfall, se 1 kap. 3 § aktiebolagslagen (2005:551). Det gäller oavsett om aktieägaren är en fysisk eller juridisk person. Med ansvarsgenombrott avses att en domstol tillåter, i strid med nämnda princip, att aktieägaren personligen görs ansvarig för bolagets förpliktelser trots att de inte överträtt någon regel i aktiebolagslagen eller brustit i någon fullgörelse gentemot bolaget.

Hur en fråga om ansvarsgenombrott skulle bedömas i fall av ersättningskrav på grund av dammhaveri är i dagsläget oklart. Det ligger inte i utredningens hand att utreda omfattningen och innebörden av skadeståndsansvaret vid dammhaveri och vad som gäller beträffande ansvarsgenombrott om ett dammbrott inträffar. Frågan är trots detta enligt utredningens mening angelägen allt eftersom förändringar sker i kraftbolagens ägarförhållanden. Ett dammhaveri kan få omfattande konsekvenser där ett enskilt bolag inte har möjlighet att svara för den ekonomiska kompensationen. Systemet för ansvarsförsäkringar eller annan ekonomisk säkerhet bör därför ses över för dammar. I samband med det bör ägarförhållandena för dammarna kartläggas och hur dessa förhållanden kan påverka en skadelidandes möjlighet att erhålla ersättning för skadorna orsakade av dammhaveri.

Införandet av en reglering om ansvarsgenombrott har dock nyligen belysts på miljörättens område och i fråga om kärnkraft.13Nedan redogörs kort för dessa utredningars överväganden.

Miljöansvarsutredningens överväganden

Miljöansvarsutredningen hade i uppdrag att undersöka och analysera behovet och konsekvenserna av en bestämmelse om ansvarsgenombrott på miljörättens område. Utredningens uppdrag omfattade bl.a. att föreslå de författningsändringar som krävdes för genomförandet i svensk rätt av Europaparlamentets och rådets direktiv 2004/35/EG, miljöansvarsdirektivet.

Miljöansvarsutredningen konstaterade att ansvarsgenombrott kommit i fråga i fall där bolag inte bedrivit någon självständig verksamhet eller haft en självständig ställning till moderbolaget eller

13 Ett utvidgat miljöansvar, SOU 2006:39 och Kärnkraft – nya reaktorer och ökat skadeståndsansvar, SOU 2009:88.

andra ägare. Det har även varit fråga om en situation som på något sätt var exceptionell. 14

Av tidigare behandling av frågan framgick att tidigare utredningar inte hade kunnat visa på ett reellt behov av en bestämmelse om ansvarsgenombrott som uppvägde de nackdelar om införandet av en sådan reglering skulle vara förknippad med.15 Miljöansvarsutredningen förordade därför inte att en regel om ansvarsgenombrott infördes. Vidare menade Miljöansvarsutredningen att behovet av en regel om ansvarsgenombrott skulle minska genom dess förslag till en utvidgning av verksamhetsutövarbegreppet i MB innebärande att detta begrepp även skulle omfatta den som kontrollerar verksamheten.

Regeringen fann i likhet med utredningen inte skäl att införa en regel om ansvarsgenombrott. Något behov av en sådan regel förelåg inte.16 Till skillnad från utredningen ansåg regeringen inte heller att det skulle införas ett mer omfattande verksamhetsutövarbegrepp.17

Kärnkraftutredningens överväganden

Kärnkraftutredningen konstaterade att såväl den tidigare Atomansvarsutredningen som Miljöansvarsutredningen funnit att någon regel om ansvarsgenombrott inte skulle införas i svensk lagstiftning. Mot bakgrund av tidigare utredningars överväganden och med anledning av den korta utredningstiden gjorde kärnkraftsutredningen inte heller någon annan bedömning i frågan. Däremot framhölls att det skulle vara intressant att i framtiden överväga om ett svårt reaktorhaveri med oöverskådliga konsekvenser skulle kunna vara en sådan exceptionell situation som berättigar till ett ansvarsgenombrott.18

Kärnkraftutredningen föreslog däremot bl.a. att ett obegränsat skadeståndsansvar skulle införas för kärnkraftsindustrin. Det obegränsade skadeståndsansvaret ska enligt utredningens förslag vara finansiellt garanterat av anläggningsägaren genom en ansvarsförsäkring eller annan ekonomisk säkerhet som motsvarar 700 miljoner euro. En innehavare av en kärnkraftsreaktor ska dessutom säker-

14SOU 2006:39, s. 232 ff. 15SOU 2006:39, s. 239-250. 16Prop. 2006/07:95 s. 99 f. 17Prop. 2006/07:95 s. 58. 18SOU 2009:88, s. 378.

ställa ekonomiska medel motsvarande 500 miljoner euro. Sammanlagt ska en anläggningsinnehavare ha 1 200 miljoner euro tillgängliga för varje olycka för att ersätta skadelidande.19 Bestämmelserna finns införda i lagen (2010:950) om ansvar och ersättning vid radiologiska olyckor som ännu inte trätt i kraft.

3.4. Tillståndsprövningen enligt miljöbalken

Tillstånd till vattenverksamhet söks enligt 11 kap. 9 b § MB hos mark- och miljödomstol. Vad en ansökan ska innehålla anges i 22 kap. 1 § MB. Bl.a. anges att ansökan ska innehålla ritningar och tekniska beskrivningar med uppgifter om förhållandena på platsen, en miljökonsekvensbeskrivning, förslag till skyddsåtgärder eller andra försiktighetsmått samt de övriga uppgifter som behövs för att bedöma hur de allmänna hänsynsreglerna i 2 kap. iakttas. Ansökan ska även innehålla förslag till övervakning och kontroll av verksamheten. I mål om vattenverksamhet ska ansökan dessutom innehålla uppgift om det finns fastigheter som berörs av vattenverksamheten eller inte.

Enligt 7 kap. 4 § LSV ska en ansökan som avser utförande av ett vattenkraftverk innehålla uppgift om det område som enligt sökanden bör utgöra strömfallsfastighet och ritningar jämte beskrivning av strömfallets läge.

Utöver ovanstående krävs även rådighet över det aktuella vattenområdet, se 2 kap. 1 § LSV. Rådighet är en processförutsättning vid en tillståndsansökan och en sökande ska styrka sin rådighet20. Om sökanden inte har rådighet ska ansökan avvisas. För vattenreglering är rådigheten särskilt reglerad i 2 kap. 4 § LSV.

Enligt 11 kap. 6 § MB får en vattenverksamhet bedrivas endast om dess fördelar från allmän och enskild synpunkt överväger kostnaderna samt skadorna och olägenheterna av den. Syftet är att hindra vattenverksamhet eller tillkomsten av en vattenanläggning som inte är samhällsekonomiskt motiverad. Den samhällsekonomiska bedömningen ska baseras på en ekonomisk analys av rimlig omfattning.

Efter det att verksamhetsutövaren lämnat in ansökan med miljökonsekvensbeskrivningen till mark- och miljödomstolen tar domstolen ställning till om inlämnat underlag är tillräckligt. Bedö-

19SOU 2009:88, s. 366 f. 20 Se bl.a. NJA 1993 s. 331.

mer domstolen att underlaget inte är tillräckligt kan sökanden föreläggas att komplettera sin ansökan med erinran om att den annars kan avvisas. När ansökan väl är komplett kungörs den och skickas på remiss till de i 22 kap. 4 § angivna myndigheterna och kommunala nämnden.

I 11 kap. 6 § andra stycke hänvisas till 19 och 20 §§elberedskapslagen (1997:228). Enligt dessa bestämmelser får inte ett mål i domstol enligt 11 kap. MB avgöras innan föreskriven prövning har skett enligt elberedskapslagen.

Om dom meddelas ska den innehålla de angivna punkterna i 22 kap. 25 §. Vad gäller vattenverksamhet finns det särskilda bestämmelser om domens innehåll i 7 kap. 6 § LSV.

3.4.1. Särskilt om säkerheten vid prövningen

I tillståndsdomen ska bl.a. anges verksamhetens säkerhet och tekniska utformning i övrigt, se 22 kap. 25 § 2 MB. Bestämmelsen infördes ursprungligen i 13 kap. 47 § vattenlagen genom en lagändring som initierades av Dammsäkerhetsutredningen (SOU 1987:64) och som formulerades slutligt i propositionen 1988/89:116 s. 27 f. Bakgrunden till bestämmelserna berörs kort i avsnitt 2.6.6. Tidigare hade det i lag endast reglerats att den tekniska utformningen skulle anges. Av nyss nämnda förarbeten framgick att domstolen vid prövningen ändå beaktade säkerhetsaspekten även om det inte fanns några särskilda föreskrifter om detta. Eftersom frågan om säkerheten var så betydelsefull fanns det skäl att ta upp den i lagtexten.

Däremot anfördes det i samma proposition att det inte borde ankomma på tillståndsmyndigheten att meddela bestämmelser om att upprätta beredskapsplaner, att utse dammansvarig eller att föreskriva regelbundna övningar med personalen såsom hade föreslagits av Dammsäkerhetsutredningen. Enligt förarbetena skulle det inte ankomma på tillståndsmyndigheten att meddela bestämmelser som omfattas av annan lagstiftning, exempelvis den dåvarande räddningstjänstlagen. Tillståndsmyndigheten skulle inte heller i strid med vattenlagens tillsynsregler meddela bestämmelser som innebar intrång i länsstyrelsens tillsynsverksamhet. Säkerhetsaspekterna i fråga skulle således endast avse den tekniska utformningen av ett vattenföretag. Med det avsågs enligt vattenlagens förarbeten anläggningens konstruktion och hållfasthet, grundläggning, utskovens

avbördningsförmåga, krönhöjd, släntlutning osv. (prop. 1981/82:130 s. 128).

I 7 kap. 7 § LSV regleras en möjlighet för tillståndsmyndigheten att i tillståndet föreskriva särskilda bestämmelser om innehållande av tappning av vatten för att under osedvanliga förhållanden tillgodose säkerheten hos en vattenanläggning. Frågan om ersättning kan i sådana fall skjutas upp. Motsvarande bestämmelse fanns i 13 kap. 49 a § vattenlagen och infördes också genom lagändringen som motiverades i prop. 1988/89:116 s. 29 f. I förarbetena till bestämmelsen anfördes att ett sätt att till måttliga kostnader och med förhållandevis små skadeverkningar förbättra säkerheten vid befintliga och planerade dammbyggnader var att meddela särskilda vattenhushållningsbestämmelser. Sådana bestämmelser skulle göra det möjligt att genom överdämning eller annan tappning än normalt dämpa eller omdisponera flöden som hotar dammbyggnadens säkerhet. De särskilda hushållningsbestämmelserna skulle endast få tillämpas i exceptionella situationer när anläggningens säkerhet allvarligt hotas. Eftersom det är ovisst när bestämmelserna blir tilllämpliga är det svårt eller omöjligt att uppskatta några skador på förhand.

3.4.2. Prövning i efterhand

Om det till följd av en skada eller för att förebygga en skada fordras att ändrings- eller lagningsarbeten måste utföras genast kan prövningsplikten enligt 11 kap. 16 § iakttas i efterhand. Av paragrafens andra stycke framgår att vatten får innehållas eller tappas i strid mot tillståndet om det är nödvändigt för att avvärja fara för liv eller hälsa, rädda värdefull egendom eller av någon annan sådan orsak. Skydd för miljön bör anses omfattas av begreppet annan sådan orsak.

Paragrafens andra stycke infördes liksom ovan angivna bestämmelse om säkerhet i tillståndsdomar genom lagändringen som behandlades i prop. 1988/89:116 s. 31 f. Av förarbetena följer att initiativet till lämpliga skyddsåtgärder i första hand ska komma från dammägaren. Det är denne som är bäst skickad att under svåra förhållanden i tidsnöd avgöra valet av åtgärder. Anläggningens ägare har dessutom kunskaper om driften vid anläggningen och dess kapacitet samt ett intresse av att anläggningen inte äventyras. Det

finns också ett intresse hos ägaren att åtgärderna är välavvägda och inte orsakar onödig skada med ökade ersättningskrav som följd.

Det är som sagt regleringsrättsinnehavaren som enligt bestämmelsen kan fatta beslut om att inte följa tillståndet. Det krävs dock alltid ett godkännande av mark- och miljödomstol i efterhand. Tillståndshavaren får stå för eventuella skador om uppstått på grund av att tillståndet frångåtts – även om andra större skador kunnat undvikas på detta sätt.

Ansökan om godkännande ska göras snarast möjligt. Miljööverdomstolen har i rättsfallet MÖD 2008:21 ansett att länsstyrelsen som tillsynsmyndighet haft rättsligt stöd enligt 26 kap. 1 och 9 §§ MB att förelägga en verksamhetsutövare att ansöka i efterhand om godkännande av åtgärder som vidtagits med stöd av 11 kap. 16 § MB utan föregående tillstånd.

3.4.3. Prövningens omfattning vid dammsäkerhetshöjande åtgärder

För det fall en dammägare vill vidta åtgärder för att höja säkerheten vid en anläggning kan dessa åtgärder kräva tillstånd. Det kan vara fråga om att bygga ytterliga utskov, förstärka delar av dammkroppen eller anlägga ytterligare erosionsskydd. Frågan om hur omfattande en sådan prövning ska vara har berörts i praxis.

I avgörandet MÖD 2009:44 hade domstolen att pröva en ansökan om att få bygga om regleringsdammen för att underhålla och förbättra säkerheten vid dammen. Domstolen konstaterade att verksamhetsutövaren i fråga hade ett rättskraftigt tillstånd att under vissa villkor reglera vattenståndet vid och driva en kraftstation. Syftet med aktuell tillståndsansökan var endast att underhålla och förbättra säkerheten vid dammen. En sådan ansökan kunde inte enligt domstolen föranleda en omprövning av hela verksamheten vid kraftstationen eller av villkor som inte hade direkt samband med ombyggnaden. Av miljödomstolens bedömning, som delades av överinstansen, framgår även att principen om en samlad bedömning av hela verksamheten gäller endast miljöfarlig verksamhet och att den inte alls var tänkt för vattenverksamhet.

Rådande rättsläge får anses vara att i de fall ansökan endast avser dammsäkerhetshöjande åtgärder kan prövningen endast avse dessa åtgärder. Däremot om ansökan avser åtgärder som t.ex. kan effekti-

visera driften vid kraftverket för att kunna utvinna mer kraft kan omfattningen av prövningen bli en annan, se MÖD 2009:37.

Utredningen om vattenverksamheter, kommittédirektiv 2012:29, har fått i uppdrag att föreslå hur tillståndsprövningen av vattenverksamheter kan ändras i syfte att hela verksamheten ska prövas i de fall en verksamhetsutövare önskar ändra en anläggning eller driften av en verksamhet.

3.4.4. Ett tillstånds rättskraft

En dom eller beslut om tillstånd gäller enligt 24 kap. 1 § MB mot alla såvitt avser frågor som har prövats i domen eller beslutet efter det att domen eller beslutet vunnit laga kraft. Det innebär att alla som har kunnat föra talan i målet blir bundna av domen, såväl enskilda sakägare som företrädare för de allmänna intressena. Det gäller även om någon inte blivit kallad i vederbörlig ordning eller fört talan i målet.

Som följer av paragrafens ordalydelse omfattas inte anmälan enligt 11 kap. 9 a § MB av rättskraft. En anmäld vattenverksamhet gäller således inte mot alla såvitt avser de bedömningar som gjorts i anmälningsärendet. En anmäld vattenverksamhet kan även i alla delar angripas genom tillsynsåtgärder från tillsynsmyndigheten.

Tillståndet ger därmed verksamhetsutövaren en trygghet. Den tillståndshavare som följer villkoren i sitt tillstånd behöver normalt inte befara att det allmänna ställer ytterligare krav med stöd av hänsynsreglerna, i vart fall inte beträffande sådana frågor som har prövats vid tillståndsgivningen.21

Rättskraften av en dom eller beslut i ett stämningsmål har inte rättskraft gentemot det allmänna eller andra än de som varit parter i målet. Inte heller beslut i tillsynsärenden har rättskraft mot utomstående. Nya eller mer ingripande förelägganden kan meddelas om förutsättningar föreligger.

Ett lagakraftvunnet tillstånd kan däremot angripas med extraordinära rättsmedel enligt rättegångsbalken dvs. begäran om resning, återställande av försutten tid eller domvillobesvär. Om domen upphävs eller ändras enligt bestämmelserna om extraordinära rättsmedel upphävs även rättskraften i berörda delar.

21Prop. 1997/98:45 del 2, s. 252.

3.4.5. Äldre tillstånds rättskraft

Många av de vattenkraftanläggningar och dammar som finns uppförda i Sverige är uppförda med tillstånd meddelade enligt äldre lagstiftning. Vissa anläggningar kan även vara uppförda för så länge sedan att ägaren gör gällande en rätt att bibehålla dem grundad på urminnes hävd.

I 1918 års vattenlag (1918:523)(ÄVL) reglerades rättskraften i 2 kap. 22 § första tycket. Liksom dagens bestämmelse om rättskraft gällde den endast ansökningsmål. Verksamhetsutövaren erhöll enligt bestämmelsen en rätt att uppföra och för framtiden bibehålla byggnaden. Sådana avvikelser från tillståndet som inte kränkte vare sig allmännas eller enskildas rätt var tillåtna.

I 1983 års vattenlag (1983:291) (VL) omformulerades rättskraftbestämmelsen. Av 15 kap. 1 § VL följer att för en dom som meddelats i ett ansökningsmål gäller tillståndet mot alla såvitt avser frågor som enligt denna lag är att bedöma i sådant mål. Avsåg tillståndet utförandet av en anläggning, innefattade det rätt att bibehålla anläggningen.

Rättskraftens omfattning skiljer sig enligt ordalydelsen något åt mellan de olika lagstiftningarna. Vid införandet av MB och rättskraftsbestämmelsen i 24 kap. 1 § MB infördes även en övergångsbestämmelse i 5 § lagen (1998:811) om införande av miljöbalken (införandelagen). Av den bestämmelsen följer att tillstånd eller godkännanden oavsett om de är meddelade med stöd av ÄVL eller VL ska anses meddelade med stöd av motsvarande bestämmelse i MB. Är det således fråga om ett tillstånd i ett ansökningsmål ska rättskraften omfatta det som följer av 24 kap. 1 § MB. Det innebär att trots att rättskraften enligt äldre lagstiftning haft en annan omfattning ska äldre tillstånds rättskraft bedömas utifrån 24 kap. 1 § MB. Det innebär att man då måste ta ställning till vad som prövats.

Miljööverdomstolen har i avgörandet MÖD 2007:23 prövat frågan om rättskraft för ett tillstånd meddelat av vattendomstolen år 1957 med stöd av VL. Tillståndet avsåg rätten att framdra och bibehålla en avloppstub i ett visst angivet vattenområde. Länsstyrelsen hade meddelat ett föreläggande om att ta bort avloppstuben. Myndigheten menade att tuben inte omfattades av något tillstånd då den inte längre tjänade sitt ursprungliga syfte. Miljööverdomstolen konstaterade dock, med hänvisning till 5 § införandelagen, att tillståndet meddelats med stöd av vattenlagen och skulle

omfattas av rättskraftsbestämmelsen i 24 kap. 1 MB. Föreläggandet begränsade därmed ett sådant tillstånd som har rättskraft och stred därför mot bestämmelsen i 26 kap. 9 § tredje stycket MB. Föreläggandet upphävdes därför.

Rätten att bevara en dammanläggning kan enligt praxis grunda sig på urminnes hävd. Miljööverdomstolen prövade i avgörandet MÖD 2007:39 ett föreläggande vid vite om att ta bort en planka som sedan 1999 fanns monterad på en damm. Dammanläggningen hade inte tillståndsprövats enligt MB eller äldre vattenrättslig lagstiftning. Miljööverdomstolen ansåg att även om rätten att behålla dammanläggningen kunde grundas på urminnes hävd så kunde åtgärden att genom plankan höja dämningsnivån inte stödjas på urminnes hävd. Det var inte uppenbart att åtgärden inte kunde skada allmänna eller enskilda intressen och åtgärden omfattades därför av tillstånds- eller anmälningsplikt. Då någon sådan prövning inte hade skett hade länsstyrelsen haft stöd att förelägga dammägaren att ta bort plankan.

Utredningen om vattenverksamheter som nämnts i föregående avsnitt ska analysera rättskraftens räckvidd avseende sådana tillstånd och äldre rättigheter som enligt 5 § införandelagen ska jämställas med tillstånd meddelade med stöd av MB. Någon närmare utredningen om detta kommer därför inte att göras i detta betänkande.

3.4.6. Omprövning

Regler om omprövning av tillstånd finns i 24 kap. 5 § MB. I fråga om vattenverksamhet får tillståndsmyndigheten ompröva tillstånd när det gäller en bestämmelse om tillåten produktionsmängd eller annan liknande bestämmelse om verksamhetens omfattning. Omprövning kan även ske för att ändra eller upphäva villkor eller andra bestämmelser eller att meddela nya sådana.

Tillståndsmyndigheten får emellertid inte meddela så ingripande villkor eller andra bestämmelser att verksamheten inte längre kan bedrivas eller att den avsevärt försvåras. En likande bestämmelse fanns i 15 kap. 10 § VL. Av bestämmelsen följde att de nya villkoren inte fick medföra kostnader för tillståndshavaren som inte stod i rimlig proportion till vinsten för det allmänna.

Omprövning kan ske på i bestämmelsen angivna grunder. I punkten 10 anges förbättring av en anläggnings säkerhet såsom skäl

för omprövning. En motsvarande bestämmelse infördes såvitt avser en vattenanläggnings säkerhet i ovan nämnda lagändring som föreslogs i prop. 1988/89:116, se 15 kap. 3 § VL. Av förarbetena framgår att dammsäkerhet är en fråga av så stor betydelse att det inte fick överlåtas till tillståndshavaren att självständigt avgöra den. Några tidsfrister skulle därför inte gälla i fråga om omprövning för att förbättra en anläggnings säkerhet.

Omprövningsmöjligheten gäller enligt nuvarande bestämmelser även tillstånd och villkor enligt VL, se 5 § införandelagen. Omprövning kan ske på ansökan från Naturvårdsverket, Kammarkollegiet och länsstyrelsen. För det fall tillsynen överförts till kommunen har kommunen också rätt att ansöka om omprövning.

Tillståndshavaren kan med stöd av 24 kap. 8 § MB också ansöka om ändring eller upphävande av villkor i en tillståndsdom utom det som avser ersättningens storlek. Villkoret får bara upphävas eller mildras endast om det är uppenbart att villkoret inte längre behövs eller är strängare än nödvändigt eller om ändringen påkallas av omständigheter som inte förutsågs när tillståndet meddelades.

3.4.7. Återkallelse

Mark- och miljödomstolen får enligt 24 kap. 3 § MB helt eller delvis återkalla ett tillstånd och förbjuda fortsatt verksamhet. Om tillståndet gäller verksamhet vid en vattenanläggning kan domstolen även återkalla rätten att bibehålla anläggningen.

I fråga om vattenanläggningar kan återkallelse ske om underhållet allvarligt försummats. Generellt kan ansökan om återkallelse också göras bl.a. om tillståndet eller villkoren som gäller för verksamheten inte följts och avvikelsen inte är av ringa betydelse. Likaså kan återkallelse ske om det till följd av verksamheten uppkommit en olägenhet av väsentlig betydelse som inte förutsågs när verksamheten tilläts. För vattenanläggningar kan återkallelsen avse även rätten att bibehålla anläggningen.

Liksom för omprövning är det Naturvårdsverket, Kammarkollegiet och länsstyrelsen som kan ansöka om återkallelse. Kommunerna kan också ansöka om återkallelse i den mån tillsynen övertagits av kommunen.

3.4.8. Tekniska krav enlig plan- och bygglagen

I sammanhanget vill utredningen bara kort nämna att dammar omfattas av de tekniska egenskapskrav som följer av 8 kap. i PBL. De tekniska egenskapskraven gäller vid nybyggnation. Kraven kan inte ställas på en befintlig anläggning annat än i vid ombyggnad och annan ändring, 8 kap. 1 § PBL.

Med tekniska egenskapskrav avses enligt 8 kap. 4 § bl.a. bärförmåga, stadga och beständighet samt säkerhet vid användning. Kraven på bärförmåga, stadga och beständighet har preciserats i 3 kap. 7 § plan- och byggförordning (2011:338). Där anges att ett byggnadsverk ska vara projekterat och utfört på ett sådant sätt att den påverkan som byggnadsverket sannolikt utsätts för när det byggs eller används inte leder till att byggnadsverket helt eller delvis rasar.

3.5. Tillsyn och tillsynsvägledning enligt MB

Vilka som är tillsyns- respektive tillsynsvägledande myndigheter och vad som åligger dem enligt MB regleras i 26 kap. MB och miljötillsynsförordningen (2011:13). Förordningen trädde i kraft den 1 mars 2011.

3.5.1. Länsstyrelsen, operativ tillsynsmyndighet för vattenverksamhet

Av 2 kap. 29 § första stycket 2 miljötillsynsförordningen framgår att länsstyrelsen ansvarar för tillsyn av vattenverksamhet med visst i bestämmelsen angivet undantag. Det innebär att länsstyrelsen är tillsynsmyndighet för dammar och därmed även dammsäkerhet. Länsstyrelsen får enligt andra stycket överlåta uppgiften att utöva tillsyn åt en kommunal nämnd enligt 1 kap.19 och 20 §§miljötillsynsförordningen.

Miljötillsynsförordningen anger att det endast är vattenverksamhet som är föremål för länsstyrelsens tillsyn. Tillsyn över vattenanläggningar nämns inte. Mot bakgrund av uttalanden i allmänmotiveringen till MB:s tillsynsbestämmelser kan det dock inte ha varit avsikten att begränsa omfattningen av tillsynen till att endast avse vattenverksamhet och inte vattenanläggningar22. Några

22Prop. 1997/98:45 del 1, s. 509.

sakliga skäl för en sådan begränsning finns inte heller. Även om endast begreppet vattenverksamhet används i miljötillsynsförordningen ger MB:s reglering om tillsyn utrymme även för tillsyn över vattenanläggningar. Länsstyrelsens tillsyn ska därför anses omfatta även vattenanläggningar såsom dammar.23 Att tillsynsansvaret för vattenanläggningar åligger länsstyrelsen har inte heller i praxis ifrågasatts, se bl.a. MÖD 2007:39 och MÖD 2007:15.

3.5.2. Skyldigheter för en tillsynsmyndighet

Hos tillsynsmyndigheten ska det finnas en utredning om tillsynsbehovet för myndighetens hela ansvarsområde enligt MB. Behovsutredningen ska avse en tid om tre år. Utredningen ska ses över vid behov och minst en gång varje år. Vidare ska en tillsynsmyndighet föra ett register över de tillsynsobjekt som behöver återkommande tillsyn, se 1 kap.6 och 7 §§miljötillsynsförordningen.

I 1 kap.812 §§miljötillsynsförordningen framgår ett antal bestämmelser om hur den operativa tillsynsmyndigheten ska bedriva sin tillsyn. En tillsynsmyndighet ska för varje verksamhetsår upprätta en samlad tillsynsplan som omfattar myndighetens ansvarsområde enligt MB. Planen ska grundas på behovsutredningen och det objektsregister myndigheten ska föra. En statlig operativ tillsynsmyndighet, såsom länsstyrelsen, ska även i den samlade tillsynsplanen beskriva hur myndigheten har avvägt fördelningen av resurser inom och mellan olika ansvarsområden och hur resurserna har anpassats efter det tillsynsbehov som finns. Tillsynsmyndigheten ska även årligen följa upp och utvärdera sin tillsynsverksamhet. Tillsynsarbetet ska bedrivas effektivt och myndigheten ska utveckla personalens kompetens i tillsynsfrågor. Om det finns olika tillsynsmyndigheter för angränsande områden ska myndigheterna i den mån det är ändamålsenligt och möjligt samordna tillsynen. Om det istället finns två eller flera myndigheter som har det operativa tillsynsansvaret för ett tillsynsobjekt, får myndigheterna komma överens om hur ansvaret ska fördelas, 2 kap. 2 § miljötillsynsförordningen.

En operativ tillsynsmyndighet har även enligt 1 kap. 13 § miljötillsynsförordningen en skyldighet att underrätta Naturvårdsverket, Havs- och vattenmyndigheten (HaV) och Kammarkollegiet om förhållanden som kan vara skäl för bl.a. förbud eller återkallelse

23 Svenska kraftnät, Handbok, Dammsäkerhet – egenkontroll och tillsyn, s. 11.

av tillstånd enligt 24 kap. 3 § MB eller en omprövning enligt 24 kap. 5 eller 6 §§ MB. Uppmärksammar en tillsynsmyndighet en omständighet som kan föranleda tillsynsåtgärder med stöd av MB men omfattas omständigheten av en annan myndighets ansvarsområde, ska tillsynsmyndigheten anmäla denna omständighet till den ansvariga myndigheten, 1 kap. 16 § miljötillsynsförordningen.

3.5.3. Svenska kraftnät, tillsynsvägledande myndighet

HaV är sedan den 1 juli 2011 tillsynsvägledande myndighet för vattenverksamhet med undantag för frågor om markavvattning enligt 3 kap. 5 § 1 miljötillsynsförordningen. Tidigare var det Naturvårdsverket som hade det tillsynsvägledande ansvaret för vattenverksamhet.

I frågor om dammsäkerhet enligt 11 kap. MB är emellertid Svenska kraftnät tillsynsvägledande myndighet vilket framgår av 3 kap. 3 § i nyss nämnda förordning. Verksamheten vid en damm har således två olika tillsynsvägledande myndigheter enligt MB. Någon definition av dammsäkerhet finns inte i förordningen eller i MB. Svenska kraftnät och Naturvårdsverket har upprättat en PM24 i vilken gränsdragningen förtydligats mellan deras olika ansvarsområden. Något motsvarande dokument har ännu så länge inte tagits fram med HaV. Av promemorian framgår att Svenska kraftnäts vägledningsansvar begränsar sig till säkerheten vid dammar som bedöms vara en vattenanläggning enligt 11 kap. MB. Frågor om vilka åtgärder som krävs för att förhindra, förebygga eller motverka dammbrott omfattas av Svenska kraftnäts ansvar. Det gäller oavsett storlek på dammen eller av konsekvenserna vid ett dammbrott.

Med dammsäkerhet menas enligt promemorian

säkerhet mot uppkomst av brott i en dammbyggnad som kan medföra skador genom okontrollerad utströmning av vatten som dämts upp med hjälp av dammbyggnaden. Med okontrollerad utströmning av vatten i definitionen ovan intolkas även utströmning av t.ex. blandningar av vatten och anrikningssand vid gruvavfallsdeponier. Vid vattentäckning av gruvavfallsdeponier med hjälp av en dammbyggnad kan läckage genom dammen leda till att vattentäckningen äventyras. Om inte läckaget riskerar att leda till dammbrott är detta inte att betrakta som en dammsäkerhetsfråga. Läckage kan vara en dammsäkerhetsfråga om det riskerar att leda till dammbrott. I begreppet skador i definitionen av dammsäkerhet ovan ingår även fysiska skador uppströms fördämningen. Med fysiska skador avses skador nedströms till följd av det

24 PM den 4 oktober 2006, dnr 649/2006/BE90.

hastigt utströmmande vattnet eller skador uppströms (t.ex. ras och skred) till följd av den hastiga sänkningen av vattennivån.

Enligt miljötillsynsförordningen ska de tillsynsvägledande myndigheterna aktivt verka för samordningen och samverkan i frågor om tillsynsvägledning, 3 kap. 1 § miljötillsynsförordningen. En tillsynsvägledande myndighet ska inom sitt vägledningsområde ge tillsynsvägledning i fråga om tillämpning av MB, föreskrifter meddelade med stöd av MB och EU-förordningar. Den tillsynsvägledande myndigheten har rätt att begära in den information som behövs från den operativa tillsynsmyndigheten. För denna information och hur den ska lämnas får den tillsynsvägledande myndigheten meddela föreskrifter, 1 kap.14 och 15 §§miljötillsynsförordningen. Svenska kraftnät har inte meddelat några sådana föreskrifter såvitt avser länsstyrelsernas rapportering om dammsäkerhet.

Såväl Naturvårdsverket som Svenska kraftnät har gett ut handböcker för egenkontroll och tillsyn. Naturvårdsverket har även gett ut en handbok för vattenverksamhet.

3.6. Tillsynsåtgärder enligt 26 kap. MB

Tillsynsverksamheten kan delas in i dels den myndighetsutövande verksamheten, dels den förebyggande och stödjande verksamheten.

De åtgärder en tillsynsmyndighet vidtar för att uppnå efterlevnad och åstadkomma rättelse utgör myndighetsutövning. Tillsynsmyndigheterna har inte endast rätt till sådan myndighetsutövning, utan det föreligger en skyldighet för tillsynsmyndigheten att kontrollera balkens efterlevnad och att vidta de åtgärder som behövs.25

Enligt 26 kap. 1 § tredje stycket MB ska tillsynsmyndigheten dessutom, genom rådgivning, information och liknande verksamhet, skapa förutsättningar för att balkens ändamål ska kunna tillgodoses. Med det avses rådgivning och utredande verksamhet av mer generell karaktär. I vilken utsträckning det ska ske finns inte närmare reglerat.

Tillsynen ska enligt 26 kap. 1 § första stycket MB säkerställa syftet med MB och föreskrifter som har meddelats med stöd av balken. Enligt andra stycket ska tillsynsmyndigheten på eget initiativ eller efter anmälan i nödvändig utsträckning kontrollera efterlevnaden av MB samt föreskrifter, domar och andra beslut som

25Prop. 1997/98:45 del 2, s. 266.

har meddelats med stöd av balken samt vidta de åtgärder som behövs för att åstadkomma rättelse. I fråga om miljöfarlig verksamhet eller vattenverksamhet som omfattas av tillstånd ska tillsynsmyndigheten även fortlöpande bedöma om villkoren är tillräckliga.

Skrivelsen ”på eget initiativ eller efter anmälan” tillkom genom en lagändring som trädde i kraft den 1 maj 200526. Ändringen var föranledd av Sveriges tillträde till Århuskonventionen27 och EU:s direktiv på konventionens område28. Efter lagändringen kan således ett tillsynsärende inledas om tillsynsmyndigheten uppmärksammar missförhållanden och/eller om en enskild anser att en olägenhet föreligger.

En anmälan från en enskild ska resultera i ett beslut från tillsynsmyndigheten. I beslutet kan tillsynsmyndigheten förelägga om olika tillsynsåtgärder eller meddela ett förbud mot att fortsätta bedriva viss verksamhet eller vidta en viss åtgärd. Tillsynsmyndigheten kan även fatta beslut om att inte ingripa mot en viss verksamhet eller åtgärd. Dessa beslut från tillsynsmyndigheten går att överklaga. Länsstyrelsens beslut kan överklagas till mark- och miljödomstolen och därefter till Mark- och miljööverdomstolen, se 19 kap. 1 § MB och 5 kap. 5 § lag (2010:921) om mark- och miljödomstolar. För prövning i Mark- och miljööverdomstolen krävs prövningstillstånd. För det fall en kommun är tillsynsmyndighet för vattenverksamheten i fråga överklagas kommunens beslut till länsstyrelsen och därefter till ovan nämnda överinstanser.

3.6.1. Rätten att överklaga ett beslut av tillsynsmyndigheten

Rätten att överklaga ett beslut enligt MB följer av 16 kap. 12 och 13 §§ MB. Enligt 16 kap. 12 § första punkten får en överklagbar dom eller ett beslut överklagas av den som domen eller beslutet angår, om avgörandet har gått honom eller henne emot. Huruvida någon är berörd av ett tillsynsbeslut får avgöras i varje enskilt fall.

26 SFS 2005:182. 27 FN/ECE:s (Förenta Nationernas ekonomiska kommission för Europa) konventionen om tillgång till information, allmänhetens deltagande i beslutsprocesser och tillgång till överprövning i miljöfrågor. 28 Europaparlamentets och rådets direktiv 2003/35/EG av den 26 maj 2003 om åtgärder för allmänhetens deltagande i utarbetandet av vissa planer och program avseende miljön och om ändring, med avseende på allmänhetens deltagande och till rättslig prövning, av direktiv 85/337/EG och direktiv 96/61/EG.

Rätten för en ideell förening att överklaga framgår av 16 kap. 13 § MB och omfattar för närvarande inte tillsynsbeslut. En sådan rätt har nu föreslagits av Industriutsläppsutredningen29.

Frågan om vem som i varje enskilt fall ska anses ha rätt att klaga har överlämnats till rättstillämpningen. Av motiven framgår att begreppet ska tillämpas generöst30. Högsta domstolen har fastslagit att rätten att överklaga ska tillkomma varje person som kan tillfogas skada eller utsättas för annan olägenhet genom den verksamhet som prövningen avser. Risken för skada eller olägenhet får inte vara enbart teoretisk eller helt obetydlig31. För att ett beslut ska anses angå en person måste personen vara berörd på ett konkret sätt.

Av praxis framgår bl.a. att en fastighetsägare nedströms en damm kan anses vara berörd av ett tillsynsbeslut på ett sådant sätt att han eller hon har rätt att klaga. I Mark- och miljööverdomstolens avgörande den 2 februari 2012, mål nr M 4696-11 fann domstolen att en fastighetsägare 2,5 km nedströms en lakvattendamm vid en avfallsanläggning var berörd av ett tillsynsbeslut. Domstolen konstaterade att fastigheten i fråga kunde drabbas av olägenheter från lakvattnet. Tillsynsmyndighetens kontroll över verksamheten kunde därför få betydelse för frågan om att förhindra olägenheter från lakvattnet. Fastighetsägaren hade därför rätt att klaga på tillsynsbeslutet.

I sammanhanget bör även nämnas att det av art 9.3 Århuskonventionen följer ett generellt krav att allmänheten ska ha rätt att få handlingar och underlåtenhet av myndigheter som strider mot den nationella miljölagstiftningen prövad av domstol eller i annan administrativ ordning. Bestämmelsen anses omfatta bl.a. tillsynsbeslut. EU-domstolen har den 8 mars 2011 meddelat dom i ett mål som berör art. 9.3 i Århuskonventionen (mål C-240/09). Av domen följer att om en handling, ett beslut eller en underlåtenhet kan strida mot unionens miljölagstiftning måste det finnas en möjlighet att få till stånd en rättslig prövning.

Utredningen kommer att återkomma till frågan om rätten att överklaga det beslut om klassificering som tillsynsmyndigheten ska fatta enligt utredningens förslag, se avsnitt 8.4.10.

29 Bättre miljö – minskade utsläpp, SOU 2011:86, s. 271 f. 30Prop. 1997/98:45 del 1, s. 483. 31NJA 2004 s. 590 I och II.

3.6.2. Adressater för tillsynsåtgärder

Generellt för föreläggande enligt MB gäller att ett föreläggande eller förbud ska riktas mot den som har den faktiska och rättsliga möjligheten att efterkomma föreläggandet eller förbudet. I miljörättslig praxis har domstolarna hänvisat till definitionen av verksamhetsutövare i 2 § lagen (1999:381) om åtgärder för att förebygga och begränsa följderna av allvarliga kemikalieolyckor, Sevesolagstiftningen. Av den bestämmelsen följer att med verksamhetsutövare menas varje fysisk eller juridisk person som driver eller innehar en verksamhet eller anläggning eller som på annat sätt har rätt att fatta avgörande ekonomiska beslut om verksamhetens eller anläggningens tekniska drift. Om verksamheten i fråga utövas med stöd av ett tillstånd är det tillståndshavaren som är rätt adressat. För det fall verksamheten överlåts till någon annan följer tillståndet och därmed ansvaret med.

För vattenanläggningar såsom en damm är det ägaren av vattenanläggningen som enligt 11 kap. 17 § har ansvar för anläggningens underhåll och är den mot vilken förbud eller förelägganden kan riktas. Anläggningsägarens ansvar är långtgående och kvarstår i princip till dess att ett förordnande om att skyldigheten att underhålla anläggningen och fullgöra andra skyldigheter har övergått till annan enligt 11 kap. 20 § MB. Det innebär att även om anläggningen är uppförd på annans mark är det fortfarande ägaren av anläggningen som är ansvarig. Detsamma gäller även för de anläggningar som inte längre är i drift men där äganderätten övergått till fastighetsägaren. Ansvaret för underhåll och andra skyldigheter kvarstår även för dessa anläggningar.

Det är endast i de fall där rätt att använda anläggningen har medgetts enligt 28 kap. 12 § MB som den till vilken rätten överlåtits har ansvar för underhåll och andra skyldigheter. Ansvaret utövas emellertid tillsammans med den ursprunglige ägaren. Däremot är inte en arrendator som enligt avtal arrenderar en anläggning och har den i drift ansvarig för underhåll. Ansvaret åligger fortfarande ägaren av anläggningen oavsett vad som avtalas mellan parterna.32

Ansvaret för en vattenanläggning åligger den ursprungliga ägaren av vattenanläggningen till dess att anläggningen antingen överlåts till annan, rivs ut eller att ett förordnande av domstol meddelas enligt 11 kap. 20 § MB. Tillstånd till drift av vattenkraftverk som är

32 Svenska kraftnät, Handbok, Dammsäkerhet – egenkontroll och tillsyn, s. 12.

knutet till en viss fastighet, strömfallsfastigheten, utgör emellertid ett undantag. Dessa tillstånd följer fastigheten om fastigheten överlåts till annan.33

Ett problem i Sverige i dag är att det finns många övergivna dammar, bl.a. för sågverk, kvarnar och flottning. Eftersom dammarna har övergivits är det ofta svårt att finna ägare som har ansvaret för sådana anläggningar.34 Utredningen återkommer till den här problematiken i avsnitt 8.4.6.

3.6.3. Föreläggande eller förbud enligt 26 kap. 9 § MB

För att MB samt föreskrifter, domar och andra beslut som har meddelats med stöd av balken ska följas får tillsynsmyndigheten enligt 26 kap. 9 § MB i det enskilda fallet besluta om de förelägganden och förbud som behövs. Det ska alltid göras en rimlighetsavvägning. Tillsynsmyndigheten får inte vidta mer ingripande åtgärder än vad som krävs i det enskilda fallet för att se till att balkens bestämmelser följs.

Av ordalydelsen följer att grunden för ett föreläggande eller förbud kan vara att en viss dom eller ett visst beslut överträtts i något avseende. Det kan också grunda sig direkt på MB:s bestämmelser, t.ex. de allmänna hänsynsreglerna eller på någon bestämmelse i en förordning eller föreskrift som meddelats med stöd av MB. För vattenverksamhet specifikt kan ett föreläggande även grunda sig på tillåtlighetsreglerna i 11 kap. 6–8 §§ MB eller underhållsskyldigheten i 11 kap. 17 § MB.

Av 26 kap. 9 § MB följer även att ett föreläggande eller förbud inte får begränsa ett beslut eller en dom om tillstånd i ansökningsmål som har rättskraft enligt 24 kap. 1 § MB. Stadgandet innebär att det är villkoren i det aktuella tillståndet eller vad som i övrigt är reglerat i tillståndet som beskriver verksamhetsutövarens skyldigheter i olika avseenden. Om en fråga har prövats vid tillståndsgivningen gäller inte de skyldigheter som framgår av hänsynsreglerna utan i stället vad som föreskrivits i domen eller beslutet. Förelägganden från tillsynsmyndigheten är möjliga bara om verksamhetsutövaren bryter mot dessa villkor eller om risk finns att ohälsa eller allvarlig skada på miljön uppkommer.35

33 Naturvårdsverket rapport 5126, Tillsyn över vattenverksamhet, s. 9. 34Prop. 1997/98:45 del 1, s. 139. 35 Bengtsson m.fl., Miljöbalken (1 jan. 2011, Zeteo) kommentaren 26 kap. 9 §.

För verksamheter som inte har tillståndsprövats eller för sådana frågor som inte har prövats eller villkorsreglerats i en tillståndsdom eller ett beslut och som faller inom MB:s tillämpningsområde kan tillsynsmyndigheten meddela ett föreläggande eller förbud. Det måste då självklart grunda sig på MB:s regler. Detta gäller t.ex. vid åsidosättande av de allmänna hänsynsreglerna i 2 kap. MB.

Av praxis följer att regeln om föreläggande och förbud i 26 kap. 9 § är undantagslös och gäller all verksamhet som regleras i miljöbalken, Mark- och miljööverdomstolens dom 8 februari 2011 i mål nr M 2893-10. I det angivna avgörandet konstaterade domstolen att det var möjligt att förelägga en ägare om utrivning av en damm där dammen saknade tillstånd. Ett föreläggande kan också innehålla ett förbud mot fortsatt kraftproduktion, MÖD 2005:18, eller skyldigheter att iaktta vissa begränsningar i verksamheten.

Mark och miljööverdomstolens angav i tre avgöranden36 att tillsynsmyndigheten med stöd av 26 kap. 9 § kan förelägga en dammägare om att ansöka om tillstånd inom viss angiven tid. I samtliga fall var det fråga om vattenkraftverk som enligt ägarna bedrevs med stöd av urminnes hävd respektive privilegiebrev. Domstolen konstaterade i samtliga avgöranden att avsaknaden av bestämmelser och villkor för driften och skötseln av anläggningarna försvårar tillsynsmyndighetens möjligheter att uppfylla sin skyldighet enligt 26 kap. 1 § MB att genom tillsyn säkerställa syftet med MB och föreskrifter som har meddelats med stöd av balken.

3.6.4. Brådskande förelägganden eller förbud

Av 26 kap. 9 § fjärde stycket MB följer ett undantag från regeln om de bindande verkningarna hos tillståndsdomar och tillståndsbeslut. Trots att en fråga är reglerad i ett tillstånd kan tillsynsmyndigheten enligt stadgandet meddela sådana brådskande förelägganden eller förbud som är nödvändiga för att undvika att ohälsa eller allvarlig skada på miljön uppkommer. Stadgandet avser ohälsa eller skador på miljön. Begreppet miljö har en vid betydelse i MB och innefattar både naturmiljön och kulturmiljö samt såväl allmän som enskild egendom. Tillsynsmyndigheten kan således under vissa förutsättningar förelägga en tillståndshavare att frångå ett tillstånd. För att man ska tillämpa denna undantagsregel bör antingen sannolikheten

36 Mark och miljööverdomstolens avgöranden den 19 april 2012 i mål nr M 7763-10, 2350-11 och 2378-11.

för skada vara ganska stor eller också den befarade skadan vara betydande37.

Motiven till paragrafen ger inte någon vägledning beträffande regelns tillämpning38. Miljöskyddslagen innehöll en motsvarande möjlighet för tillsynsmyndigheten att i brådskande fall om särskilda omständigheter förelåg meddela föreläggande utan hinder av tillståndets rättskraft (40 § andra stycket). I propositionen till miljö-skyddslagen39 angavs som exempel att en häftigt uppblossande epidemi kunde vara en situation där föreskrifter skulle kunna meddelas enligt lagrummet.

Viss vägledning om bestämmelsens tillämpning följer av Koncessionsnämndens praxis. I rättsfallet KN B 063/95 förelåg förutsättning för tillsynsmyndigheten att meddela föreläggande med krav på begränsning av fosfortillförsel till sjön Södra Bullaren från en fiskodling till följd fosforutsläppens mycket negativa miljöpåverkan på sjön40.

Om regeln tillämpas och skador uppkommer på enskild egendom till följd av att en vattendom frångås, uppstår frågan om ansvar att betala ersättning. Några uttryckliga regler om ersättningsrätt finns inte i sådana situationer. Har myndigheterna begått fel eller försummelse vid myndighetsutövning kan ersättning utgå enligt bestämmelser i skadeståndslagen. I övrigt kan en allmän rättsgrundsats om ersättningsskyldighet i nödsituationer åberopas när ett ingrepp av en myndighet medför skada på annans egendom. Den i vars intresse annans egendom uppoffras är skyldig att ersätta ägaren för egendomen41. Denna ersättningsskyldighet gäller även för det allmänna. Om ändringar av tappningar sker för att mildra verkningar av översvämningar görs det i vart fall delvis i det allmännas intresse. Det är dock oklart om den typ av skador det kan röra sig om är ersättningsgilla och i så fall till hur stor del samt vem som i sådana fall är att betrakta som det allmänna.42

37 Bengtsson m.fl., Miljöbalken (1 jan. 2011, Zeteo) kommentaren 26 kap. 9 §. 38Prop. 1997/98:45 del 1, s. 493 f. och del 2, s. 272. 39Prop. 1969:28 s. 226. 40 Bjällås och Rahmn, Miljöskyddslagen, 2 uppl., s. 180 f. 41 Bertil Bengtsson, Ersättning vid offentliga ingrepp 2, 1991, s. 65. 42Miljöbalken under utveckling, SOU 2002:50, s. 176 ff.

3.6.5. Föreläggande om upplysningar enligt 26 kap. 21 § MB

Tillsynsmyndigheten får enligt 26 kap. 21 § MB förelägga den som bedriver verksamhet eller vidtar en åtgärd som omfattas av MB:s tillämpningsområde att till tillsynsmyndigheten lämna de uppgifter och handlingar som behövs för tillsynen. Stadgandet avser endast sådana uppgifter som är av betydelse för tillsynen såsom driftsförhållanden, omfattningen av verksamheten m.m. Upplysningarna behöver inte avse enbart den löpande tillsynen utan tillsynsmyndigheten kan även begära uppgifter som den behöver för övergripande, samordnande och uppföljande miljöarbete. Bestämmelsen ger emellertid endast stöd för inhämtande av handlingar och upplysningar som inte kräver närmare utredning.43

Den årsrapportering om dammsäkerhet som flertalet länsstyrelser kräver in av dammägare i dag sker i huvudsak med stöd av den här bestämmelsen. Underlaget utgör ett stöd för länsstyrelsernas tillsyn. Det är emellertid tveksamt om alla uppgifter som enligt den förtryckta blanketten ska lämnas in kan krävas med stöd av MB.

Ett exempel är den klassning som dammägaren gör enligt RIDAS. Klassningen kan i och för sig ses om en förenklad kartläggning av de risker och konsekvenser den aktuella anläggningen och eventuell verksamhet som bedrivs vid anläggningen medför eller kan medföra. Dammägaren är enligt de allmänna hänsynsreglerna, framförallt försiktighetsprincipen och kunskapskravet, skyldig att hålla sig ständigt informerad om verksamhetens påverkan på den omgivande miljön. Om dammägaren har ett underlag som legat till grund för klassningen skulle det kunna utgöra ett sådant material som kan krävas in av tillsynsmyndigheten med stöd av 26 kap. 21 § MB. Däremot finns det inte någon lagstadgad skyldighet att klassa dammanläggningen enligt RIDAS. Skulle en dammägare inte vilja lämna in uppgift om vilken konsekvensklass dammen i fråga hör till finns det heller inga möjligheter för tillsynsmyndigheten att med stöd av nuvarande bestämmelser i MB förelägga om sådana upplysningar.

43Prop. 1997/98:45 del 2, s. 282.

3.6.6. Föreläggande om undersökning enligt 26 kap. 22 § MB

Utöver de undersökningar en verksamhetsutövare gör inom ramen för sin egenkontroll har tillsynsmyndigheten möjlighet att förelägga om undersökning enligt 26 kap. 22 § MB.

Den som bedriver verksamhet eller vidtar en åtgärd som kan befaras medföra olägenheter för människors hälsa eller miljön kan enligt bestämmelsen föreläggas att utföra de undersökningar av verksamheten eller åtgärden och dess verkningar som behövs för att tillsynsmyndigheten på ett riktigt sätt ska kunna utföra sina tillsynsuppgifter. För tillämpningen krävs således inte att verksamheten konstaterats faktiskt vara miljöskadlig utan det räcker med att det kan befaras. Undersökningens syfte kan vara att klargöra om sådan skada eller risk för skada föreligger. Däremot förutsätter bestämmelsen att verksamheten är pågående.44

Begreppet undersökning bör enligt förarbetena ges en vid tolkning. Det kan omfatta bl.a. provtagningar och besiktning. Omfattningen av utredningen får avgöras i varje enskilt fall. Möjligen räcker det med en enstaka undersökning men ibland krävs fortlöpande undersökningar.

Det är verksamhetsutövaren som står kostnaden för utredningen. Undersökningsplikten är därför begränsad till vad som behövs för att tillsynsmyndigheten ska kunna utföra sin tillsyn. Undersökningar som genomförs får inte vara ren forskning.45 De utredningsåtgärder som krävs måste även vara rimliga och nyttan med utredningsåtgärden måste stå i proportion till kostnaderna.

Istället för att verksamhetsutövaren utför undersökningen kan tillsynsmyndigheten också besluta att undersökningen ska göras av fristående expertis med teknisk och vetenskaplig sakkunskap inom området i fråga. Tillsynsmyndigheten bör inhämta verksamhetsutövarens uppfattning innan beslut fattas om detta och är skyldig att tillse att en sådan undersökning inte blir onödigt kostsam.46 Det är dock tillsynsmyndigheten som fastställer beloppet. Den som utför undersökningarna omfattas av tystnadsplikt enligt 26 kap. 27 § MB.

För det fall tillsynsmyndigheten beslutar om att anlita en utomstående konsult uppstår frågan om en sådan tjänst är underkastad reglerna om offentlig upphandling. En tillsynsmyndighets förordnande om att annan ska utföra undersökning görs i verksamhets-

44 Setterlid, Offentlig tillsyn enligt miljöbalken, upplaga 1:1, s. 94. 45 Setterlid, Offentlig tillsyn enligt miljöbalken, upplag 1:1, s. 95. 46Prop. 1997/98:45 del 2, s. 283.

utövarens intresse och ska därför ses som en s.k. ”tredjemansupphandling”. Uppdraget avser en tjänst som ska tillgodose annan än myndighetens direkta behov. Sådana upphandlingar har inte i praxis ansetts utgöra upphandlingar enligt lagen (1992:1528) om offentlig upphandling.47

Till dess att undersökningen är avslutad kan tillsynsmyndigheten förena ett beslut om undersökning med ett överlåtelseförbud av den berörda fastigheten eller annan egendom under viss angiven tid. Avsikten med ett sådant förbud är att undvika ansvarsflykt. Kan det uppnås på ett annat lindrigare sätt ska förbud inte tillgripas.

För att utreda om en vattenanläggning tillkommit i laga ordning eller är av laga beskaffenhet kan enligt 9 kap. 5 § LVV en ägare till vattenanläggningen eller någon vars rätt berörs av den hos länsstyrelsen ansöka om att en besiktningsman förordnas för att utreda frågan. Den som ansökt om besiktningen ska betala kostnaderna för den med ett belopp som länsstyrelsen bestämmer.

3.6.7. Föreläggande eller förbud vid vite

Enligt 26 kap. 14 § MB får ett föreläggande eller förbud förenas med vite. Närmare bestämmelser om vitesföreläggandets adressat, beräkning av storlek, utformning och utdömande finns i lagen (1985:206) om viten.

3.6.8. Rätt till tillträde

I 28 kap. MB finns bestämmelser om tillträde. I första hand ska tillträde ske efter överenskommelse med ägaren eller innehavaren. I den mån en effektiv tillsyn kräver oanmälda inspektionsbesök ska sådan kunna genomföras. Endast om ägaren eller innehavaren motsätter sig tillträde blir det aktuellt att tvångsvis bereda sig tillträde. En myndighet har rätt att mot en ägares eller innehavares vilja få tillträde till dennes egendom och där vidta åtgärder, allt i den utsträckning som behövs för att myndigheten ska kunna fullgöra sina uppgifter.

Tillträde kan ske till den fastighet där verksamheten bedrivs eller till en angränsande fastighet för att t.ex. mäta utsläpp från verk-

47 Setterlid, Offentlig tillsyn enligt miljöbalken, upplaga 1:1, s. 96 och Kammarrätten i Stockholm, dom 1995-01-30, mål 12192-94.

samheten. Tillträde kan även ske för att utföra särskilda undersökningar eller kartläggningar.

Även sådana som utför uppdrag åt myndigheten har rätt till tillträde. Det kan handla om anlitad expertis som utför en besiktning.

Vid tillståndsprövning kan prövningsmyndigheten besluta om att skyddsåtgärder ska vidtas på annans egendom. Om fastighetsägaren i fråga motsätter sig tillträde har länsstyrelsen rätt att besluta om tvångstillträde så att åtgärderna kan utföras.

Den som lider skada av intrånget har rätt till ersättning. Regler om detta finns i 31 kap. 10 § MB. Som framgår av 31 kap. 10 § utgår inte ersättning om åtgärderna utgör ett led i tillsyn beträffande verksamhet på fastigheten.

För vattenanläggningar finns en särskild tillträdesbestämmelse i 28 kap. 11 § MB. Bestämmelsen ger den underhållsskyldige rätt att nyttja annans mark för arbeten och åtgärder som behövs för att underhållsskyldigheten ska kunna fullgöras.

3.7. Möjligheten att förelägga om sänkning av vattennivån

Utredningen har i uppdrag att klarlägga om tillsynsmyndigheten, enligt nuvarande bestämmelser, har möjlighet att förelägga dammägarna att temporärt sänka vattennivån i ett magasin om dammägaren inte kan visa att dammsäkerheten är tillfredsställande vid högt magasinvattenstånd avseende dammar med stora konsekvenser i händelse av dammbrott eller att förelägga om andra åtgärder som bedöms lämpliga.

Som redogjorts för under avsnitt 3.6.3. får inte ett föreläggande eller ett förbud begränsa ett beslut eller en dom om tillstånd i ett ansökningsmål som har rättskraft enligt 24 kap. 1 § MB. Rättskraften omfattar frågor som har prövats i domen eller beslutet.

För de dammar som frågeställningen avser, dammar med stora konsekvenser i händelse av dammbrott, är det utredningens uppfattning att dessa omfattas av tillstånd eller annan jämförbar rättighet, nedan kallat tillstånd. Utöver rätt att uppföra själva dammanläggningen föreskrivs i de allra flesta tillstånd hur vattnet får regleras. Genom de s.k. vattenhushållningsbestämmelserna anges hur vattnet får innehållas och tappas. Tillståndet kan även vara förenat med bestämmelser om minimitappning. I de flesta tillstånd anges även dämnings- och sänkningsgräns.

Som redan nämnts gäller ett tillstånds rättskraft såvitt avser frågor som har prövats i domen eller beslutet enligt 24 kap. 1 § MB. Om en fråga har prövats vid tillståndsgivningen gäller inte de skyldigheter som framgår av MB:s hänsynsregler utan i stället vad som föreskrivits i domen eller beslutet. Tillståndet och därmed förenade villkor får i princip inte inskränkas eller ändras på något sätt48. Tillståndet ger därmed verksamhetsutövaren en trygghet. Den tillståndshavare som följer villkoren i sitt tillstånd behöver normalt inte befara att det allmänna ställer ytterligare krav med stöd av hänsynsreglerna, i vart fall inte beträffande sådana frågor som har prövats vid tillståndsgivningen.49 Det innebär att för det fall tillståndet i fråga innehåller angivande om hur vattnet får innehållas och tappas omfattas det av tillståndets rättskraft och kan inte angripas annat än att särskilda förhållanden föreligger. Det gäller även temporära avsänkningar.

Många av de tillstånd som tillämpas i dag är meddelade med stöd av äldre lagstiftning. Rättskraftsregeln i dessa lagar såg något annorlunda ut än vad den gör i MB. Tillstånd meddelade enligt äldre lagstiftning har dock samma rättskraft som tillstånd meddelade med stöd av 11 kap. MB, 5 § lagen (1998:811) om införande av miljöbalken, jfr MÖD 2007:23 som omnämns i avsnitt 3.4.4. Det innebär att trots att rättskraften enligt äldre lagstiftning haft en annan omfattning ska äldre tillstånds rättskraft bedömas utifrån 24 kap. 1 § MB.

3.7.1. Föreläggande i brådskande fall

Möjligheten att frångå den tappning av vatten som fastställts genom vattendomar har belysts i tidigare utredning50. I betänkandet redogörs för nedanstående situationer där man i brådskande fall eller mer akuta situationer kan frångå bestämmelsen om ett tillstånds rättskraft och därmed även eventuella villkor om reglering av vattennivån.

48 Strömberg, Vattenlagen med kommentar, s. 271. 49Prop. 1997/98:45 del 2, s. 252. 50Miljöbalken under utveckling, SOU 2002:50, s. 176 ff.

Föreläggande med stöd av 26 kap. 9 § MB

Som nämnts i avsnitt 3.6.4 innehåller bestämmelsen i 26 kap. 9 § fjärde stycket MB ett undantag från regeln om de bindande verkningarna hos tillståndsdomar och tillståndsbeslut. Regeln kan komma till användning för att förelägga en regleringsrättsinnehavare att frångå en vattendom vid risk för skador på egendom eller samhällelig infrastruktur. Utredningen har inte kunnat finna något avgörande där ett sådant föreläggande i fråga om vattenverksamhet har prövats.

Godkännande i efterhand

Som nämnts i 3.4.2. får enligt 11 kap. 16 § MB vatten innehållas eller tappas i strid mot tillståndet om det är nödvändigt för att avvärja fara för liv eller hälsa, rädda värdefull egendom eller av någon annan sådan orsak. Skydd för miljön bör även anses omfattas av begreppet annan sådan orsak.

Det är regleringsrättsinnehavaren som enligt bestämmelsen kan fatta beslut om att inte följa tillståndet. Det krävs dock alltid ett godkännande av mark- och miljödomstol i efterhand och tillståndshavaren får stå för eventuella skador om uppstått på grund av att tillståndet frångåtts – även om andra större skador kunnat undvikas på detta sätt. Ansökan om godkännande ska göras snarast möjligt. Risken för skadeståndskrav medför av naturliga skäl att regleringsrättsinnehavarens intresse av att utan egen nytta utnyttja denna möjlighet att påverka flöden är liten.51

Utredningen om dammsäkerhet och höga flöden föreslog i sitt betänkande52 att ovanstående bestämmelse, då i 4 kap. 4 § vattenlagen (1983:291), skulle kompletteras med en möjlighet för länsstyrelsen att besluta om att vatten får innehållas eller tappas i strid mot meddelade bestämmelser. Som skäl för förslaget anförde utredningen att det var tänkbart att en dammägare inte skulle utnyttja möjligheten om att frångå vattenhushållningsbestämmelserna. Om det i efterhand inte visar sig vara den bästa tänkbara lösningen kan dammägaren riskera både straffpåföljd och skadeståndsansvar. Enligt utredningen var det därför bättre att länsstyrelsen, som inte beövde riskera detta ansvar, fattade beslutet om sådana extraordinära åtgärder. Förslaget ledde aldrig till någon lagstiftning.

51Miljöbalken under utveckling, SOU 2002:50, s. 177. 52 Älvsäkerhet SOU 1995:40.

Åtgärder med stöd av LSO

Miljööverdomstolen konstaterade i avgörandet MÖD 2002:34 att ett tillståndsbesluts rättskraft enligt 24 kap. 1 § MB kan få vika på grund av tvingande säkerhetsskäl. I avgörandet hänvisas till MB:s förarbeten53 där det anges att en tillståndsdom eller ett tillståndsbeslut enligt miljölagstiftning inte har någon rättskraft i förhålllande till krav på åtgärder med stöd av räddningstjänstlagen. Räddningstjänstlagstiftningen har numera ersatts av LSO.

Enligt 6 kap. 2 § LSO får räddningsledaren vid en räddningsinsats bereda sig och medverkande personal tillträde till annan fastighet. Räddningsledaren får även bl.a. göra ingrepp i annans rätt och föra bort eller förstöra annans egendom. Rätt att besluta om sådana åtgärder har även länsstyrelsen för det fall ansvaret för räddningsinsatserna övertagits med stöd av 4 kap. 10 § LSO.

I begreppet ingrepp i annans rätt ligger till exempel att besluta om avsänkning av ett magasin på ett sätt som kan strida mot vad som regleras i ett tillstånd. Utöver att det kan strida mot vad som regleras i ett tillstånd kan åtgärden även stå i strid med dammägarens intressen eftersom produktionsförlust kan uppstå.

För att ingrepp i annans rätt ska få företas krävs enligt bestämmelsen att det är fråga om en räddningsinsats. En räddningsinsats enligt LSO och även enligt tidigare räddningstjänstlagstiftningen kan endast bli aktuell då det redan är fråga om en olycka eller överhängande fara för en olycka. Det innebär att om dessa omständigheter inte föreligger kan ingrepp i annans rätt med stöd av LSO inte företas.

Utöver att situationen i fråga måste vara en räddningsinsats måste den även ge motiv till ingreppet med hänsyn till behovet av ett snabbt ingripande, det hotade intressets vikt, kostnaderna för insatsen och omständigheterna i övrigt.

Med olycka avses enligt förarbetena till LSO en plötsligt inträffad händelse som har medfört eller som kan befaras medföra skada. Ett dammbrott kan utgöra en sådan olycka. När överhängande fara för dammbrott ska anses föreligga finns inte angivet i vare sig förarbeten eller praxis.

Miljöbalkskommittén hade i betänkandet SOU 2002:50 att överväga bl.a. om det skulle införas ytterligare möjligheter för samhället att ingripa i en översvämningssituation genom att besluta att frångå den tappning av vatten som fastställts genom vattendomar.

53Prop. 1997/98:145 del 2, s. 252.

Efter att ha redogjort för ovanstående möjligheter för samhället att besluta med stöd av MB eller dåvarande räddningstjänstlagen fann kommittén inte skäl att föreslå nya bestämmelser. Resonemanget avser översvämningssituationer men kan i stora delar översättas till ett dammbrott. 54 I stället för ändrade och mer omfattande möjligheter för samhället att ingripa konstaterade kommittén att behovet av samordningsinsatser är betydligt större.

Även utredningen om översyn av räddningstjänstlagen uppmärksammade i sitt betänkande55 ovanstående begränsningar i samhällets möjligheter att ingripa. Utredningen hade dock inte enligt sina direktiv i uppdrag att utvidga begreppet räddningsinsats och föreslog därför ingen ändring.

3.7.2. Föreläggande vid icke akuta situationer

I de fall en icke akut situation föreligger men där tillsynsmyndigheten uppmärksammar att säkerheten vid dammen eller i ägarens arbete och organisation inte är tillräcklig kan myndigheten behöva förelägga om åtgärder. Det kan t.ex. vara fråga om att dammen eller ägarens säkerhetsarbete inte uppfyller tillräckliga säkerhetskrav. Dammen kanske inte klarar av att avbörda ett dimensionerande flöde och behöver byggas om. I avvaktan på en sådan ombyggnad kan säkerhetsåtgärder behöva vidtas. Det kan avse en temporär avsänkning av magasinet till dess att åtgärder vidtagits. Utredningen vill framhålla att det ligger i allas intresse, såväl dammägares som tillsynsmyndighetens och det allmännas att åtgärder vidtas för att undvika ett dammhaveri.

Om en åtgärd inte begränsar något som omfattas av ett rättskraftigt tillstånd finns inga hinder att förelägga om åtgärder. Ett sådant föreläggande kan då meddelas med stöd av bl.a. de allmänna hänsynsreglerna i 2 kap MB. Av försiktighetsprincipen så som den kommit till uttryck i 2 kap. 3 § MB följer att en dammägare är skyldig att utföra skyddsåtgärder för att förebygga, hindra eller motverka att verksamheten medför skada eller olägenhet för människors hälsa eller miljön. I förarbetena till MB exemplifieras ett antal försiktighetsmått. För vattenanläggningar anges bl.a. att dammar ska byggas så att de uppfyller säkerhetskrav.56

54Miljöbalken under utveckling, SOU 2002:50, s. 179 f. 55 Reformerad räddningstjänstlagstiftning, SOU 2002:10, s. 157 f. 56Prop. 1997/98:45 del 2, s. 18.

I sammanhanget bör även 17 kap. 2 § i 1983 års vattenlag uppmärksammas. Paragrafen, som innehöll en av vattenlagens underhållsbestämmelser, har tillsammans med ett antal dylika miljörättsliga bestämmelser tjänat som förebild till den allmänna hänsynsregeln i 2 kap. 3 § MB57. Bestämmelsen angav att vattenföretag som inverkar på vattenförhållandena ska drivas så att de inte i onödan skadar allmänna eller enskilda intressen. Enligt förarbetena var bestämmelsen endast tillämplig i de fall särskilda bestämmelser om vattenföretagets drift inte hade meddelats. Om det däremot inte hade angivits närmare i tillståndet hur innehållande och tappning vid en regleringsdamm skulle ske innebar bestämmelsen att åtgärderna skulle utföras så att onödiga skador på motstående intressen undveks.58

Som angivits ovan är tillsynsmyndighetens möjlighet att meddela förelägganden eller förbud begränsad av ett tillstånds rättskraft. Tillståndets rättskraft ger ägaren en viss trygghet. Samtidigt har ägaren ett uttryckligt ansvar att underhålla sin anläggning enligt 11 kap. 17 § MB. Ansvaret avser en skyldighet att underhålla sin anläggning så att det inte uppkommer skada för allmänna eller enskilda intressen genom ändringar i vattenförhållandena. Skyldigheten gäller vattenanläggningar, oavsett om tillstånd till dem har lämnats eller inte. Underhållsansvaret innebär att ägaren är skyldig inte bara att utföra löpande reparationer utan även att bygga om en anläggning som har tjänat ut.59

Det saknas praxis på hur 11 kap. 17 § MB kan tillämpas i de fall dammen och verksamheten vid dammen omfattas av ett rättskraftigt tillstånd. Enligt utredningen framgår inte i vare sig förarbeten till MB eller tidigare motiv till vattenlagen att underhållsskyldigheten på något sätt skulle begränsas av ett tillstånds rättskraft. Ett föreläggande om att vidta åtgärder med stöd av underhållsskyldigheten enligt 11 kap. 17 § MB borde därför kunna meddelas även för anläggningar med tillstånd. Säkerhetsskälen är avgörande60. Det bör dock enligt utredningen vara fråga om allvarliga brister som gör att tillståndets rättskraft bryts igenom. Som redan nämnts framgår av praxis att ett tillståndsbesluts rättskraft kan få ge vika på grund av tvingande säkerhetsskäl, se MÖD 2002:34.

57Miljöbalken – en skärpt och samordnad miljölagstiftning för en hållbar utveckling, SOU 1996:103, del 2, s. 22. 58 Strömberg, Vattenlagen med kommentar, s. 315. 59 Bengtsson m.fl., Miljöbalken (1 jan. 2011, Zeteo) kommentaren 11 kap. 17 § 60 Naturvårdsverket rapport 5126, Tillsyn över vattenverksamhet, s. 18.

Om tillsynsmyndigheten utifrån befintlig rapportering kan konstatera att det föreligger tecken på brister kan myndigheten med stöd av bestämmelserna i 26 kap. 21 och 22 §§ MB begära ytterligare information av ägaren eller att ägaren vidtar en utredning. Det kan avse brister såsom svagheter i konstruktionen men också i organisationen. Kan tillsynsmyndigheten inledningsvis visa på att det finns en konkret risk för att det föreligger brister i säkerheten bör det enligt utredningen åligga ägaren att kunna visa på att så inte är fallet. Tillsynsmyndigheten kan med stöd av 26 kap. 19 och 22 §§ MB förelägga en ägare att redovisa det underlag som kan behövas för att tillsynsmyndigheten ska kunna ta ställning till vilka åtgärder som krävs. Däremot kan inte myndigheten förelägga ägaren att ange vilka åtgärder som behöver vidtas för att höja säkerheten vid dammen eller inom organisationen, se MÖD 2004:23.

Skulle det visa sig att säkerheten vid anläggningen har sådana brister, om än inte akuta, bör en tillsynsmyndighet med stöd av befintliga bestämmelser kunna förelägga om säkerhetshöjande åtgärder. Det skulle enligt utredningen även kunna avse att sänka nivån i ett magasin trots att det skulle tvinga verksamhetsutövaren att frångå de vattenhushållningsbestämmelser som följer av tillståndet.

En rimlighetsavvägning enligt 2 kap. 7 § MB måste dock alltid göras. Nyttan som i det här fallet skulle utgöras av en höjd säkerhet måste sättas i relation till den produktionsförlust som en avsänkning innebär för dammägaren.

3.8. Egenkontroll

Systemet för tillsyn enligt MB bygger till stor del på att verksamhetsutövaren har en fungerande kontroll över sin egen verksamhet och rapporterar resultaten till tillsynsmyndigheten. Såväl tillsynsreglerna som bestämmelserna om egenkontroll syftar till att balkens regler efterlevs och att syftet uppfylls.

Stadgandet om egenkontroll finns i 26 kap. 19 § MB och omfattar den som bedriver verksamhet eller vidtar åtgärder som kan befaras medföra olägenheter för människors hälsa eller påverka miljön. Verksamhetsutövaren ska enligt bestämmelsen fortlöpande planera och kontrollera verksamheten för att motverka eller förebygga sådana verkningar. Syftet med egenkontrollen är alltså att verksamhetsutövaren ska ha kontroll över vilken påverkan verksamheten har på omgivningen.

3.8.1. Vilka dammar omfattas av egenkontroll

Bestämmelsen om egenkontroll medför ansvar oavsett om det avser näringsverksamhet eller om verksamheten drivs privat. I de fall där det bedrivs aktiv vattenverksamhet vid t.ex. kraftverksdammar eller gruvdammar där drift pågår är det uppenbart att bestämmelserna om egenkontroll är tillämpliga. Skyldigheten att bedriva egenkontroll kvarstår så länge miljöpåverkan pågår. Det innebär att ansvaret för att utöva egenkontroll för en verksamhetsutövare kan fortgå även efter det att en verksamhet är nedlagd. Gamla dammar där verksamheten vid dammarna sedan länge upphört och den ekonomiska nyttan saknas omfattas av bestämmelsen om egenkontroll. Även sådana vattenanläggningar där det inte bedrivs någon aktiv vattenverksamhet har ansetts kunna omfattas av bestämmelserna om egenkontroll, t.ex. överfallsdammar.

3.8.2. Egenkontrollens utformning och omfattning

En verksamhetsutövare med egenkontrollansvar ska genom egna undersökningar eller på annat sätt hålla sig underrättad om verksamhetens eller åtgärdens påverkan på miljön. Det är den som bedriver en verksamhet som har störst kunskap om den och dess verkningar. Kontrollen av den egna verksamheten ska utgöra en integrerad del av den dagliga verksamheten och därför också vara en pågående eller fortlöpande process. Bestämmelserna om egenkontroll knyter an till den omvända bevisbördan samt hänsynsreglerna i 2 kap. MB, särskilt bestämmelserna om att skaffa sig kunskaper och att i yrkesmässigt bedrivna verksamheter använda bästa möjliga teknik. Verksamhetsutövarens ansvar inskränker sig inte till att kontrollera att balkens bestämmelser och för verksamheten särskilt meddelade villkor efterlevs. Det ankommer därutöver på denne att aktivt hålla sig informerad om verksamhetens påverkan på miljön. Ansvaret avser även påverkan som i och för sig är tillåten.

Det är vanligt att det i tillståndet föreskrivs att verksamhetsutövaren ska utforma och inkomma med ett kontrollprogram till tillsynsmyndigheten. I ett kontrollprogram beskriver verksamhetsutövaren hela eller vissa delar av egenkontrollen. Tillsynsmyndigheten kan även enligt 26 kap. 19 § tredje stycket MB begära att verksamhetsutövaren ska lämna förslag på kontrollprogram eller förbättrande åtgärder.

3.8.3. Förordningen (1989:901) om verksamhetsutövares egenkontroll

Förordningen (1989:901) om verksamhetsutövares egenkontroll omfattar den som yrkesmässigt bedriver verksamhet eller vidtar åtgärder som omfattas av tillstånds- eller anmälningsplikt enligt 9 kap. eller 11–14 kap. MB. Det innebär att förordningen gäller anmälnings- eller tillståndspliktiga verksamheter men också sådana åtgärder som vidtas inom ramen för en yrkesmässigt bedriven verksamhet.

Reglerna gäller således för både miljöfarlig verksamhet och vattenverksamhet. I fråga om vattenverksamhet regleras ett generellt undantag från anmälnings- eller tillståndsplikten i 11 kap. 12 § MB. Verksamhetsutövaren måste visa att det är uppenbart att varken allmänna eller enskilda intressen skadas, se avsnitt 3.3.1.

Det finns ingen rättslig definition av yrkesmässig. De dammanläggningar som inte kan anses ingå i en yrkesmässigt bedriven verksamhet omfattas inte av egenkontrollförordningens bestämmelser. Däremot omfattas de av kraven som anges i 26 kap. 19 § MB.

Egenkontrollförordningens bestämmelser innebär ingen inskränkning i de krav rörande verksamhetskontroll som en tillsynsmyndighet kan ställa i ett enskilt fall eller som kan ha föreskrivits enligt annan lagstiftning, 2 §. Förordningens bestämmelser om egenkontroll utgör således en miniminivå för hur verksamhetsutövarnas egenkontroll ska vara utformad. Mer långtgående krav på rapportering eller undersökningar kan ställas av tillsynsmyndigheten i enskilda fall. De måste dock självklart vara motiverade utifrån balkens övriga bestämmelser.

Det är verksamhetsutövaren som har att visa att den verksamhet som bedrivs eller de åtgärder som vidtas uppfyller kraven i MB, jfr kravet på omvänd bevisbörda i 2 kap. 1 § MB. För att verksamhetsutövaren ska kunna visa detta bör denne dokumentera egenkontrollen på ett ändamålsenligt sätt. Liksom utformningen av egenkontrollen bör även omfattningen av dokumentation anpassas till verksamhetens typ och storlek men även till dess påverkan på miljön och människors hälsa. I 4–7 §§ egenkontrollförordningen finns bindande bestämmelser om dokumentation.

Fördelning av det organisatoriska ansvaret

Av förordningens 4 § följer att det för varje verksamhet ska finnas en fastställd och dokumenterad fördelning av det organisatoriska ansvaret för de frågor som gäller för verksamheten enligt MB, föreskrifter som meddelats med stöd av MB samt domar och beslut rörande verksamhetens bedrivande och kontroll. Den fastställda ansvarsfördelningen bör enligt Naturvårdsverkets allmänna råd, NFS 2001:2, avse alla frågor som har eller kan ha någon betydelse för skyddet av miljön och människors hälsa. Det är vidare viktigt att den som åläggs ansvar för en viss uppgift också ges förutsättningar att ta ansvaret. Det kan avse nödvändiga förutsättningar i form av kunskaper, befogenheter att fatta beslut och att vidta åtgärder samt tillräckliga resurser i form av personal, pengar och tid.

Rutiner för kontroll av utrustning

Av förordningens 5 § följer att verksamhetsutövaren ska ha dokumenterade rutiner för att fortlöpande kontrollera att utrustning m.m. för drift och kontroll hålls i gott skick, för att förebygga olägenheter för människors hälsa och miljön. Kontrollen ska omfatta hela dammen.

Enligt Naturvårdsverkets allmänna råd bör kontrollrutinerna avse sådan utrustning som har eller kan få betydelse för skyddet av människors hälsa eller miljön om de inte är i gott skick. I fråga om dammar kan det avse avbördningsanordningar m.m.

Även utrustning för kontroll av verksamheten bör enligt de allmänna råden omfattas av rutinerna. Det kan avse utrustning för bl.a. mätning av läckage och rörelser i dammkroppen.

Undersökning av risker och underrättelse till myndigheten

Enligt 6 § i förordningen ska verksamhetsutövaren fortlöpande och systematiskt undersöka och bedöma riskerna med verksamheten ur hälso- och miljösynpunkt. Resultatet av detta ska dokumenteras. Enligt Naturvårdsverkets allmänna råd bör risker under såväl normal drift som vid särskilda händelser, driftstörningar eller olyckor undersökas och bedömas. Omfattningen och förfarandet får anpassas efter verksamhetens art.

Risker kan exempelvis bero på den använda tekniken och arbetsmetoderna men också på organisationen eller på administrativa brister i form av bristande dokumentation av rutiner.

Enligt Naturvårdsverkets allmänna råd bör verksamhetsutövaren identifiera riskkällor. Utifrån dessa bör verksamhetsutövaren bedöma sannolikheten för att en viss händelse eller onormala driftförhållanden ska uppstå samt bedöma dess konsekvenser. Undersökningen och bedömningen bör fokusera på sådana risker som kan ha eller få någon påvisbar betydelse för skyddet av människors hälsa eller miljön. Verksamhetsutövaren bör efter genomförd bedömning värdera om de identifierade och uppskattade riskerna går att acceptera eller om de måste åtgärdas.

Ny kunskap eller nya rön som blivit allmänt tillgängliga eller kända kan också leda till att verksamhetsutövaren bör undersöka och bedöma en eventuell risk. I fråga om dammar skulle t.ex. ett dammbrott vid en anläggning kunna föranleda att liknande dammkonstruktioner som den som havererat bör undersökas mer ingående.

Om det i verksamheten inträffar en driftstörning eller liknande händelse som kan leda till olägenheter för människors hälsa och miljön, ska verksamhetsutövaren omgående underrätta tillsynsmyndigheten om detta. Enligt Naturvårdsverkets allmänna råd bör en sådan underrättelse lämnas redan vid misstanke om att olägenheter från en störning eller en händelse kan uppstå. Det bör ske utan att den faktiska risken först undersöks. Underrättelseskyldigheten bör inte frånta verksamhetsutövaren från ansvar för händelsen och konsekvenser av den.

Av den ansvarsfördelning som ska finnas enligt 4 § bör det framgå vem som ansvarar för att underrätta myndigheten vid störningar eller andra händelser.

3.8.4. Myndighetsföreskrifter om egenkontroll

Naturvårdsverket och Socialstyrelsen får enligt 8 § i egenkontrollförordningen meddela ytterligare föreskrifter inom sina ansvarsområden enligt miljötillsynsförordningen. Svenska kraftnät har inte motsvarande föreskriftsrätt för sitt ansvarsområde, dammsäkerhet.

Naturvårdsverket har som redan nämnts lämnat allmänna råd och också gett ut en handbok om egenkontroll men bara meddelat en föreskrift som omfattar genomförande av mätningar och provtagningar i vissa miljöfarliga verksamheter.

3.9. Sanktioner

Sanktioner på miljöområdet är till för att miljöregleringen ska få genomslag. I begreppet sanktion ingår både straff och miljösanktionsavgifter. Dessa sanktioner syftar bakåt i tiden och avser en redan begången gärning. Vite är också en typ av sanktion vars syfte är att förmå någon att vidta eller att underlåta att vidta en åtgärd. Vite har omnämnts i avsnitt 3.6.7. Nedan beskrivs den straffrättsliga regleringen i MB som kan beröra dammsäkerhet, miljösanktionsavgifter samt företagsbot.

3.9.1. Straffrättsliga regler

Enligt 26 kap. 2 § MB ska tillsynsmyndigheten anmäla till polis- eller åklagarmyndigheten om det finns misstanke om brott. Det gäller överträdelser av bestämmelser i MB eller föreskrifter meddelade med stöd av balken. Så snart en straffbar överträdelse konstateras ska tillsynsmyndigheten anmäla de faktiska förhållandena. Tillsynsmyndigheten ska inte själv bedöma om överträdelsen kan föranleda fällande dom eller om det är ett ringa brott. Bedömningar av gärningens allvar, om vårdslöshet eller uppsåt förelegat, vem som är ansvarig för överträdelsen och liknande ska ske i den efterföljande brottsutredningen. 61

De viktigaste miljöstraffrättsliga reglerna finns i 29 kap. MB. Även några regler i 3, 12 och 13 kap. brottsbalken kan undantagsvis aktualiseras såsom vållande till kroppsskada eller sjukdom, vållande till annans död, skadegörelse samt spridande av gift och smitta.

Miljöbrott

Enligt 29 kap. 1 § 4 MB kan den som med uppsåt eller av oaktsamhet bedriver verksamhet eller vidtar en åtgärd som ändrar yt- eller grundvattennivån på ett sätt som skadar eller kan skada människors hälsa, djur eller växter i en omfattning som inte har ringa betydelse eller som medför eller kan medföra någon annan betydande olägenhet i miljön dömas för miljöbrott. Straffskalan för brottet är böter till fängelse i högst två år. Dammbyggnader, markavvattningar och åtgärder som innebär bortledande av grundvatten är

61Prop. 1997/98:45 del 2, s. 267.

typiska företeelser som kan omfattas. Straffbarheten omfattar inte åtgärder som är tillåtna enligt vad som framgår av ett tillstånd för en vattenverksamhet. Om tillstånd lämnats för verksamheten och en åtgärd vidtas inom ramen för tillståndet, döms inte till ansvar enligt 1 §, vilket följer av sista stycket.

Otillåten miljöverksamhet

Om någon med uppsåt eller av oaktsamhet påbörjar eller bedriver en verksamhet eller vidtar en åtgärd utan att ha fått erforderligt tillstånd eller godkännande kan han eller hon dömas för otillåten miljöverksamhet, 29 kap. 4 § första stycket 1d–e MB. Det gäller även om man underlåtit att göra anmälan eller inte iakttagit föreskriven tidsfrist innan verksamheten eller åtgärden påbörjats. Det kan för vattenverksamhet komma i fråga om man inte har tillstånd för en anläggning som kräver tillstånd eller inte anmält en anmälningspliktig vattenverksamhet. Straffskalan är böter eller fängelse i högst två år.

Som nämnts i avsnitt. 3.3.1 krävs inte tillstånd eller anmälan för en vattenverksamhet för det fall verksamhetsutövaren kan visa att det är uppenbart att varken allmänna eller enskilda intressen inte skadas. En felaktig bedömning av verksamhetsutövaren i denna del kan innebära en straffbar lagöverträdelse för det fall åtgärden i fråga vidtas.

Försvårande av miljökontroll

Brottet försvårande av miljökontroll enligt 29 kap. 5 § MB avser lämnande av oriktiga uppgifter till myndigheter som från miljö- och hälsoskyddssynpunkt har betydelse för myndighetens prövning eller tillsyn. Lämnandet måste ha skett med uppsåt eller av oaktsamhet. Bestämmelsen avser lämnande av oriktiga uppgifter i ansökan, anmälan eller annan handling där uppgiftsskyldigheten framgår av regeringens föreskrift eller där skyldigheten att lämna uppgifter följer av beslut i det enskilda fallet. I punkten 2 nämns särskilt brott mot skyldigheten att underrätta tillsynsmyndigheten om driftstörningar i verksamheten. Sådana bestämmelser finns i bl.a. egenkontrollförordningen.

Det måste således finnas en uttrycklig skyldighet i en författning att lämna vissa uppgifter. Någon generell straffbeläggning av oriktiga uppgifter som lämnas in till myndighet är det alltså inte fråga om. Att muntligen fara med osanning är inte straffbelagt enligt den punkten.

Straffskalan uppgår även för detta brott till böter eller fängelse i högst två år.

Brott mot underhållsskyldigheten

Enligt 29 kap. 8 § 6 MB kan den som med uppsåt eller oaktsamt bryter mot den underhållsskyldighet som föreligger enligt 11 kap. 17 § första stycket, 20 § första stycket och 21 § första stycket dömas till böter eller fängelse i högts två år.

3.9.2. Miljösanktionsavgifter

Miljösanktionsavgifter är ett administrativt ingripande som följer på en överträdelse av en angiven bestämmelse i MB eller en föreskrift meddelad med stöd av balken. I dag finns ingen miljösanktionsavgift kopplad till någon bestämmelse som rör vattenverksamhet och vattenkraft.

I 30 kap. MB anges ramarna för avgifterna medan den mer detaljerade regleringen finns i förordningen (1998:950) om miljösanktionsavgifter. Sedan den 1 januari 2007 kan såväl enskilda som näringsidkare och myndigheter påföras sanktionsavgift. Vilka överträdelser som är sanktionerade med en avgift anges i bilagan till förordningen. Den typ av överträdelser som hittills angivits är huvudsakligen sådana där det klart kan konstateras om ett brott mot reglerna skett. För sent inkomna rapporter är en sådan överträdelse. Sanktionsavgiftens storlek kan uppgå till minst 1 000 kr och högst 1 000 000 kr. Även beloppen anges i bilagan till miljösanktionsförordningen under respektive överträdelse.

När regeringen fastställer miljösanktionsavgiftens storlek ska den väga in såväl hänsyn till överträdelsens allvar som betydelsen av den bestämmelse som överträdelsen avser. Med det senare uttrycket avses de objektiva omständigheterna såsom hur lång tid överträdelsen har pågått, överträdelsens omfattning, den typiska faran som överträdelsen medför samt känsligheten hos den omgiv-

ning som påverkas. Uttrycket ”betydelsen av den bestämmelse som överträdelsen avser” syftar på betydelsen av bestämmelsen som sådan och intresset av det den är avsedd att reglera. Härmed menas att en värdering av skyddsintresset görs. Skydd av människors liv och hälsa ska ges en tyngre vikt än de bestämmelser som avser att skydda estetiska intressen eller befrämja det rörliga friluftslivet.62

Som exempel på överträdelser och därtill kopplade avgifter kan nämnas att ett för sent inlämnande av miljörapport för miljöfarlig verksamhet kan kosta 2 000 kr (A-verksamhet) eller 1 000 kr (Bverksamhet). Miljösanktionsavgiften för en överträdelse av 4 § egenkontrollförordningen om krav på fastställd och dokumenterad fördelning av det organisatoriska ansvaret uppgår till 50 000 kr (Averksamhet) eller 25 000 kr (B-verksamhet). Likaså är överträdelse av 5 § egenkontrollförordningen om dokumenterade rutiner för fortlöpande kontroll belagt med miljösanktionsavgift. Här påpekas åter att för närvarande avser överträdelserna enbart miljöfarlig verksamhet. Motsvarande finns inte för vattenverksamhet.

Av 30 kap. 2 § MB följer att avgiften ska tas ut även om överträdelsen inte har skett uppsåtligen eller av oaktsamhet. Ansvaret är således strikt. Det krävs inte att överträdelsen har medfört någon ekonomisk fördel. Det finns dock vissa i paragrafen angivna undantag.

Det är respektive tillsynsmyndighet som ska besluta om miljösanktionsavgift. Avgiften tillfaller dock staten. Tillsynsmyndighetens beslut överklagas till mark- och miljödomstolen. Det gäller även i de fall kommunen är tillsynsmyndighet.

3.9.3. Företagsbot

Det rena straffansvaret placeras alltid på fysiska personer även om miljöbrottet har skett i näringsverksamhet. Om brottet har begåtts i näringsverksamhet och strängare straff än penningböter är föreskrivet finns också möjlighet att påföra en näringsidkare, som kan vara en juridisk person, en företagsbot enligt 36 kap. 7 § brottsbalken.

För att en näringsidkare ska kunna åläggas en företagsbot krävs att näringsidkaren inte har gjort vad som skäligen kunnat krävas för att förebygga brottsligheten. Ansvar kan således bli aktuellt på grund av bristande rutiner och kontroller till förebyggande av

62Prop. 1997/98:45 del 1, s. 539.

brott. Företagsbot kan också påföras om brottet har begåtts av en person i ledande ställning eller en person som annars haft ett särskilt ansvar för tillsyn eller kontroll i verksamheten.

Det finns inte något krav på att gärningsmannen åtalas för brottet eller ens identifieras, men det måste alltså stå klart att ett brott har blivit begånget. Företagsbot ska fastställas till lägst 5 000 kr och högst 10 miljoner kr.

3.10. Förordningen om utvinningsavfall – särskild reglering för gruvdammar

Såsom nämnts i kap. 2 är gruvdammar en typ av damm som omfattas av utredningsuppdraget. Utöver befintligt regelverk i MB och angränsande förordningar regleras gruvdammars drift och kontroll även i förordningen (2008:722) om utvinningsavfall (utvinningsavfallsförordningen).

Utvinningsavfallsförordningen trädde i kraft den 1 september 2008 och är en följd av implementeringen av EG-direktivet om hantering av avfall från utvinningsindustrin (2006/21/EG). Förutom i utvinningsavfallsförordningen har direktivet genomförts i redan befintliga bestämmelser i MB t.ex. kravet i 2 kap. 3 § på att bästa möjliga teknik ska användas, kraven på tillstånd eller anmälan enligt 9 kap. 6 § och 6a §, förordningen (2003:789) om skydd mot olyckor (FSO), förordningen (1998:899) om miljöfarlig verksamhet och hälsoskydd. Utvinningsavfallsförordningen ersätter inget tidigare regelverk.

3.10.1. Definitioner

Med utvinningsavfall avses enligt 3 § avfall från prospektering, utvinning eller bearbetning, avfall från lagring av en mineraltillgång och avfall från driften av bergtäkt.

Enligt 5 § avses med avfallsanläggning en damm, ett upplag eller ett annat område som är avsett för uppsamling eller deponering av utvinningsavfall i fast eller flytande form, med de dammar och andra konstruktioner som är avsedda att stänga inne, hålla tillbaka, avgränsa eller på annat sätt stödja ett sådant område. Med avfallsanläggning avses inte en hålighet efter utvinning där annat avfall än

farligt avfall läggs tillbaka efter utvinning för efterbehandlingsändamål eller för konstruktionsändamål.

Om en anläggning enligt förordningens definition utgör en riskanläggning, omfattas den av särskilda krav. Verksamhetsutövaren ska då se till att det finns en strategi för att förebygga allvarliga olyckor och en intern beredskapsplan. För att utgöra en riskanläggning ska avfallsanläggningen vid en riskbedömning ge grund för antagandet att en allvarlig olycka skulle kunna inträffa om ett upplag kollapsar, en fördämning rämnar eller till följd av någon annan brist i anläggningen eller felaktig drift av den. Vid bedömningen ska man beakta anläggningens nuvarande och framtida storlek, lokalisering samt miljöpåverkan. En avfallsanläggning kan också bedömas som en riskanläggning om den innehåller avfall över en viss mängd som klassificeras som farligt enligt avfallsförordningen (2011:927) eller innehåller ämnen eller beredningar som klassificeras som farliga enligt Kemikalieinspektionen63.

Kommissionen beslutade den 20 april 2009 om definitionen av kriterierna för klassificering av avfallsanläggningar. I beslutet föreskrivs närmare om vilka kriterier som ska gälla för att en anläggning ska klassas som en avfallsanläggning i kategori A motsvarande riskanläggning i utvinningsavfallsförordningen. I skrivande stund är det oklart om eller hur beslutet ska implementeras i svensk rätt.

3.10.2. Krav på riskanläggningar

Verksamhetsutövaren ska för en riskanläggning enligt 19 § i utvinningsavfallsförordningen se till att det för anläggningen finns en strategi för att förebygga allvarliga olyckor, ett säkerhetsledningssystem som genomför strategin och en intern beredskapsplan som specificerar de åtgärder som ska vidtas vid anläggningen i händelse av en olycka. Strategin, säkerhetsledningssystemet och den interna beredskapsplanen ska vara anpassade till de risker för allvarliga olyckor under drift och efter stängning som anläggningen är förenad med.

63 Klassificeringen ska ha skett med stöd av 18 § förordningen (2008:245) om kemiska produkter och biotekniska organismer för att genomföra rådets direktiv 67/548/EEG av den 27 juni 1967 om tillnärmning av lagar och andra författningar om klassificering, förpackning och märkning av farliga ämnen, senast ändrat genom kommissionens direktiv 2009/2/EG, eller Europaparlamentets och rådets direktiv 1999/45/EG av den 31 maj 1999 om tillnärmning av medlemsstaternas lagar och andra författningar om klassificering, förpackning och märkning av farliga preparat, senast ändrat genom Europaparlamentets och rådets förordning (EG) nr 1272/2008.

Skyldigheterna som kopplats till riskanläggningar i förordningen har stora likheter med skyldigheterna för Sevesoverksamheter på den högre kravnivån enligt den så kallat Sevesolagstiftningen, se vidare i avsnitt 4.2.2. Riskanläggningar som till följd av avfallets karaktär omfattas av Sevesolagstiftningen (både högre och lägre kravnivå) är därför undantagna från bestämmelserna om strategi för att förebygga allvarliga olyckor, intern beredskapsplan och information till allmänheten i förordningen om utvinningsavfall.

Strategi

Strategin ska innehålla de övergripande mål och handlingsprinciper för hantering av riskerna för allvarliga olyckor samt en beskrivning av hur säkerhetsledningssystemet är uppbyggt. Strategin ska vara dokumenterad och verksamhetsutövaren ska se till att tillsynsmyndigheten får en kopia.

Säkerhetsledningssystem

Säkerhetsledningssystemet ska avse styrningen av verksamheten i fråga om organisation och ansvarsfördelning, metoder, rutiner och andra förfaranden samt resurser för att utforma strategin och genomföra den. Säkerhetsledningssystemet ska enligt 21 § utvinningsavfallsförordningen omfatta de rutiner och instruktioner som behöver fastställas och tillämpas i fråga om

1. uppgifter och ansvarsområden för den personal på alla nivåer i

organisationen som deltar i arbetet med att hantera risker för allvarliga olyckor, identifiering av utbildningsbehov och genomförande av den utbildning som behövs samt andra anställdas och eventuella entreprenörers deltagande,

2. att systematiskt kunna identifiera risker för allvarliga olyckor

som uppkommer vid normala och onormala driftförhållanden och att bedöma sådana riskers sannolikhet och allvar,

3. det underhåll av anläggningen, de processer, den utrustning, de

åtgärder vid tillfälliga avbrott eller det som i övrigt behövs för en säker drift,

4. att planera och genomföra nybyggnationer eller andra ändringar

i anläggningen,

5. att med systematisk analys identifiera förutsebara nödsitua-

tioner samt förbereda, prova och se över beredskapsplaner avsedda för sådana situationer,

6. rapportering vid upptäckt av skyddsåtgärder som inte fungerar,

tillbud, och allvarliga olyckor, att undersöka, följa upp och lära av vunna erfarenheter, att löpande bedöma hur säkerhetsledningssystemet stämmer överens med de mål och principer som avses i 20 § samt att undersöka och korrigera bristande överensstämmelse, och

7. att regelbundet och systematiskt göra en revision och översyn

av strategin och säkerhetsledningssystemets effektivitet och lämplighet samt att verksamhetsutövarens högsta ledning deltar i revisionen och översynen, gör nödvändiga uppdateringar och dokumenterar detta.

Vidare ska det i säkerhetsledningssystemet ingå en person som har det operativa ansvaret för att strategin genomförs och för att den kontinuerligt övervakas.

Intern beredskapsplan

Inför att den interna beredskapsplanen upprättas ska verksamhetsutövare samråda med kommunen och de anställda samt annan personal som kan påverka säkerheten. Verksamhetsutövaren ska se till att tillsynsmyndigheten får en kopia av den interna beredskapsplanen.

Den interna beredskapsplanen ska enligt 24 § utvinningsavfallsförordningen alltid innehålla:

1. namn eller befattning på de personer som har befogenhet att starta

en intern räddningsinsats, samt på de personer som har till uppgift att sköta samordningen av omedelbara räddningsinsatser,

2. uppgift om vem eller vilka som ansvarar för kontakten med

kommunen i fråga om upprättandet av plan för räddningsinsatser enligt 3 kap. 6 § förordningen (2003:789) om skydd mot olyckor,

3. en beskrivning av vilka åtgärder som ska vidtas för att hindra

och begränsa skador på människors hälsa och miljön för varje situation eller slag av händelse som kan förutses och som i verksamheten kan spela en avgörande roll för uppkomsten av en allvarlig olycka och andra incidenter, även omfattande en redogörelse för säkerhetsutrustning och tillgängliga resurser,

4. en beskrivning av varningssystem och de åtgärder som ska vidtas

vid varning samt de åtgärder i övrigt som syftar till att begränsa skador på människors hälsa,

5. en beskrivning av rutiner för alarmering av kommunens organi-

sation för räddningstjänst vid en olycka och den information som ska lämnas vid alarmering,

6. en beskrivning av rutiner för samverkan med kommunens orga-

nisation för räddningstjänst vid en olycka, innefattande rutiner för hur stöd ska lämnas vid insatser utanför verksamheten,

7. en beskrivning av hur personalen utbildas och övas och, i före-

kommande fall, hur samövning med kommunens organisation för räddningstjänst genomförs, och

8. en beskrivning av planerna för hur miljön snabbt ska kunna

återställas efter en allvarlig olycka i syfte att minimera effekterna.

3.10.3. Avfallshanteringsplan

Den som driver en verksamhet som ger upphov till utvinningsavfall eller driver en avfallsanläggning ska enligt 34 § utvinningsavfallsförordningen ha en avfallshanteringsplan. Avfallshanteringsplanen ska innehålla

1. en beskrivning av den eller de verksamheter som ger upphov till

utvinningsavfallet,

2. en redogörelse för de kemiska ämnen som används eller är

avsedda att användas vid den bearbetning som ger upphov till utvinningsavfallet, med uppgifter om de kemiska ämnenas stabilitet,

3. en uppgift om den uppskattade totala mängden utvinningsavfall

som kommer att produceras eller hanteras under verksamhetens planerade driftstid,

4. en beskrivning av de fysikaliska och kemiska egenskaperna hos

det utvinningsavfall som avses att deponeras, med uppgifter om avfallets stabilitet vid de atmosfäriska och meteorologiska förhållandena på platsen för deponin,

5. en beskrivning av den eller de deponeringsmetoder som är

avsedda för det utvinningsavfall som deponeras,

6. de uppgifter som utöver 2–5 krävs för den karakterisering som

avses i 26 §,

7. uppgifter om

a) de identifierade olycksrisker som verksamheten är förenad med, om planen avser en avfallsanläggning som inte är en riskanläggning, eller

b) att det finns en strategi för förebyggande av allvarliga olyckor, ett säkerhetssystem för genomförande av strategin och en intern beredskapsplan, om planen avser en riskanläggning, och

8. en redogörelse för hur verksamhetsutövaren i övrigt kommer att

följa bestämmelserna i 15–18, 25–29 och 31 §§.

Om planen avser en avfallsanläggning som inte är en riskanläggning, ska planen innehålla en redogörelse för varför anläggningen inte bedöms vara en riskanläggning.

3.10.4. Kommunens skyldigheter

Information till allmänheten

Kommunen har en skyldighet att informera allmänheten om det i kommunen finns personer som löper risk att påverkas av en allvarlig olycka vid en riskanläggning. Informationen kan ges på en webbplats eller på annat lämpligt sätt. Den information som ska tillhandahållas ska enligt 40 § utvinningsavfallsförordningen innehålla:

1. verksamhetsutövarens namn och uppgift om var anläggningen

finns,

2. en uppgift om vem hos kommunen som svarar för innehållet i

informationen,

3. en upplysning om att

a) anläggningen omfattas av bestämmelserna i 19–24 §§ om strategi för att förebygga olyckor och intern beredskapsplan, och

b) kommunen har fått all relevant information om de risker för allvarliga olyckor som anläggningen är förenad med samt om de åtgärder som har vidtagits eller ska vidtas för att förebygga, förhindra och minska skadliga effekter på människors hälsa och miljön,

4. en tydlig och enkel redogörelse för

a) aktiviteterna vid anläggningen,

b) de ämnen och beredningar som förekommer i anläggningen med angivande av ämnenas och beredningarnas vanliga namn eller namn på den eller de ämneskategorier som ämnena och beredningarna tillhör samt ämnenas och beredningarnas allmänna riskklassificering, och

c) det avfall i anläggningen som kan förorsaka allvarliga olyckor med upplysningar om avfallets viktigaste farliga egenskaper,

5. en allmän beskrivning av vilka allvarliga olyckor som skulle

kunna inträffa och sådana olyckors effekter på människors hälsa och miljön,

6. upplysningar om hur allmänheten kommer att varnas och

informeras om det händer en allvarlig olycka,

7. upplysningar om vilka åtgärder allmänheten bör vidta om det

händer en allvarlig olycka,

8. en upplysning om att den som driver anläggningen är skyldig

att vidta lämpliga åtgärder inom anläggningsområdet och samverka med den kommunala räddningstjänsten för att hantera och begränsa följderna av en olycka,

9. en upplysning om den plan för räddningsinsatser som finns

enligt 3 kap. 6 § förordningen (2003:789) om skydd mot olyckor, och

10. en upplysning om var mer information kan fås.

Den som driver eller i sin verksamhet har en riskanläggning är skyldig att ersätta de kostnader som varit skäliga för kommunens information till allmänheten.

Plan för räddningsinsatser

Enligt 3 kap. 6 § FSO ska kommunen upprätta en plan för räddningsinsatser för de anläggningar som klassats som riskanläggningar enligt utvinningsavfallsförordningen. Planen ska ha den omfattning som säkerheten för omgivningen kräver och allmänheten ska på lämpligt sätt ha möjlighet att lämna synpunkter. Den som driver en riskanläggning ska förse kommunen med upplysningar som kommunen behöver för att upprätta planen. Planen ska förnyas var tredje år eller när det annars till följd av ändrade förhållanden finns anledning till det.

3.10.5. Tillsyn och egenkontroll

Det operativa tillsynsansvaret regleras i MB och miljötillsynsförordningen. Operativ tillsynsmyndighet kan vara länsstyrelsen, eller i de fall tillsynen har överlåtits, kommunen. Enligt 47 § i utvinningsavfallsförordningen ska regelbundna inspektioner göras på plats. Anläggningarna som omfattas av utvinningsavfallsförordningen omfattas även av bestämmelserna om egenkontroll i såväl MB som egenkontrollförordningen.

Om det vid en avfallsanläggning inträffar något som kan påverka avfallsanläggningen stabilitet eller som kan innebär olägenheter för människors hälsa eller miljön är verksamhetsutövaren skyldig att underrätta tillsynsmyndigheten om detta, 49 § utvinningsavfallsförordningen. En sådan underrättelse ska ske så snart som möjligt och inte senare än inom 48 timmar. Verksamhetsutövaren ska även vid behov vidta åtgärder enligt den interna beredskapsplanen. Om tillsynsmyndigheten kommer med anvisningar om korrigeringsåtgärder ska dessa följas.

MSB har det centrala ansvaret för tillsynsvägledning när det gäller MB:s tillämpning i frågor om bestämmelser om förebyggande och hantering av allvarliga olyckor i förordningen om utvinningsavfall, se 3 kap. 8 § 3 miljötillsynsförordningen. För övriga bestämmelser i förordningen har Naturvårdsverket det centrala ansvaret för tillsynsvägledning. Svenska kraftnät har såsom nämnts det tillsynsvägledande ansvaret för dammsäkerhet enligt 11 kap. MB. Länsstyrelsen har tillsynen över kommunens skyldighet om plan för räddningsinsatser enligt FSO.

4 Internationell utblick och reglering för jämförbara verksamheter och

4.1. Internationell utblick

Utredningen har med stöd av Svenska kraftnät tagit fram uppgifter om hur dammsäkerhetsfrågor regleras i andra länder. Uppgifterna kommer från en pågående studie som genomförs av en arbetsgrupp inom ICOLD (International Commission on Large Dams, dam safety committee, working group on dam legislation). Publicering av studien planeras till år 2013.

Arbetsgruppen har skickat ut enkäter med frågor rörande regelverk, klassificering av dammar, tillsyn och ansvar för dammsäkerhet till medlemsländer inom ICOLD. Svar har inkommit från knappt 40 av ICOLD:s cirka 90 medlemsländer och uppföljande kontakter pågår. Cirka hälften av de medverkande länderna ligger i Europa. Vidare deltar bl.a. USA, Kanada och ytterligare fyra länder i Nord-/Sydamerika, Australien, Nya Zealand, ett antal länder i Asien som Kina, Japan, Indien, Indonesien, samt några afrikanska länder bl.a. Sydafrika.

4.1.1. Regelverk för dammsäkerhet

I de studerade länderna finns, med ett fåtal undantag, övergripande lagstiftningar såsom vattenlagstiftning och reglering om skydd mot olyckor och beredskap. Dessa övergripande regelverk innehåller generella regler som kan tillämpas på dammar och dammsäkerhet.

Många länder, delstater, etc. har därutöver specifika lagar för dammar och dammsäkerhet. Finland har vid sidan om sin vattenlag även en dammsäkerhetslag vilken omfattar bestämmelser om

planering och anläggande av dammar, klassificering, underhåll och drift, beredskap för olyckor samt straffbestämmelser. Likaså Norge har vid sidan om en vattenlag en mycket detaljerad och omfattande dammsäkerhetsförordning. Dammsäkerhetsförordningen innehåller bestämmelser om klassificering, tekniska krav på utformning, bestämmelser om drift och övervakning samt krav på egenkontroll. Dessutom reglerar förordningen krav på ägarföretagets organisation och kvalifikationskrav för vissa nyckelpositioner med avseende på dammsäkerhet.

Det är även vanligt att länder har bindande myndighetsföreskrifter alternativt att aktörer inom dammsäkerhetsområdet med stöd av branschen, högskolan och myndigheter tagit fram riktlinjer och standards som kompletterar det befintliga regelverket. Ofta är det landets medlemsorganisation inom ICOLD som tar fram sådana riktlinjer, exempelvis Canadian Dam Association i Kanada och SpanCOLD i Spanien. I Tyskland har de flesta delstater en egen vattenlag som i sin tur hänvisar till tekniska regelverk vad gäller krav på design, byggande, drift och övervakning. Det finns s.k. DIN-normer avseende dammsäkerhet men även andra tekniska standarder.

Sverige är således ett av fåtal länder som saknar särskilda bestämmelser om dammsäkerhet. I likhet med de flesta andra länder som ingår i studien har dock Sverige ett särskilt regelverk för gruvdammar.

Studien visar också på att länder som har ett bindande regelverk för dammsäkerhet i större utsträckning har modeller för att säkerställa ingenjörskompetens, certifieringsförfaranden för personal, en specialiserad tillsynsmyndighet och/eller en oberoende expertpanel som granskar anläggningarna.

4.1.2. Klassificeringssystem

I flertalet av de länder som deltagit i studien finns krav på klassning av dammen efter konsekvenser av dammbrott alternativt geometriska kriterier som dammens höjd och uppdämd volym vatten. Gången är normalt att dammägaren tar fram underlag och förslag på klass och myndigheten fastställer klassen. Klassningen ingår i de allra flesta länder i det bindande regelverket. Det vanliga är ett system indelat på tre till fyra klasser.

Klassificeringen utgår antingen från fara eller tänkbara konsekvenser såsom förlust av liv, samhällsviktiga anläggningar, ekonomiska värden, miljö m.m. eller indirekta mått på skadepotentialen såsom en kombination av dammens höjd och det uppdämda magasinets volym. Norges klassificeringssystem utgår i huvudsak från antalet s.k. boenheter som berörs av ett dammbrott. För att en damm ska hamna i den högsta konsekvensklassen ska mer än 150 boenheter beröras. Motsvarande kriterium i den finländska regleringen är fara för människoliv och fara för hälsan eller betydande fara för miljön eller egendom.

Indelningen i klasser tydliggör gränsdragning för vilka dammar regelverket gäller och vilken myndighet som ansvarar för tillsyn men utnyttjas även för att kunna ställa differentierade krav på t.ex. design, övervakning och egenkontroll, rapportering till myndighet m.m. Mer långtgående krav ställs genomgående på dammar med större konsekvenser av dammbrott.

4.1.3. Egenkontroll och myndighetsrapportering

På samma sätt som i Sverige vilar ansvaret för dammens säkerhet även i andra länder på dammägaren.

Det är obligatoriskt att ägaren ska ta fram program för övervakning av dammen, och normalt ska detta godkännas av tillsynsmyndigheten. Dammens klassificering styr frekvensen för vissa tillståndskontrollaktiviteter och rapporteringskrav. Normalt bygger övervakningen på att dammägaren övervakar, inspekterar m.m., men att rapportering sker till myndigheten som granskar rapporteringen.

Ägaren ansvarar för att löpande dammätningar, visuell tillståndkontroll, funktionsprov, osv. görs i enlighet med övervakningsprogrammet, samt att analys och dokumentation av observationerna görs. Ofta har en namngiven kvalificerad ingenjör hos ägaren ansvar för detta. Sammanställning av löpande övervakning görs normalt i en årlig rapport som ges in till myndigheten. Myndigheten ska granska och godkänna/lämna synpunkter på rapporten. I många länder finns det i regelverket krav på ingenjörens kompetens och erfarenhet. Myndighetens godkännande av kvalificerad personal är inte ovanligt.

Beroende på klass föreskrivs normalt att detaljerad dammsäkerhetsinspektion eller ”detailed review” ska göras minst en gång

per 5–10 år av kvalificerade ingenjörer. Inspektionen utförs ofta av en grupp av cirka tre stycken sakkunniga experter. Det förekommer att experterna måste väljas ur en förteckning/panel. Myndigheten eller motsvarande har, efter eventuell rekommendation från särskilt råd med denna uppgift, godkänt dessa mot fastställda krav på kompetens, erfarenhet och lämplighet i övrigt. Vid inspektion stäms dammsäkerheten av vid anläggningen mot regelverk, aktuellt tillstånd och drifterfarenheter, god ingenjörspraxis/riktlinjer, m.m. Granskningen leder fram till en sammanställning av avvikelser som behöver åtgärdas av ägaren. Myndigheten får normalt den detaljerade rapporten och ska kontrollera att den svarar mot regelverkets krav och godkänna den.

Det är således normalt dammägarens uppgift att visa för myndigheten att regelverket följs. Myndigheten ska kontrollera detta genom bl.a. granskning av kontrollprogram, årliga rapporter, rapporter över detaljerade inspektioner m.m. Det är mer ovanligt, men förekommer, att myndigheten själv genomför inspektioner av dammen. Det förekommer att myndigheten anlitar en expertpanel för genomförande av t.ex. 5-årsinspektion, men normalt är det dammägarens ansvar som en del i egenkontrollen.

Myndighetskontrollen ses i allmänhet som en ”extra” granskning av dammsägarens egenkontroll av säkerheten. Schweiz beskriver det som att det finns fyra skikt av övervakning/tillståndkontroll; 1.) driftpersonalen (dammvakt), 2.) erfaren ingenjör (ägarens ”dam safety engineer”/kvalificerade ingenjörer) 3.) experter (jfr de som gör FDU/5–10 års inspektion) 4.) statlig myndighet.

4.1.4. Myndighetstillsyn

I länder som t.ex. Schweiz, Österrike och Spanien utövas dammsäkerhetstillsyn över de stora dammarna alternativt dammar med stora konsekvenser i händelse av dammbrott av en specialiserad nationell myndighet eller organisation. Regionala myndigheter ansvarar för tillsyn av övriga dammar.

I Norge utövas tillsyn över samtliga dammar i landet av en central myndighet, NVE. NVE godkänner bl.a. konsekvensklass för dammen, utför inspektioner på anläggningarna, godkänner kompetensen hos vissa personer inom dammägarorganisationen och håller utbildning.

I Finland övervakas dammsäkerheten av de regionala miljöcentralerna i egenskap av dammsäkerhetsmyndighet. Myndighetsuppgifter som gäller dammsäkerhet har koncentrerats till tre av totalt 15 miljöcentraler.

4.1.5. Säkerställande av kompetens

Många länder har krav i sina regelverk för att säkerställa att nödvändig ingenjörskompetens finns hos såväl ägaren som hos tillsynsfunktionen. Det kan avse angivna kompetenskrav i regelverket men också att tillsynsmyndigheten ska godkänna vissa personer som ska utföra angivna arbetsuppgifter. Nedan ges några exempel på hur kompetens säkerställs i en del länder.

I Norge finns som redan nämnts fastställda kompetenskrav. NVE godkänner, med stöd av två råd med representation från branschen och NVE, personer som har ansvar för dammanläggningar (ägare) respektive för att göra dammsäkerhetsutvärderingar (konsulter).

Österrike har utöver tillsynsmyndigheten en expertkommission ”Dam Safety Commission”. Experterna utses av den nationella tillsynsmyndigheten och kommissionens ansvar definieras i förordning. Expertkommissionen definierar ”state of the art” på viktiga områden, granskar och utarbetar tekniska riktlinjer på uppdrag av den nationella tillsynsmyndigheten. Experter ur denna panel genomför vart femte år inspektioner av de stora dammarna på uppdrag av den nationella tillsynsmyndigheten.

I England, Wales och Skottland ska enligt lag särskilda ”panel engineers” anlitas av dammägaren för olika arbetsuppgifter. Det finns tre olika typer av ”panel engineers”; för inspektioner, för övervakning av drift och underhåll samt för övervakning av design och konstruktion. Dammanläggningarna ska bl.a. inspekteras vart tionde år av en ”inspection engineer”. ”Panel engineers” utses i femårsperioder av miljöministern på rekommendation av Society of Civil Engineer’s reservoir committee. En ”panel engineer” ska uppfylla krav på ingenjörskompetens, erfarenhet, kunskap om regelverk osv. men även vara i fysisk form för att kunna genomföra inspektioner.

4.2. Reglering för jämförbara verksamheter

4.2.1. Regleringen för kärnkraftverk

En kärnkraftsanläggnings verksamhet och dess säkerhet regleras i lagen (1984:3) om kärnteknisk verksamhet (kärntekniklagen), strålskyddslagen (1988:220) och MB. Bestämmelserna i dessa lagar kompletteras med förordningar, föreskrifter och allmänna råd.

Verksamheten vid en kärnkraftsanläggning är enligt MB en miljöfarlig verksamhet som omfattas av balkens regler i tillämpliga delar. Det innebär att bl.a. de allmänna hänsynsreglerna, tillsynsbestämmelserna är tillämpliga på en sådan anläggning. Likaså omfattas följderna av en redan inträffad olycka av reglerna i LSO.

Utöver balkens reglering finns även bestämmelser om bl.a. tillsyn och beredskap i kärntekniklagen och förordningen (1984:14) om kärnteknisk verksamhet. Kärntekniklagen är inriktad på att tillvarata dels säkerheten vid den kärntekniska verksamheten, dels Sveriges åtaganden på icke-spridningsområdet samt på tillsyn över och insyn i verksamheten. Därutöver regleras skydd för människor, djur och miljö mot skadlig verkan av strålning i strålskyddslagen. Lagens syfte är att behövliga skyddsåtgärder mot skador från strålning alltid ska kunna vidtas med stöd av lagen och skapa ett så fullständigt strålskydd som möjligt i samhället.

Utredningen om en samordnad reglering på kärnteknik- och strålskyddsområdet (Strålsäkerhetsutredningen) har i sitt betänkande, SOU 2011:18, föreslagit att kärntekniklagen och strålskyddslagen samordnas i MB.

Begreppet säkerhet

Begreppet säkerhet definieras i 4 § kärntekniklagen. Av begreppet framgår att säkerheten vid kärnteknisk verksamhet ska upprätthållas genom att de åtgärder vidtas som krävs för att förebygga fel i eller felaktig funktion hos utrustning, felaktigt handlande eller annat som kan leda till en radiologisk olycka. Kraven avser också haveribekämpande och konsekvenslindrande åtgärder. Genom de på detta sätt angivna kraven framhålls att säkerheten vid kärnteknisk verksamhet bestäms inte bara av utformningen av tekniska system m.m. utan också av organisatoriska, administrativa och personella faktorer.

Den uppställda målsättningen i kärntekniklagstiftningen för säkerhetsarbetet är att, så långt det över huvud taget är möjligt, undanröja riskerna för en radiologisk olycka och därmed ytterst för förluster av liv eller egendom. Kärntekniklagen har därför utformats så att tillståndsinnehavaren har givits ett ansvar för driften av den kärntekniska verksamheten som närmar sig det strikta. Se mer om föreslagna ändringar avseende ansvar i avsnitt 3.3.4.

Tillsyn och egenkontroll

Strålsäkerhetsmyndigheten är tillsynsmyndighet enligt såväl kärntekniklagen och strålskyddslagen som MB. Likaså är myndigheten tillsynsvägledande myndighet enligt miljöbalken för de verksamheter där kommunen eller länsstyrelsen är tillsynsmyndighet. Liksom andra tillsynsmyndigheter ska Strålsäkerhetsmyndigheten bedöma verksamhetsutövarens förmåga att leda och styra verksamheten utifrån ett strålsäkerhetsperspektiv. För varje kärnteknisk anläggning har myndigheten en särskild samordnare som håller ihop myndighetens tillsynsarbete.

Strålsäkerhetsmyndighetens tillsyn består i att inspektera anläggningarna, genomföra verksamhetsbevakningar, granska dokument och ansökningar samt genomföra samlade strålsäkerhetsvärderingar av samtliga anläggningar. Tillsynen bedrivs både löpande och med särskilda tillsynsåtgärder. Den löpande tillsynen innebär att myndigheten regelbundet undersöker hur anläggningarna uppfyller myndighetens krav på strålsäkerhet. Den särskilda tillsynen innebär att myndigheten fokuserar särskilt på en anläggning eller på en del av verksamheten.

Utöver bestämmelserna om tillsyn och egenkontroll i 26 kap. MB finns en nästan likalydande reglering i kärntekniklagen och strålskyddslagen. Tillståndshavaren ska på begäran av myndigheten lämna de upplysningar och tillhandahålla de handlingar som behövs för tillsynen. Vidare ska tillståndshavaren också ge myndigheten tillträde till anläggning eller plats där verksamhet bedrivs för undersökningar och provtagningar i den omfattning som behövs. Myndigheten får vid behov anlita polismyndigheten för biträde vid tillsynen.

Enligt kärntekniklagen får tillsynsmyndigheten besluta om de åtgärder som behövs för att lagen, föreskrifter eller villkor som har meddelats med stöd av lagen ska följas. I samma syfte får

myndigheten meddela förelägganden och förbud i enskilda fall. Om en verksamhetsutövare inte vidtar en åtgärd som ålagts denne får myndigheten låta vidta åtgärden på verksamhetsutövarens bekostnad.

Till skillnad från MB:s bestämmelser om förelägganden innehåller kärntekniklagens motsvarande bestämmelse i 18 § ingen begränsning av ett föreläggande eller förbuds omfattning. Möjligheten att meddela ett föreläggande eller förbud enligt 18 § kärntekniklagen är inte begränsat av ett tillstånds rättskraft enligt 24 kap. 1 § MB. Innebörden av lagens bestämmelser är alltså att Strålsäkerhetsmyndigheten i sin tillsyn har rätt att besluta om varje åtgärd som myndigheten bedömer nödvändig för säkerheten. Ett sådant tillsynsbeslut kan innebära t.ex. att en tillståndshavare föreläggs att vidta vissa åtgärder som villkor för fortsatt drift av en anläggning. Strålsäkerhetsmyndigheten kan också besluta om förbud för en verksamhet och ställa upp villkor för att den – efter förnyad prövning – ska få återupptas.

Minst vart tionde år ska en helhetsbedömning göras av anläggningens säkerhet och strålskydd enligt 10 a § kärntekniklagen. Bedömningen ska göras med hänsyn till utvecklingen inom vetenskap och teknik. Den ska innehålla analyser och redogörelser av

1. på vilket sätt anläggningens konstruktion, funktion, orga-

nisation och verksamhet uppfyller kraven i denna lag, MB och strålskyddslagen samt föreskrifter och villkor som har beslutats med stöd av dessa lagar, och

2. förutsättningarna för att dessa föreskrifter och villkor ska kunna

uppfyllas fram till nästa helhetsbedömning.

Tillsynsmyndighetens beslut ska gälla omedelbart, om inte annat bestäms. Till skillnad från tillsynsbeslut meddelade för andra verksamheter som regleras enligt MB får Strålsäkerhetsmyndighetens tillsynsbeslut överklagas hos regeringen.

Strålsäkerhetsmyndighetens metoder för tillsyn 1

Myndigheten använder sig huvudsakligen av fyra metoder för att kontrollera anläggningens säkerhetsarbete; nämligen inspektion, granskning, verksamhetsbevakning och uppföljning av händelser. Därutöver görs samlade strålsäkerhetsvärderingar.

Inspektion innebär att myndigheten på plats undersöker hur tillståndshavaren uppfyller krav enligt lagar, förordningar och föreskrifter. Det görs genom att intervjua personal på anläggningarna och granska dokument.

För varje inspektion sätter myndigheten ihop en grupp med olika kompetenser som kompletterar varandra beroende på inspektionens inriktning. Om brister upptäcks vid inspektionen kan det leda till att verksamhetsutövaren föreläggs att vidta vissa åtgärder och sedan rapportera resultatet till myndigheten.

Vid granskningen analyserar och bedömer myndigheten underlag, rapporter, anmälningar och ansökningar från anläggningarna. Det kan bl.a. gälla anmälningar om att bygga om eller förändra verksamheten och rapporter om säkerhetsåtgärder som tillståndshavaren har genomfört. Myndigheten går igenom dessa och väljer ut de som kan behöva granskas mer ingående av myndigheternas specialister.

Verksamhetsbevakningen innebär att myndigheten samlar information om strålsäkerhetsarbetet på anläggningar. Myndigheten tar del av ansökningar, rapporter och andra dokument samt för en dialog med personalen och ledningen. Underlaget ger en bild av hur anläggningens strålsäkerhetsarbete fungerar och kan leda till att myndigheten initierar ytterligare inspektioner och granskningar.

Myndighetens tillsyn omfattar även att följa upp händelser som har inträffat på en anläggning och som tillståndshavaren har en skyldighet att rapportera. På myndigheten finns en särskild grupp med olika kompetenser som går igenom och bedömer händelserna för att avgöra om tillståndshavaren har utrett varför felen och bristerna uppkommit samt att åtgärder vidtagits för att förhindra att de inträffar igen.

Om en händelse är mer allvarlig kan myndigheten tillsätta en RASK-utredning. Det är en metod som används när en händelse inträffat eller ett förhållande uppdagats som väsentligt kan påverka strålsäkerheten. Myndigheten kan fatta beslut om att snabbt samla information för att i ett tidigt skede få en oberoende bild av

1 Hämtat från Strålsäkerhetsmyndighetens hemsida, www.stralsakerhetsmyndigheten.se.

händelsen/förloppet, och därigenom få ytterligare information innan myndigheten fattar beslut om tillsynsåtgärder. Myndigheten genomför ungefär två till fem RASK-utredningar per år.

Varje år ställer myndigheten samman och värderar strålsäkerhetsläget på varje anläggning. Underlaget utgörs av de bedömningar som gjorts genom samtliga tillsynsåtgärder som utförts. Var tionde år gör även myndigheten för varje anläggning en mer ingående helhetsbedömning av hur anläggningen uppfyller kraven enligt lag, förordningar och föreskrifter samt förutsättningar för fortsatt kravuppfyllelse de kommande tio åren. Bedömningen tar hänsyn till den utveckling som skett inom vetenskap, teknik och internationell säkerhetsstandard.

Strålsäkerhetsmyndighetens föreskrifter om säkerhet i kärntekniska anläggningar

Strålsäkerhetsmyndigheten är bemyndigad att meddela föreskrifter om åtgärder för att upprätthålla säkerheten vid en kärnteknisk anläggning samt provning, kontroll och besiktning för detta syfte. Strålsäkerhetsmyndighetens föreskrifter om säkerhet i kärntekniska anläggningar, SSMFS 2008:1 (föreskrifterna) innehåller de grundläggande bestämmelserna för drift av kärntekniska anläggningar.

Enligt 2 kap. 1 § i föreskrifterna ska varje anläggning ha en för anläggningen anpassad grundkonstruktion och ett djupförsvar. Med djupförsvar menas bl.a. att konstruktionen, uppförandet, driften, övervakningen och underhållet av anläggningen är sådana att driftstörningar och haverier förebyggs. Det ska även finnas flerfaldiga anordningar och förberedda åtgärder som ska skydda barriärerna mot genombrott. Om ett sådant genombrott skulle ske så ska det finnas anordningar och förberedda åtgärder som begränsar konsekvenserna av brottet.

Kategorisering av brister

För det fall en brist skulle konstateras eller det föreligger en misstanke om brist i barriären eller djupförsvaret ska åtgärder vidtas, se 2 kap. 3–6 §§. Bristerna har delats in i tre kategorier och är angivna i en bilaga till förordningen. Beroende av vilken kategori den

aktuella bristen tillhör ska anläggningen sättas i säkert läge och driften får inte sättas i gång innan förrän vissa åtgärder vidtagits. Kategori 1 är de allvarligaste bristerna. En sådan brist kan vara att integriteten hos någon av barriärerna har försämrats. Det kan även vara att det föreligger en brist i verksamheten, ledningen eller styrning som har sådan omfattning att den utgör ett allvarligt hot mot säkerheten. När en brist enligt kategori 1 har konstaterats får inte anläggningen tas i drift förrän de utredningar som genomförts och de åtgärder som vidtagits med anledning av bristen är säkerhetsgranskade av Strålsäkerhetsmyndigheten.

Rapportering

I 7 kap. i föreskrifterna regleras vad som ska rapporteras till Strålsäkerhetsmyndigheten. Tidsintervallet för och innehållet i rapporteringen följer av en bilaga till föreskrifterna. Utöver brister i anläggningen ska även inträffade händelser och uppdagade förhållanden av väsentlig betydelse rapporteras. Rapporteringen ska ske utan dröjsmål. Även sådana händelser och förhållanden som är av mindre allvarligt slag men ändå av betydelse för säkerheten i anläggningen ska rapporteras skyndsamt. Därutöver ska rutinmässiga rapporter ges in varje dygn, vecka och år.

Sådana brister som omfattas av kategori 1 ska inom en timme rapporteras till Strålsäkerhetsmyndigheten. Efter sju dagar ska en mer utförlig rapport ges in. Brister som omfattas av kategori 2 ska rapporteras inom 30 dygn med en utförlig rapport.

Vilka uppgifter som respektive rapportering ska innehålla framgår av bilaga 4 till föreskrifterna. Samtliga rutinmässiga rapporter ska innehålla en redogörelse för inträffade händelser och förhållanden av kategori 1, 2 och 3. En årsrapport ska innehålla en samlad redovisning av verksamheten vid anläggningen med de erfarenheter som vunnits och de slutsatser som dragits med hänsyn till säkerheten. Brister som omfattas av kategori 3 ska även beskrivas.

Organisation, ledning och styrning

Enligt 2 kap. 8 § i föreskrifterna ska den kärntekniska verksamheten ledas, styras, utvecklas och utvärderas med stöd av ett ledningssystem så utformat att kraven på säkerhet tillgodoses. Ledningssystemet, inklusive de rutiner och instruktioner som behövs för styrningen ska hållas aktuella och dokumenterade. Tillämpningen, ändamålsenligheten och effektiviteten av ledningssystemet ska systematiskt och periodiskt undersökas av en fristående revisionsfunktion.

Av 2 kap. 9 § i föreskrifterna framgår att tillståndshavaren ska se till att:

1. det finns dokumenterade säkerhetsmål och riktlinjer för hur

säkerheten ska upprätthållas och utvecklas i den kärntekniska verksamheten, samt att de som arbetar i denna, är väl förtrogna med dessa mål och riktlinjer,

2. ansvar, befogenheter och samarbetsförhållanden definieras och

dokumenteras för den personal som arbetar med uppgifter av betydelse för säkerheten i den kärntekniska verksamheten,

3. den kärntekniska verksamheten planeras så att tillräcklig tid och

tillräckliga resurser avsätts för de säkerhetsåtgärder och den säkerhetsgranskning som behöver genomföras,

4. beslut i säkerhetsfrågor föregås av en tillräcklig beredning och

rådgivning så att frågorna blir allsidigt belysta,

5. personalen innehar den kompetens och lämplighet i övrigt som

behövs för de arbetsuppgifter som har betydelse för säkerheten i den kärntekniska verksamheten samt att detta finns dokumenterat,

6. den som arbetar i den kärntekniska verksamheten ges de förut-

sättningar som behövs för att kunna arbeta på ett säkert sätt,

7. erfarenheter av betydelse för säkerheten i den egna kärntekniska

verksamheten och från liknande sådana verksamheter fortlöpande tas tillvara och delges berörd personal,

8. säkerheten i den kärntekniska verksamheten rutinmässigt över-

vakas och följs upp, avvikelser identifieras och hanteras så att säkerheten upprätthålls och fortlöpande utvecklas enligt de mål och riktlinjer som gäller.

Ytterligare bestämmelser om personalens kompetens finns även i Strålsäkerhetsmyndighetens föreskrifter (SSMFS 2008:32) om kompetens hos driftpersonal vid reaktoranläggningar.

Efter att en anläggning tagits i drift ska säkerheten fortlöpande analyseras och bedömas på ett systematiskt sätt. Analysen ska ligga till grund för det säkerhetsprogram som även ska finnas. Säkerhetsprogrammet ska avse säkerhetsförbättrande åtgärder, såväl tekniska som organisatoriska, som föranleds analysen. Programmet ska utvärderas och uppdateras årligen.

Beredskap

Utöver den beredskap som stadgas om i LSO ska det för driftstörningar och haverier som kan kräva skyddsåtgärder inom och utanför anläggningen finnas en beredskapsplan. Enligt 2 kap. 12 § föreskrifterna ska det finnas beredskap för att klassificera händelser enligt gällande larmkriterier, larma anläggningens personal, bedöma risken för och storleken av eventuella utsläpp och dess tidsförhållanden samt lämna information till ansvariga myndigheter om det tekniska läget vid anläggningen. Åtgärderna ska enligt 2 kap. 13 § i föreskrifterna dokumenteras i en beredskapsplan som ska prövas och godkännas av Strålsäkerhetsmyndigheten innan anläggningen tas i drift.

Ändringar i beredskapsplanen avseende de åtgärder som stadgas i 12 § föreskrifterna ska vara säkerhetsgranskade. Ändringar ska även anmälas till Strålsäkerhetsmyndigheten.

Säkerhetsgranskning

En säkerhetsgranskning ska enligt 4 kap. 3 § i föreskrifterna utföras för kontroll av att tillämpliga säkerhetsaspekter är beaktade och att tillämpliga säkerhetskrav är uppfyllda. Granskningen ska genomföras på ett allsidigt och systematiskt sätt samt vara dokumenterad. Vidare ska granskningen genomföras i två steg. Det innebär att den fråga som ska granskas först granskas inom de delar av anläggningens organisation som ansvarar för den aktuella sakfrågan. Det andra steget ska utföras av en för ändamålet inrättad granskningsfunktion som ska ha en fristående ställning i förhållande till de sakansvariga delarna av organisationen.

Säkerhetsredovisning

Utöver ovanstående dokumentation ska det för varje anläggning även finnas en säkerhetsredovisning enligt 4 kap. 2 § i föreskrifterna. Redovisningen ska avspegla anläggningen som den är byggd, analyserad och verifierad samt visa hur gällande krav på konstruktion, funktion, organisation och verksamhet är uppfyllda. Säkerhetsredovisningen ska minst innehålla vad som framgår av bilaga 2 till föreskrifterna. Av bilagan följer att redovisningen bl.a. ska innehålla en redovisning av hur platsen och dess omgivning från säkerhetssynpunkt kan påverka anläggningen. Man bör då ta hänsyn till hydrologiska förhållanden, geologi och seismik samt i omgivningen pågående verksamheter. Dessutom ska redovisningen även innehålla en redovisning av anläggningens konstruktion och funktionsbeskrivning samt organisation och principerna för ledning och styrning för vissa angivna funktioner. Med hänsyn till behovet av sekretess ska även redovisningen på ett lämpligt sätt innehålla information om konstruktionsförutsättningar och utformning av det fysiska skyddet.

Säkerhetsredovisningen ska även innehålla en redogörelse för de säkerhetstekniska driftsförutsättningarna (STF). Enligt föreskrifternas 5 kap. 1 § ska de STF upprättas till ledning för driften av anläggningen och innehålla de uppgifter som framgår av bilaga 3 till föreskrifterna. I bilaga 3 anges att vissa gränsvärden ska anges, nödvändiga villkor och begränsningar för anläggningens driftklarhet, säkerhetsfunktioner, principer för ledning och styrning samt regler för hantering av fel, störningar, underhållsarbeten, provningar och ändringsarbeten.

Instruktioner och riktlinjer

Utöver de STF ska det enligt 5 kap. 2 § i föreskrifterna finnas instruktioner och riktlinjer. Instruktionerna ska reglera åtgärder under normaldrift, driftstörningar och sådana haverier som är beaktade i anläggningens konstruktion. Instruktionerna ska vara ändamålsensliga, dokumenterade och hållas aktuella. Riktlinjerna ska styra åtgärder som kan behöva vidtas för att kontrollera och begränsa konsekvenserna av haverier som inte är beaktade i anläggningens konstruktion.

Underhåll, fortlöpande tillsyn och kontroll

Byggnadsdelar, system, komponenter och anordningar av betydelse för säkerheten vid en anläggning ska fortlöpande kontrolleras och underhållas på ett sådant sätt att de uppfyller de säkerhetskrav som ställs. För detta ska det finnas program för underhåll, fortlöpande tillsyn och kontroll samt hantering av åldersrelaterade försämringar och skador. Programmen ska vara dokumenterade samt ses över och uppdateras mot bakgrund av vunna erfarenheter och utvecklingen inom vetenskap och teknik.

Avgifter för tillsyn

Avgifter för prövning och tillsyn m.m. enligt kärntekniklagen och strålskyddslagen regleras i förordningen (2008:463) om vissa avgifter till Strålsäkerhetsmyndigheten. Tillsynsavgift ska enligt förordningens 11 § betalas av tillståndshavaren för varje kalenderkvartal. Beloppet ska betalas i förskott och uppgår till drygt 3 miljoner kr per kärnkraftsreaktor under normaldrift. Det blir drygt 12 miljoner kr per reaktor och år.

För granskning av en sådan helhetsbedömning som ska göras var tionde år enligt 10 a § kärntekniklagen ska tillståndshavaren betala en granskningsavgift på 2 miljoner kr.

Tillståndshavaren ska även betala en beredskapsavgift till Strålsäkerhetsmyndigheten. Enligt 12 § i förordningen ska även den avgiften betalas i förskott per kvartal och beloppen varierar beroende på vilken hotkategori anläggningen tillhör. För hotkategori I uppgår avgiften till 947 000 kr per kvartal, hotkategori II 206 000 kr per kvartal och 52 000 kr för en anläggning i hotkategori III.

Utöver ovanstående avgifter ska även tillståndshavaren till en kärnkraftsreaktor betala en avgift för forskning uppgående till cirka 1,6 miljoner kr per kvartal för varje reaktor. Det blir cirka 6,4 miljoner kr per reaktor och år.

Det innebär att en tillståndshavare sammantaget ska betala 18,9 miljoner kr per reaktor och år till Strålsäkerhetsmyndigheten. Därutöver tillkommer beredskapsavgiften som avser hela anläggningen och är beroende av vilken hotkategori anläggningen har bedömts ha. Vart tionde år ska tillståndshavaren även betala 2 miljoner kr för granskningen av helhetsbedömningen.

Länsstyrelsen och MSB disponerar år 2012 26 miljoner kr av ovanstående avgifter för beredskapsåtgärder mot kärnkraftolyckor.

4.2.2. Reglering för Seveso-anläggningar

Sevesolagstiftningen bygger på de s.k. Sevesodirektiven I och II samt industriolyckskonventionen2. Direktiven och konventionen har implementerats i bl.a. lagen (1999:381) om åtgärder för att förebygga och begränsa följderna av allvarliga kemikalieolyckor (Sevesolagen) med tillhörande förordning (1999:382) om åtgärderna för att förebygga och begränsa följderna av allvarliga kemikalieolyckor (Sevesoförordningen). Ändringar med anledning av direktiven infördes också i miljöbalken, förordningen (1998:899) om miljöfarlig verksamhet och hälsoskydd, förordningen (1998:900) om tillsyn enligt MB, förordningen (1998:905) om miljökonsekvensbeskrivningar samt lagen (2003:778) och förordningen (2003:789) om skydd mot olyckor.

Sevesolagstiftningen tillämpas på sådana verksamheter där farliga ämnen förekommer i en viss angiven mängd. Mängden anges i bilaga till Sevesoförordningen. Verksamheter kan antingen omfattas av en lägre eller en högre kravnivå. Nivån utgår från den i bilagan angivna mängden.

Sevesolagen gäller parallellt med andra lagstiftningar såsom t.ex. MB. En anläggning som omfattas av bestämmelserna i Sevesolagen kan även utgöra en miljöfarlig verksamhet enligt MB och därmed omfattas av balkens bestämmelser.

Handlingsprogram

Enligt 6 § Sevesolagen ska en verksamhetsutövare förebygga riskerna för allvarliga kemikalieolyckor. I de fall en olycka inträffar är verksamhetsutövaren skyldig att begränsa följderna för människors hälsa och miljön. Hur olyckorna ska förebyggas ska anges i ett handlingsprogram. Handlingsprogrammet ska enligt 6 § Sevesoförordningen vara skriftligt och innehålla uppgifter om de mål och allmänna handlingsprinciper som verksamhetsutövaren har ställt

2 Direktiven 82/501/EEG om risker för storolyckor i vissa industriella verksamheter och 96/82/EG om åtgärder för att förebygga och begränsa följderna av allvarliga olyckshändelser där farliga ämnen ingår med tilläggsdirektiv 2003/105/EG samt Konventionen om gränsöverskridande effekter av industriolyckor av den 17 mars 1992.

upp för hanteringen av riskerna för allvarliga olyckor. Programmet ska även innehålla uppgift om en säkerhetsorganisation.

MSB har i föreskrifterna SRVFS 2005:2, bilaga 1 angett vad som ska ingå i verksamhetens säkerhetsorganisation.

1. Organisation och personal. Beskrivning av roll- och ansvarsfördelning för de som har uppgifter i samband med hanteringen av risker för allvarliga kemikalieolyckor, innefattande såväl anställda på alla nivåer i organisationen som uppdragstagare inklusive entreprenörer, utbildningsbehoven för dessa och utbildningens uppläggning.

2. Identifiering och bedömning av riskerna för allvarliga kemikalieolyckor. Beslut om och införande av rutiner så att riskerna för allvarliga kemikalieolyckor, vid normal drift och vid driftsstörningar, systematiskt kan identifieras så att sannolikheten för och konsekvenserna av sådana olyckor kan bedömas.

3. Styrning. Beslut om och införande av rutiner och instruktioner för hur arbetet ska bedrivas under säkra förhållanden, inbegripet underhåll och fortlöpande tillsyn av verksamheten, processer och utrustning samt tillfälliga driftsavbrott.

4. Hantering av ändringar. Beslut om och införande av rutiner för planering av ändringar som ska genomföras på befintliga anläggningar eller upplagsplatser eller för utformning av nya anläggningar, processer eller upplagsplatser.

5. Planering inför nödsituationer. Beslut om och införande av rutiner för att kunna förutse nödsituationer genom systematisk analys. Dessutom, för verksamheter som omfattas av kravet på säkerhetsrapport enligt 10 § Sevesolagen, beslut om och införande av rutiner för att utforma, pröva och revidera de interna planerna för räddningsinsatser, inklusive rutiner för utbildning inför nödsituationer till berörd personal samt entreprenörer.

6. Resultatuppföljning. Beslut om och införande av rutiner som gör det möjligt att kontinuerligt följa upp efterlevnaden av handlingsprogrammet samt införande av rutiner för undersökning och rättelse vid bristande efterlevnad. Rutiner ska finnas för anmälan av allvarliga kemikalieolyckor eller olyckstillbud, särskilt då det brustit i skyddsåtgärderna, samt undersökning av olyckor och olyckstillbud. Rutiner ska även finnas för uppföljning utifrån tidigare erfarenheter.

7. Utvärdering och revision. Beslut om och införande av rutiner för systematisk och regelbunden utvärdering av handlingsprogrammets effektivitet och lämplighet. Verksamhetens ledning ska ansvara för att handlingsprogrammet revideras när utvärderingen visar på brister. Ledningens ställningstagande ska dokumenteras.

Säkerhetsrapport

För de verksamheter som omfattas av den högre kravnivån ska en säkerhetsrapport upprättas, enligt 8 § Sevesoförordningen och 10 § Sevesolagen. Säkerhetsrapporten ska lämnas till tillsynsmyndigheten.

MSB har i angivna föreskrifter angett vad en säkerhetsrapport minst ska innehålla. Bl.a. ska verksamhetens plats och omgivning beskrivas inbegripet dess geografiska läge, meteorologiska, geologiska och hydrologiska förhållanden. Uppgifter om anläggningar och annan aktivitet vid verksamheten som kan ge upphov till olycka. Anläggningen ska beskrivas med uppgifter om den huvudsakliga hanteringen och produktionen vid de delar av verksamheten som har betydelse för säkerheten. Riskkällor och de förebyggande åtgärder som vidtagits ska anges. Processerna ska också beskrivas vid såväl normal drift som vid förutsägbara störningar. Säkerhetsrapporten ska även redovisa att olycksrisker identifierats och analyserats. Möjliga scenarier för allvarliga olyckor och sannolikheten för dessa ska beskrivas i detalj. Vidare ska en bedömning göras av hur omfattande och svåra följderna av de identifierade olyckorna skulle kunna bli. Bedömningen ska kompletteras med kartor, ritningar eller motsvarande information som visar de områden som kan komma att påverkas. De förebyggande och begränsande åtgärder som vidtagits inklusive teknisk data och den utrustning som finns för anläggningens säkerhet ska beskrivas. Rapporten ska även beskriva hur följderna av en allvarlig olycka kan begränsas.

Plan för interna räddningsinsatser

Likaså ska de verksamheter som omfattas av den högre kravnivån ha en plan för interna räddningsinsatser enligt 12 § Sevesolagen och 10 § Sevesoförordningen. Planen ska upprättas i samråd med kommunen och de anställda. Den ska utgöra en del av säkerhetsrapporten. Tillsynsmyndigheten ska ha del av planen och ska även granska den.

MSB har i bilaga 2 till angivna föreskrifter angett vad den interna planen för räddningsinsatser ska innehålla. Bl.a. ska den innehålla namn eller befattning på de som har befogenhet att starta en intern räddningsinsats. För varje situation eller händelse som kan förutses och som kan spela en avgörande roll för uppkomsten av en allvarlig olycka ska det finnas en beskrivning av vilka åtgärder som ska vidtas för att begränsa följderna. Det ska även finnas en beskrivning av varningssystem och de åtgärder som ska vidtas vid varning. Rutiner för alarmering till och samverkan med kommunens organisation för räddningstjänst ska även anges. Den utbildning och övning som personalen får ska också beskrivas.

Kommunens skyldigheter

Enligt 14 § i Sevesolagen ska kommunen se till att personer som löper risk att påverkas av en allvarlig kemikalieolycka informeras. Kravet gäller endast de anläggningar som enligt Sevesolagen omfattas av den högre kravnivån. Informationen ska avse vilka säkerhetsåtgärder som ska vidtas och hur man ska agera vid en olycka. Informationsansvaret gäller även i förhållande till personer i andra kommuner eller utomlands.

Det är kommunen som ansvarar för att informationen tillhandahålles men det är verksamhetsutövaren som ska svara för kostnaderna för den information som ska lämnas.

MSB har i bilaga 3 till angivna föreskrifter angett ett minimikrav för vad informationen till allmänheten ska innehålla. Bl.a. ska där framgå vilka kemikalieolyckor som skulle kunna inträffa inklusive möjliga följder av dessa olyckor, upplysningar om hur allmänheten kommer att varnas och informeras i händelse av en olycka samt upplysningar om vilka åtgärder allmänheten ska vidta i händelse av en sådan olycka.

Enligt 3 kap. 6 § FSO ska även kommunen ha en plan för räddningsinsatser för de anläggningar som omfattas av den högre kravnivån enligt Sevesolagen.

Tillsyn

MSB, länsstyrelserna och kommunerna är tillsynsmyndigheter enligt Sevesolagen och de föreskrifter som är meddelade med stöd av lagen. Länsstyrelserna och kommunerna är tillsynsmyndigheter med den ansvarsfördelning för tillsyn av miljöfarlig verksamhet som följer av MB. Det innebär att länsstyrelsen har ansvar för tillsynen över de miljöfarliga verksamheter som omfattas av tillståndsplikt enligt bilagan till förordningen (1998:899) om miljöfarlig verksamhet och hälsoskydd förutom de verksamheter som omfattas av Strålsäkerhetsmyndighetens tillsyn. Kommunerna har tillsyn över de miljöfarliga verksamheter som inte anges i bilagan. Tillsynen kan överlåtas från länsstyrelse till kommun. Tillsynsmyndigheten ska samordna tillsynen enligt Sevesolagen med den som utförs enligt MB.

Tillsynsmyndigheterna ska utarbeta ett tillsynsprogram för varje verksamhet. För verksamheter som omfattas av kravet på säkerhetsrapport ska tillsynsprogrammet grunda sig på en analys och en planmässig bedömning av riskerna för allvarliga kemikalieolyckor i samband med verksamheten.

Regleringen om tillsynsåtgärder i Sevesolagen överensstämmer med den i MB. Tillsynsmyndigheten har rätt att få de upplysningar och tillgång till de handlingar som behövs för tillsynen. Myndigheten har även rätt att få tillträde till anläggningen och polismyndigheten ska lämna den hjälp som behövs. Tillsynsmyndigheten får meddela de förelägganden och förbud som behövs men den möjligheten är begränsad av den rättskraft som följer av 24 kap. 1 § miljöbalken.

Ett föreläggande eller förbud får förenas med vite. En tillsynsmyndighet får även vidta en åtgärd på en verksamhetsutövares bekostnad om denne inte gör det som myndigheten förelagt om för att utreda verksamhetens påverkan på omgivningen. Vid en sådan utredning ska verksamhetsutövaren samråda med statliga och kommunala myndigheter, organisationer och enskilda. Om det behövs får verksamhetsutövaren begära hjälp från tillsynsmyndigheten. Tillsynsmyndigheten kan då med stöd av 21 § Sevesolagen

förelägga en verksamhetsutövare eller någon annan att lämna de uppgifter som behövs.

Förelägganden eller förbud enligt Sevesolagen överklagas på samma sätt som för motsvarande beslut enligt MB.

Finansiering av Sevesotillsyn

Tillsyn enligt Sevesolagen finansieras över anslag 2:7 (MSB:s ramanslag inom utgiftsområde 6). MSB betalar efter rekvisition ut medel till länsstyrelsen för tillståndsprövning och tillsyn av Sevesoverksamheter i den högre kravnivån. Dagens finansieringssystem ger inget utrymme för kommunerna att finansiera sin Sevesotillsyn.

Översyn av Sevesolagstiftningen

I augusti 2011 beslutade regeringen om att tillsätta en särskild utredare för att se över regleringen av tillståndsgivning och tillsyn för Sevesoverksamheter.3 Utredaren ska bl.a. utreda om den nuvarande ansvarsfördelningen för tillsyn är ändamålsenlig utifrån målet om en effektiv tillsyn och utifrån målsättningen att miljöbalkstillsyn och Sevesotillsyn ska ske samlat. Även finansiering av tillsynen ska ses över. Uppdraget ska redovisas den 1 november 2012.

3 Utredningen om en effektiv Sevesolagstiftning, Fö 2011:02

5. Svenska kraftnäts och länsstyrelsernas dammsäkerhetsarbete

5.1. Inledning

Detta kapitel beskriver Svenska kraftnäts tillsynsvägledning och främjande av dammsäkerheten samt länsstyrelsens operativa tillsyn av dammsäkerheten. Utredningen beskriver respektive aktörers verksamheter, baserat på den reglering som beskrivs i kapitel 3. Utredningen gör vidare bedömningar avseende de olika aktörernas verksamheter.

Kapitlet avslutas med en redogörelse över några samverkansforum samt samverkans- och utvecklingsprojekt som bedrivits i samverkan mellan aktörerna under senare år. Även avseende dessa gör utredningen bedömningar.

5.2. Svenska kraftnät – främjar dammsäkerheten i landet

Uppgiften att främja dammsäkerheten i landet åvilar sedan 1998 Svenska kraftnät enligt 3 § förordningen (2007:1119) med instruktion för Affärsverket Svenska kraftnät. Uppgiften omfattar enligt 5 § att i frågor om dammsäkerhet:

1. följa klimatförändringarnas påverkan samt följa och medverka i

utvecklingen i landet,

2. verka för att möjligheterna att minska skador till följd av höga

flöden utvecklas och tas till vara,

3. regelbundet rapportera till regeringen om utvecklingen och vid

behov föreslå åtgärder,

4. uppmärksamma behovet av forskning,

5. svara för tillsynsvägledning enligt miljötillsynsförordningen

(2011:13), och

6. vid behov samråda med berörda myndigheter och organisa-

tioner.

Enligt 14 § ska det finnas ett råd, Dammsäkerhetsrådet, som ska biträda affärsverket i arbetet med dammsäkerhetsfrågor. Representanter för Svenska kraftnät, Svensk Energi, SveMin, SMHI, Sveriges Kommuner och Landsting (SKL), MSB och länsstyrelsen ingår i rådet. Rådet har möten cirka tre gånger per år.

Den del av Svenska kraftnät som arbetar med dammsäkerhet kallas i betänkandet för den centrala myndighetsfunktionen för dammsäkerhet. Den centrala myndighetsfunktionen har som sin övergripande uppgift att främja dammsäkerheten i landet. Att främja betyder att ge stöd åt, arbeta för någots bästa, gynna och utveckla. Myndighetsfunktionen är pådrivande, stödjande och samlande inom dammsäkerhetsområdet. Svenska kraftnät främjar dammsäkerheten genom följande arbetsuppgifter:

  • Utveckling av tillsyn och egenkontroll
  • Främjande av kunskapsutveckling och kompetensförsörjning
  • Främjande av beredskapsutveckling
  • Samråd med berörda myndigheter och organisationer
  • Rapportering och särskilda satsningar

5.2.1. Utveckling av tillsyn och egenkontroll

Svenska kraftnäts uppgift att utveckla tillsyn och egenkontroll avseende dammsäkerhet bedrivs främst genom att vara tillsynsvägledande myndighet för dammsäkerhet men också genom att i samverkan med branschen utveckla riktlinjer och vägledningar.

Tillsynsvägledningen innebär att Svenska kraftnät ska utvärdera, följa upp och samordna länsstyrelsernas operativa tillsyn samt ge dem stöd och råd. Svenska kraftnäts tillsynsvägledning omfattar utveckling av metoder för bastillsyn av dammsäkerheten, anordnande av handläggarträffar och upprättande av metodbeskrivningar. Svenska kraftnäts vägledning för den operativa tillsynen av damm-

säkerhet har bl.a. skett genom en vägledande skrift som gavs ut 2003 och som efter uppdatering 2007 har titeln Handbok Dammsäkerhet – egenkontroll och tillsyn1 där bl.a. rutinen för årsrapportering beskrivs, se mer i avsnitt 5.3.2. Vidare anordnas seminarier och handläggarträffar för personal vid länsstyrelserna om dammsäkerhet, beredskap för dammbrott och tillsyn.

Svenska kraftnät, Svensk Energi och SveMin har ett delat huvudmannaskap för riktlinjer för bestämning av dimensionerande flöden för dammanläggningar2, sa avsnitt 6.2.3. Uppföljning av riktlinjernas relevans sker fortlöpande genom den så kallade Flödeskonferensen, där Svenska kraftnät, SMHI, Svensk Energi och SveMin är representerade.

Svenska kraftnät i samverkan med Svensk Energi och SveMin har upprättat ett system för klassificering av dammsäkerhetsanmärkningar, så kallade standardiserade bedömningsklasser3, se avsnitt 6.2.4. Genom bedömningssystemet har en gemensam nomenklatur och ett systematiskt sätt att bedöma en svaghets betydelse för dammsäkerheten tagits fram som bl.a. syftar till tydligare kommunikation mellan dammägare och länsstyrelser.

Svenska kraftnät följer upp och utvärderar länsstyrelsernas operativa tillsyn genom att sammanställa och analysera den årsrapportering som görs från dammägare till länsstyrelserna samt genom enkätundersökningar, workshops och dialog. Svenska kraftnät följer även årligen upp dammägarnas arbete med att anpassa anläggningarna enligt riktlinjer för dimensionerande flöden för dammanläggningar.

5.2.2. Främjande av kunskapsutveckling och kompetensförsörjning

Svenska kraftnäts mål är att vidmakthålla och utveckla teknik och kompetens inom älv- och dammsäkerhetsområdet.

År 2005 bildades Svenskt Vattenkraftcentrum, SVC, som är en gemensam satsning på utbildning och forskning inom vattenkraft och vattenbyggnad av kraft- och gruvindustri, Statens energi-

1 Dammsäkerhet – egenkontroll och tillsyn. Handbok, Svenska kraftnät (2007). 2 Riktlinjer för bestämning av dimensionerande flöden för dammanläggningar. Nyutgåva. Svenska kraftnät, Svensk Energi och SveMin (2007). 3 System för bedömning av dammsäkerhetsanmärkningar. Svenska kraftnät, Svensk Energi och SveMin (reviderad 2010).

myndighet och Svenska kraftnät samt fyra högskolor. Svenska kraftnäts mål är att god kompetens ska finnas och fortlöpande förnyas och utvecklas hos berörda aktörer inom damm- och älvsäkerhetsområdet. I detta syfte ska en god utbildnings- och forskningsmiljö utvecklas och bibehållas i landet inom älv- och dammsäkerhetsområdet. Svenska kraftnät ger ekonomiskt stöd till SVC:s kompetensområde Vattenbyggnad och medverkar i styrgruppen.

Svenska kraftnät stödjer dessutom forsknings- och utvecklingsprojekt genom

  • Ekonomiskt stöd i första hand i samverkan med kraftindustrin (via Elforsk), gruvindustrin (via SveMin) och berörda myndigheter (exempelvis SMHI).
  • Medverkan som adjungerade ledamöter i styrgruppen för Elforsks ramprogram ”dammsäkerhetstekniskt utvecklingsarbete”, se avsnitt 6.4.2
  • Medverkan i styrgrupper och arbetsgruppen för utvalda utvecklingsprojekt Exempel på aktuella utvecklingsprojekt som haft stor betydelse för pågående utveckling av beredskap för dammbrott ges i avsnitt 5.4.4.

5.2.3. Främjande av beredskapsutveckling

Svenska kraftnäts mål är att i de stora kraftverksälvarna ska kraftindustrins och samhällets samlade beredskap för dammbrott och höga flöden vara väl planerad, samordnad och övad. Beredskapsplaner för dammbrott och höga flöden ska utvecklas i Luleälven, Skellefteälven, Umeälven, Ångermanälven, Indalsälven, Ljungan, Ljusnan, Dalälven, Klarälven/Vänern/Göta älv, Lagan och i övriga vattendrag där dammbrott eller höga flöden kan ge regionala konsekvenser.

Svenska kraftnät ger ekonomiskt stöd till utvecklingen av samordnad beredskap och medverkar aktivt i projekten, se avsnitt 5.4.4. Arbete pågår för närvarande i ovan nämnda vattendrag. Vidare pågår sedan 2008 utvecklingsprojekt om system för varning av allmänheten vid dammbrott, se i angivet avsnitt.

5.2.4. Samråd med berörda myndigheter och organisationer

Myndighetsfunktionen för dammsäkerhet på Svenska kraftnät samverkar och utbyter erfarenheter med berörda myndigheter och branschorganisationer i Sverige och utomlands.

Vid sidan av länsstyrelsen samverkar och samråder Svenska kraftnät främst med följande centrala myndigheter; HaV, MSB och SMHI.

Svenska kraftnät samverkar med branschorganisationerna Svensk Energi och SveMin och branschen i övrigt genom att stödja gemensamma forsknings- och utvecklingsprojekt, stöd till och medverkan i SwedCOLDs verksamhet, se avsnitt 6.4.1, samt medverkan vid utbildningar som branschorganisationerna håller regelbundet.

Internationell samverkan bedrivs främst genom att vara med i ett informellt nätverk av europeiska dammsäkerhetsmyndigheter samt medverkan i arbetsgrupper inom ICOLD.

5.2.5. Rapportering och särskilda satsningar

Myndighetsfunktionen för dammsäkerhet på Svenska kraftnät har årligen rapporterat till regeringen om dammsäkerhetsutvecklingen i landet. Rapporten för år 20114 baseras på arbetet med regeringsuppdrag om dammsäkerhet och klimatförändringar, dammägarnas årsrapportering om dammsäkerhet till länsstyrelserna år 2010, uppföljning av länsstyrelsernas dammsäkerhetstillsyn och utvecklingen av samordnad beredskap för dammbrott, information från utvecklings- och utredningsarbete m.m. inom dammsäkerhetsområdet under 2011.

Under senare år har en stor del av tiden för Svenska kraftnäts dammsäkerhetshandläggare ägnats åt genomförandet av regeringsuppdrag och särskilda satsningar. Bl.a. har Svenska kraftnät i sitt uppdrag att fortlöpande följa klimatförändringars betydelse för dammsäkerheten, genomfört fyra regeringsuppdrag i samverkan med Svensk Energi, SveMin och SMHI som avrapporterades i slutet av 20115.

4 Dammsäkerhetsutveckling i Sverige år 2011, Svenska kraftnät, (2011). 5 Dammsäkerhet och klimatförändringar, Slutrapport från Kommittén för dimensionerande flöden för dammanläggningar i ett klimatförändringsperspektiv, Svenska kraftnät, Svensk Energi, SveMin, SMHI (2011).

Regeringsuppdrag dammsäkerhet och klimatförändringar

Kommittén för dimensionerande flöden för dammanläggningar i ett klimatförändringsperspektiv bildades 2008 genom en överenskommelse mellan Svenska kraftnät, Svensk Energi, SveMin och SMHI. Kommitténs uppdrag var att leda ett program för att analysera och värdera klimatfrågans betydelse för dammsäkerheten med avseende på flödesdimensionering och ta initiativ till att erforderliga studier kommer till stånd.

Kommittén bildades för att genomföra de uppdrag avseende dammsäkerhet och klimatförändring som gavs till Svenska kraftnät i regleringsbrev för år 2008, som följd av de förslag som lämnades i Klimat- och sårbarhetsutredningens slutbetänkande6. Uppdraget sammanfattas i följande punkter:

1. Analys av hur förändringar i tillrinningsförhållanden och drift av vattenkraftsystem kan påverka dimensionerande flöde samt risken för översvämningar. Regeringsuppdrag till Svenska kraftnät att analysera i samarbete med kraftbranschen.

2. Utveckling av metoder för samt beräkning av flöden av betydelse för dammar av flödesdimensioneringsklass I och II i ett förändrat klimat. Regeringsuppdrag till Svenska kraftnät att utveckla i samarbete med SMHI.

3. Utveckling av metoder för

 kartläggning av sårbarheten hos

dammar av flödesdimensioneringsklass I och II, med avseende på klimatförändringar, samt genomförande av en sådan kartläggning. Regeringsuppdrag till Svenska kraftnät.

4. Analys av gruvdammars säkerhet med avseende på långsiktiga klimatförändringar. Regeringsuppdrag till Svenska kraftnät att analysera i samarbete med gruvindustrin.

Regeringsuppdragen avrapporterades i slutet av 20117. En sammanfattning av slutrapporten ges nedan.

6 Sverige inför klimatförändringarna – hot och möjligheter. Slutbetänkande av klimat- och sårbarhetsutredningen, SOU 2007:60. 7 Dammsäkerhet och klimatförändringar, Slutrapport från Kommittén för dimensionerande flöden för dammanläggningar i ett klimatförändringsperspektiv, Svenska kraftnät, Svensk Energi, SveMin, SMHI (2011).

Kommittén för dimensionerande flöden för dammanläggningar i ett klimatförändringsperspektiv har under 2008–2011 analyserat och värderat klimatfrågans betydelse för dammsäkerheten.

Förändringar i höga flöden är den dominerande klimatfaktorn när det gäller påverkan på dammsäkerheten. För att kunna beakta klimatförändring vid beräkning av dimensionerande flöden för dammar har en metodik som inkluderar klimatscenarier utvecklats och prövats. Metodiken har använts för beräkning av framtida 100årsflöden, för hela Sverige, samt framtida dimensionerande klass Iflöden för ett tiotal anläggningar.

För 100-årsflöden, mot slutet av seklet, är den samlade bilden att det går en markant gräns genom Sverige ungefär längs en linje från Karlstad till Mälardalen. Söder därom visar de beräknade 100årsflödena en ökande tendens för stora delar av Sydsverige.

Norrut visar beräkningarna på minskade 100-årsflöden förutom i nordvästligaste delen av Norrland där en ökning är tydlig. Vad gäller de mest extrema klass I-flödena är det svårt att generalisera klimateffekten. Valet av klimatscenarier har stor påverkan på resultatet och även anläggningsspecifika faktorer spelar in. Med dessa förbehåll konstateras att beräkningarna i flertalet fall uppvisar generella tendenser till minskande extrema flöden, i första hand beroende på att det dimensionerande snötäcket minskar.

För några av de studerade dammarna visar beräkningarna dock på ökande dimensionerande flöde. Ett varmare klimat medför dessutom troligen att frekvensen av kortvariga och intensiva skyfall ökar, vilket medför att lokala översvämningar kan bli vanligare.

Kommittén har kartlagt sårbarheten för höga flöden för drygt 350 av kraftindustrins dammanläggningar i flödesdimensioneringsklass I och II. Kartläggningen visar att det finns ett kvarstående åtgärdsbehov avseende dagens dimensionerande flöde för cirka en fjärdedel av de kartlagda anläggningarna i flödesdimensioneringsklass I. För vissa av anläggningarna kommer en klimatförändring troligen att medföra ökade extrema flöden som ställer ytterligare krav på anpassning. I dagsläget bedöms cirka en tredjedel av de kartlagda anläggningarna i flödesdimensioneringsklass I ha goda marginaler för ökade extrema flöden. Studien visar vidare att de kartlagda anläggningarna i flödesdimensioneringsklass II med några få undantag klarar dagens 100-årsflöde utan överströmning. Kommittén noterar dock att det finns ett mörkertal då underlag om dammar saknats helt eller delvis i flera län. Detta gäller i stor

utsträckning för södra Sverige där klimatberäkningarna pekar mot ökade 100-årsflöden.

Motsvarande genomgång av gruvindustrins dammanläggningar, varav 20 gruvdammar, visar att vissa dammar behöver uppgraderas för att möta dagens kriterier för dimensionerande flöden, även om det stora flertalet gruvdammar har goda marginaler för att hantera ökande flöden. Under driftperioden ger vidare regelbundna om- och tillbyggnader goda förutsättningar för successiv anpassning av gruvdammar och utskov. Efter nedläggning beror riskerna med avseende på klimatförändringar på vilken lösning för efterbehandling som valts. Planerna för efterbehandling måste visa hur man långsiktigt avser att hantera dessa risker.

I 2007 års nyutgåva av Riktlinjer för bestämning av dimensionerande flöden för dammanläggningar ges översiktliga rekommendationer med avseende på klimatfrågan. Med utgångspunkt från dessa har Kommittén utarbetat en vägledning till dammägarna för utförande av framtida dimensioneringsberäkningar för dammar i ett klimat i förändring.

Vidare lämnar Kommittén rekommendationer till riktlinjernas huvudmän avseende vad som bör ingå i en nationell strategi för hantering av klimatförändring i dammsäkerhetsarbetet.

Regeringsuppdrag förstärkt tillsynsvägledning

I utredningens direktiv nämns att utredningen ska beakta Svenska kraftnäts pågående utvecklingsarbete avseende tillsynsvägledningen för dammsäkerhet. I regleringsbrev för år 2011 och 2012 fick Svenska kraftnät följande uppdrag:

Affärsverket Svenska kraftnät ska utifrån den under 2010 redovisade översynen av de statliga insatserna för dammsäkerhet vidareutveckla tillsynsvägledningen i de delar som ryms inom ramen för befintliga regelverk och uppdrag.

Svenska kraftnäts har 2011 upprättat en plan för ett förstärkt arbete med tillsynsvägledning för dammsäkerhet8. Planen ger en beskrivning av bakgrunden till dagens dammsäkerhetstillsyn, utgångspunkter för förstärkt tillsynsvägledning för dammar med särskilt

8 Plan för förstärkt arbete med tillsynsvägledning, Svenska kraftnät, (2011).

stora konsekvenser och ökade insatser för kompetensutveckling samt en handlingsplan i tre huvudsakliga delar:

1. Kartläggning av dammar med särskilt stora konsekvenser och tydliggörande av ansvaret för dessa.

2. Förstärkt tillsynsvägledning genom metodutveckling och dokumentation av processer och rutiner för förstärkt myndighetsinsyn och dammsäkerhetstillsyn.

3. Insatser för kompetensutveckling inom älv- och dammsäkerhetsområdet för personal vid länsstyrelser m.fl.

Svenska kraftnät återredovisar arbetet med förstärkt tillsynsvägledning till regeringen i den regelbundna rapporteringen av dammsäkerhetsutvecklingen.

Under 2011 har Svenska kraftnät påbörjat kartläggningen av dammar med särskilt stora konsekvenser. Kartläggningen har skett genom att Svenska kraftnät har bett dammägarna att lämna uppgifter om vilka av deras dammar som de – baserat på befintligt underlag om konsekvenser av dammbrott – bedömer tillhör denna särskilda kategori.

Kartläggningen omfattar i nuläget cirka 25 dammar men antalet kan komma att förändras som en följd av ökande kunskaper om konsekvenser av dammbrott. Svenska kraftnät har identifierat kontaktpersoner vid berörda länsstyrelser och har informerat dem om resultatet av inventeringen.

Målet för tillsynsvägledningen är att verka för att tillsynen av dammar med särskilt stora konsekvenser ska utvecklas så att den

  • ger samhället djupgående insyn i och kontroll av ägarens dammsäkerhetsarbete och dammens säkerhetsstatus,
  • bedrivs på ett sådant sätt att den stimulerar ägaren till ett ambitiöst dammsäkerhetsarbete i linje med de styrande säkerhetsprinciperna,
  • följer fastställda rutiner, är likvärdig för olika delar av landet och samordnas mellan länen,
  • ges hög prioritet, dvs. erforderliga resurser och kompetens.

Utgångspunkterna för Svenska kraftnäts och länsstyrelsernas förstärkta arbete med tillsynsvägledning och operativ tillsyn av damm-

säkerhet för dammar med särskilt stora konsekvenser ska vara följande.

  • Tillsyn av dammar med särskilt stora konsekvenser i händelse av dammbrott ska ges högsta prioritet.
  • Tillsynen förutsätter ökad och mer djupgående insyn från samhällets sida i ägarens dammsäkerhetsarbete och dammens säkerhetsstatus.
  • Tillsynen förutsätter god och djupgående kompetens om dammsäkerhet och tillsyn.
  • Tillsyn där flera län berörs måste samordnas och former för detta utvecklas och fastställas.

Vidareutvecklingen av tillsynsvägledningen för dammar med särskilt stora konsekvenser vid dammbrott ska enligt Svenska kraftnäts plan genomföras under en utvecklings- och provperiod för förstärkt myndighetsinsyn och rutiner för dammsäkerhetstillsyn i samverkan mellan Svenska kraftnät, Svensk Energi, berörda dammägare och länsstyrelser (2011–2013). Under utvecklings- och provperioden avser Svenska kraftnät att utveckla former och rutiner för

  • utökad säkerhetsrapportering från dammägare till myndigheterna,
  • myndighetsuppföljning av säkerhetsrapportering m.m., och
  • myndighetsmedverkan vid kvalificerad tillståndskontroll och revisioner.

Svenska kraftnät utvecklar förslag på arbetsmetoder som provas och utvärderas i samråd med dammägare och länsstyrelser. Svenska kraftnät ska stödja länsstyrelsen med dammsäkerhetskompetens och medverka så långt som möjligt vid tillsynsaktiviteterna. Verket ger vidare lägesrapporter till och inhämtar råd och synpunkter från Dammsäkerhetsrådet. God samverkan mellan myndigheter och dammägare bedöms vid sidan av utökade resurser för tillsynsvägledning och tillsyn av denna kategori av dammar vara en förutsättning för utvecklingsarbetet.

Granskning med internationella experter 2006–2008

Svenska kraftnät har tillsammans med branschorganisationen Svensk Energi utarbetat en modell för s.k. särskild granskning av dammar inom den högsta konsekvensklassen. Syftet var att pröva om dammsäkerheten vid de aktuella dammarna håller god internationell standard, att utvärdera den utarbetade granskningsmodellen samt att ge förbättrat underlag för dammägarnas fortsatta dammsäkerhetsarbete och myndigheternas tillsyn.

Granskningsmodellen innebär att oberoende experter med särskild kompetens och internationell erfarenhet från dammsäkerhetsverksamhet granskar dammsäkerheten vid en anläggning. Granskningen utförs på uppdrag av dammägaren som ett komplement till den ordinarie egenkontrollen men med insyn och möjlighet till påverkan för myndigheterna. I modellen ingår också att dammägaren till tillsynsmyndigheten lämnar en handlingsplan som beskriver hur synpunkter i expertgruppens granskningsrapport kommer att hanteras.

Försök med särskild granskning enligt denna modell gjordes under 2006–2008 på följande fem dammanläggningar9:

  • Höljes i Klarälven, Värmlands län (Fortum)
  • Suorva i Stora Lule älv, Norrbottens län (Vattenfall)
  • Hällby i Ångermanälven, Västernorrland (E.ON)
  • Håckren i Indalsälven, Jämtlands län (Vattenregleringsföretagen)
  • Ajaure i Umeälven i Västerbottens län (Vattenfall)

I ett av dessa fall ansåg granskarna att varken dammsäkerhet eller dammsäkerhetsarbete nådde upp till god internationell nivå. I de övriga fallen bedömdes säkerheten och säkerhetsarbetet ligga i linje med god internationell nivå men granskarna ansåg att det förelåg vissa förbättringsbehov.

Granskningsrapporterna bekräftade många redan kända utvecklingsbehov. Hit hörde bättre dokumenterade rutiner för styrning och hantering av företagens dammsäkerhetsarbete. I några fall föranledde granskningarna förändrat perspektiv på enskilda frågor,

9 Dammsäkerhet - pilotprojekt ”särskild granskning”, Svenska kraftnät (2008).

initiering av nya studier och vissa omprioriteringar i ägarens planer, vilket framgår av de handlingsplaner som ägarna lämnat till berörd länsstyrelse efter respektive granskning.

Granskarna fann vidare att kompetensen hos ägarna är hög men att anmärkningsvärt få personer hos ägarna arbetar med dammsäkerhet. Granskarna uttryckte tveksamhet mot den vanligt förekommande ordningen att anlita entreprenörer för genomförande av nyckeluppgifter inom skötseln av dammar. Korta kontraktstider med eventuella byten av driftentreprenör ansågs också vara olämpligt.

5.2.6. Resurser

Den centrala myndighetsfunktionen på Svenska kraftnät har under de senaste åren omfattat 2–3 årsarbetskrafter.

5.2.7. Utredningens bedömning

Svenska kraftnät har fullföljt den tillsynsvägledande och främjande uppgiften avseende dammsäkerhet väl, men det finns enligt utredningen möjlighet att utveckla arbetet ytterligare, särskilt avseende tillsynsvägledning. Vad gäller utveckling av tillsyn och egenkontroll anser utredningen att ytterligare resurser behöver läggas på tillsynsvägledning av länsstyrelserna i form av vägledning, utbildning, råd och stöd samt uppföljning av genomförd tillsyn. Att tillsynsvägledningen behöver utvecklas är något som även framhållits av de handläggare utredningen träffat vid utredningens länsstyrelsebesök.

Pågående regeringsuppdrag avseende förstärkt tillsynsvägledning för dammar med särskilt stora konsekvenser i händelse av dammbrott bör därför ligga till grund för Svenska kraftnäts fortsatta arbete med tillsynsvägledning. God samverkan mellan myndigheter och dammägare bedöms vid sidan av utökade resurser för tillsynsvägledning och tillsyn av denna kategori av dammar vara en förutsättning för utvecklingsarbetet. Utredningen återkommer till hur tillsynsvägledningen bör utvecklas i kapitel 11.

Vad gäller främjande av kunskapsutveckling och kompetensförsörjning anser utredningen att denna verksamhet är nödvändig för den fortsatta utvecklingen av dammsäkerheten i landet och att den därför bör fortsätta bedrivas i minst nuvarande omfattning.

Främjande av beredskapsutveckling är viktigt för den fortsatta utvecklingen av samordnad beredskapsplanering för dammbrott och bör därför fortsätta i minst nuvarande omfattning. För att tydliggöra att Svenska kraftnäts främjande även avser beredskapsutveckling bör det även framgå av instruktionen. Utredningen anser därför att Svenska kraftnäts instruktion bör ändras för att tydligare inbegripa även denna arbetsuppgift. Utredningen föreslår därför en ändring, se avsnitt 11.4.3.

Myndighetsfunktionen för dammsäkerhet på Svenska kraftnät samråder med berörda myndigheter och organisationer i viss grad. Utredningen anser att samverkan med andra myndigheter måste stärkas i frågor med beröring på dammsäkerhet och att respektive myndigheters ansvarsområden måste tydliggöras. Samverkan med branschorganisationerna Svensk Energi och SveMin och branschen i övrigt samt internationell samverkan är viktig och bör bibehållas i minst nuvarande omfattning.

Utredningen anser att det är av stor vikt att Svenska kraftnät och övriga huvudmän för riktlinjerna för dimensionerande flöden upprättar en nationell strategi för hantering av klimatförändring i dammsäkerhetsarbetet och fullföljer de rekommendationer som getts i Klimatkommitténs slutrapport.

Utredningen konstaterar att efter försöksperioden med granskningar av internationella experter som beskrevs i avsnitt 5.2.5 har inga ytterligare granskningar genomförts i enlighet med den framarbetade metoden. Enligt utredningen är metoden är funktionell. Särskilt för problematiska anläggningar eller anläggningar med särskilt stora konsekvenser i händelse av dammbrott kan det vara lämpligt att även i fortsättningen genomföra expertgranskningar enligt denna modell.

5.3. Länsstyrelsernas tillsyn

5.3.1. Tillsyn av dammsäkerhet är en del av vattenverksamhetstillsynen

Tillsyn av dammsäkerhet utgör en del av den tillsyn av vattenverksamhet som ska utövas enligt miljötillsynsförordningen. Länsstyrelsen är operativ tillsynsmyndighet när det gäller vattenverksamhet, vilket till övervägande del innebär tillsyn av verksamhetsutövarnas egenkontroll.

Verksamhetsutövarens egenkontroll vid dammanläggningar kan enligt Naturvårdsverkets handbok10 delas in i sex större block; vattenhushållning, dammsäkerhet och övriga risker, miljöundersökningar, kemiska produkter m.m., driftstörningar och underhåll.

Tillsyn över vattenverksamheter skiljer sig i grunden inte från annan tillsyn enligt miljöbalken. För att genomföra den operativa tillsynen används vanligtvis metoder som systemtillsyn för att bedöma kvaliteten på egenkontrollen, detaljtillsyn samt granskning av rapporter och information. Tillsynen kan vara olika för tillsynsobjekt med och utan tillstånd. Som all annan verksamhet ska vattenverksamhet bedrivas med utgångspunkt från dels villkor och föreskrifter i tillstånd, dels med iakttagande av MB:s allmänna hänsynsregler.

Redovisningen av regeringsuppdraget Fi2008/309311 innehåller ett citat från en länsstyrelse som beskriver tillsynen som bedrivs inom vattenverksamheten:

Tillsynsverksamheten (inom vattenområdet) utgörs till allra största delen av insatser till följd av inkommande ärenden, till exempel prövning av anmälningsärenden, rådgivning, information, klagomål, fastställande av kontrollprogram, granskning av miljörapporter, periodiska besiktningar osv. Utöver dessa händelsestyrda insatser planeras målstyrda, operativa insatser mot sådana företeelser, verksamheter och åtgärder, som bedöms vara av signifikant betydelse för miljömålens uppfyllelse utifrån myndighetens egna bedömningar om hur miljösituationen i länet ser ut. I detta arbete används också planer och program inom miljömålsarbetet, biologisk återställning, vattenförvaltning, fiskevård mm. Med hänsyn till att den händelsestyrda tillsynen upptar i stort sett alla resurser i anspråk omfattar den egeninitierade tillsynen en mycket liten del av verksamhet.

I redovisningen av regeringsuppdraget beskrivs vidare att även om länsstyrelsen har tagit fram tillsynsplaner och har en vilja att genomföra dessa är den faktiska situationen att den planerade tillsynen ofta trängs undan av andra uppgifter som måste tas i första hand. Prioriteringen i de allra flesta fall är att prövningsärenden kommer först. Därefter kommer den händelsestyrda tillsynen och – om tiden medger – planerad tillsyn.

10 Vattenverksamheter - Handbok för tillämpningen av 11 kapitlet i miljöbalken, 2008:5, Naturvårdsverket, (2008). 11 Länsstyrelsernas Tillsyn – dagsläge, möjliga förbättringar, framtidsutsikter, Fi2008/3093.

5.3.2. Rutin för årsrapportering

I detta avsnitt beskrivs länsstyrelsens tillsyn av dammsäkerheten såsom Svenska kraftnät rekommenderar att den bör bedrivas. Det utgör en grund för redovisningen av genomförd årsrapportering och uppföljning av tillsynen i avsnitt 5.3.3 respektive 5.3.4. Avsnittet behandlar enbart tillsyn av dammsäkerhet och inte tillsynen av vattenverksamhet i stort.

I sin handbok12 påpekar Svenska kraftnät att tillsynen är en av flera faktorer som påverkar dammsäkerheten. Bland andra faktorer kan nämnas verksamhetsutövares egenkontroll, regelverk och riktlinjer, beredskapsplanering samt kompetens- och kunskapsutveckling. En utgångspunkt i arbetet med den operativa tillsynen bör vara att kontrollera att dammägarna har utarbetat och följer lämpliga rutiner för egenkontroll. Huvudprincipen är att verksamhetsutövaren ska utöva den egenkontroll som krävs för att säkerställa dammsäkerheten.

I handboken beskrivs den rutin för årlig rapportering från dammägarna som introducerades 2003 och som Svenska kraftnät anser bör tillämpas för alla dammar som kan utgöra en säkerhetsrisk, oavsett om de används för vattenkraftproduktion, gruvproduktion, skydd mot översvämningar eller något annat.

Huvudsyftet med årsrapporteringen är att länsstyrelsen som operativ tillsynsmyndighet på ett rationellt sätt ska få dammägarnas svar på de viktigaste frågorna om dammsäkerheten i länet.

  • Vilka dammar i länet skulle i händelse av dammbrott kunna orsaka stora konsekvenser?
  • Vem äger dessa dammar och vem är ansvarig för dammsäkerheten vid dem?
  • Har dammägaren rutiner för egenkontroll av dammsäkerheten för dessa dammar?
  • Finns det några allvarliga svagheter vid dessa dammar och hur avser dammägaren i så fall åtgärda detta?

Den årliga rapporteringen ska bland annat ge uppgifter om

  • vilka personer som är ansvariga för dammsäkerheten,

12 Dammsäkerhet – egenkontroll och tillsyn. Handbok, Svenska kraftnät (2007), sid. 71.

  • dammarnas konsekvensklassificering,
  • ägarnas egenkontrollverksamhet genom besiktningar och fördjupade dammsäkerhetsutvärderingar samt huruvida det finns manual för drift, tillståndskontroll och underhåll,
  • identifierade allvarliga svagheter med betydelse för dammsäkerheten,
  • planerade och genomförda åtgärder med anledning av identifierade svagheter.

Rapporteringen ska ge länsstyrelsen underlag för prioritering av ytterligare tillsynsinsatser och möjligheterna till insyn för den enskilde medborgaren förbättras. Tillsynsmyndigheten rekommenderas att följa upp de uppgifter dammägarna lämnat i årsrapporterna, bl.a.

  • att ägarna hanterar identifierade allvarliga svagheter på ett tillfredsställande sätt,
  • konsekvensklassificeringars riktighet,
  • redovisade planer för egenkontrollaktiviteter samt
  • uppföljning av årsrapporternas överensstämmelse med verkliga förhållanden.

5.3.3. Genomförd årsrapportering

Länsstyrelserna förmedlar dammägarnas rapporter till Svenska kraftnät, som årsvis gör en nationell sammanställning13 som del i uppgiften att följa upp och utvärdera tillsynen. Den rutin för rapportering av dammsäkerhet som introducerades av Svenska kraftnät år 2003 tillämpas av länsstyrelserna. Dess användning har successivt ökat till att i dagsläget ha ingående uppgifter från de 18 län som bedöms ha dammar som är av dammsäkerhetsmässig betydelse. Även antalet dammanläggningar som rapporteras in ökar successivt, se tabell 5.1. Se mer om årsrapporteringen i avsnitt 6.3.

13 Sammanställning av rapportering avseende dammsäkerhet år 2010, Svenska kraftnät, (2011).

Källa: Svenska kraftnät.

5.3.4. Uppföljning av tillsynen

Enkätundersökning 2011

Svenska kraftnät skickade senast under år 2011 ut en enkät till vattenhandläggarna vid de 21 länsstyrelserna i landet.14 Syftet med enkätundersökningen var att följa upp och utvärdera länsstyrelsernas tillsyn. 18 länsstyrelser svarade på enkäten. Svenska kraftnät har anmärkt att två länsstyrelser inte svarade trots att det finns flera dammar i konsekvensklass 1A eller 1B i de länen. Av den sammanställning som Svenska kraftnät utfört och som utredningen har fått ta del av framgår bl.a. följande.

Länsstyrelsens tillsynsinsatser

De flesta länsstyrelser nämnde att de arbetar med insamling och viss bearbetning av årsrapporteringen. Därutöver hanteras inkomna ärenden och klagomål. Ett fåtal länsstyrelser nämnde att de har deltagit vid FDU-genomgångar och andra att de har gjort tillsynsbesök vid anläggningar. Några nämnde att de utför uppföljning av dammsäkerhet inom ramen för vattenverksamhetstillsynen.

Ett fåtal driftstörningar har rapporterats till länsstyrelserna. Berörda länsstyrelser följde upp att felen åtgärdats genom kontakter med dammägarna.

Många länsstyrelser svarade att de inte har gjort några stödjande insatser.

14 Sammanställning och analys av länsstyrelsernas tillsyn av dammsäkerhet 2011, Svenska kraftnät (2011).

Länsstyrelsernas resurser för tillsyn

Dammsäkerheten ingår som en ospecificerad del i vattenverksamheten i länsstyrelsens tillsynsplaner. Länsstyrelserna har begränsade resurser för tillsyn av vattenverksamheter. Generellt anges i enkätsvaren att ingen eller mycket liten tid används för egeninitierad tillsyn av dammsäkerhet.

Tiden för tillsyn av dammsäkerhet varierar mycket från mindre än en vecka till en halv årsarbetskraft per år. Vissa länsstyrelser verkar ha resurser och kan prioritera tillsynen av dammsäkerhet medan andra inte har det. Särskilt två länsstyrelser i de län med flest dammar i högre konsekvensklasser ägnar tillsynen av dammsäkerheten mindre än två veckor per år. Även i andra län med relativt många dammar i de högre konsekvensklasserna ägnar länsstyrelserna enbart några veckor per år åt tillsynen av dammsäkerheten.

De flesta länsstyrelser svarade att de inte hade tagit ut någon avgift för dammsäkerhetstillsynen.

Handläggares kompetens och utbildning

Dammsäkerhetstillsynen hanteras oftast av vattenhandläggare, utan erfarenhet av dammsäkerhetsarbete från tidigare anställningar. Vattenhandläggarna har relevanta utbildningar för tillsyn av vattenverksamheten i stort. De flesta har högskoleutbildning inom relevanta områden för tillsyn av vattenverksamheten, några handläggare har relevant utbildning för dammsäkerhetstillsyn.

Flera länsstyrelser uppgav i sina enkätsvar att det är svårt att upprätta och bibehålla dammsäkerhetskompetens inom länsstyrelsen. Flera länsstyrelser nämnde också att de vill genomföra kompetensutveckling och efterfrågade kurser anpassade efter länsstyrelsernas behov.

Länsstyrelsens synpunkter på tillsynsvägledning

De flesta länsstyrelser ansåg att Svenska kraftnäts handbok är bra och att handläggarträffarna som anordnas av Svenska kraftnät för länsstyrelserna eller som anordnas av länsstyrelserna där Svenska kraftnät medverkar är givande. Många ville ha handläggarträffar oftare och mer tid för diskussion och konkreta exempel.

Flera länsstyrelser nämnde att tillsynsvägledningen bör utvecklas med konkreta exempel på hur dammsäkerhetstillsynen ska bedrivas och de ville veta hur tillsyn bedrivs i andra länder.

Vidare ansåg länsstyrelserna att de kurser som finns är bra men att de inte fokuserar på myndighetsrollen. Mer juridik efterfrågades av flera.

De länsstyrelser som hade sökt stöd från Svenska kraftnät i specifika fall har fått det och var nöjda med det stöd de fick.

Flera länsstyrelser framförde att dammsäkerhetstillsynen i Sverige behöver organiseras om på något sätt för att bli mer ändamålsenlig. Resursbrist och arbetsbelastning gör att arbete med dammsäkerhet i praktiken inte prioriteras annat än vid inkommande ärenden.

5.3.5. Utredningens länsstyrelsebesök

Utredningen har besökt fyra länsstyrelser för att inhämta information om nuvarande dammsäkerhetstillsyn, tillsynsvägledning och beredskap samt synpunkter om framtida regelverk och myndighetsorganisation. Utredningen har vid dessa besök mött representanter från Dalarnas, Norrbottens, Västerbottens och Kronobergs länsstyrelser. Länsstyrelserepresentanterna var i de flesta fall vattenhandläggare och krisberedskapshandläggare eller chefer för dessa enheter.

Avseende den dammsäkerhetstillsyn som bedrivs i dag har bilden från Svenska kraftnäts enkätundersökning 2011 bekräftats. Dammsäkerhetstillsynen utförs av vattenhandläggare placerade på miljöenheten. Länsstyrelserna utför nästan ingen egeninitierad tillsyn utan tillsynen är till stor del händelsestyrd. Vissa länsstyrelser upprättar tillsynsplaner, andra inte. Även om tillsynsplaner finns hinner länsstyrelsehandläggarna i praktiken inte med de planerade åtgärderna. Istället läggs den huvudsakliga tiden på klagomåls- och anmälningsärenden. Tillsynen av dammsäkerhet utförs som en del av vattenverksamhetstillsynen och tidsredovisas också gemensamt. Ingen av de länsstyrelser som utredningen besökte hade fullständiga register över dammanläggningar i länen.

Avseende en framtida reglering för dammsäkerhet var länsstyrelserna positiva till tydliga krav eftersom det skulle ge förutsättningar för bättre tillsyn. De ansåg dessutom att tydligare krav, såsom i utvinningsavfallsförordningen och Sevesolagstiftningen, underlättar tillsynen. Länsstyrelserepresentanterna var också posi-

tiva till att införa ett klassificeringssystem och ansåg att det klassificeringssystem som finns i RIDAS skulle utgöra en bra förlaga. Det bör vara dammägaren som föreslår klass och tillsynsmyndigheten som fastställer klassen baserad på en av ägaren utförd och dokumenterad konsekvensanalys. Vidare bör årsrapporteringen utvecklas till att innehålla utförligare redovisning av brister samt uppgifter om anläggningarnas avbördningsförmåga i förhållande till dimensionerande flöden.

Avseende kompetens på tillsynsmyndigheten ansåg representanterna att krav på tillsynsmyndighetens dammsäkerhetskompetens bör ställas utifrån vad som förväntas av tillsynsmyndigheten. För att handläggare ska utveckla sin dammsäkerhetskompetens efterfrågade representanterna fler kurser, gärna med inriktning på dammsäkerhetstillsyn. Dessutom efterfrågades mer tillsynsvägledning.

För de dammar med störst konsekvenser vid dammbrott ansåg representanterna att personer med hög kompetens inom dammsäkerhet inklusive beredskap för dammbrott är nödvändig.

5.3.6. Utredningens bedömning

Svenska kraftnät sammanfattar sin enkätundersökning med att länsstyrelsernas tillsyn av dammsäkerhet har en ringa omfattning men att de insatser som görs i huvudsak följer rekommendationerna i Svenska kraftnäts handbok. Utredningen delar Svenska kraftnät slutsatser.

Utredningen anser att den dammsäkerhetstillsyn som bedrivits inte är tillräcklig för att säkerställa att dammägarna i sin egenkontroll upptäcker och åtgärdar allvarliga svagheter och brister. En anledning till att tillsynen brister kan vara den knapphändiga informationen om upptäckta svagheter från dammägarna i årsrapporteringen. Utredningen anser att en utökad beskrivning av upptäckta allvarliga svagheter och brister på dammarna skulle öka länsstyrelsens möjligheter att upptäcka brister i dammägarnas egenkontroll när de genomför tillsyn. Vid knapphändig information anser utredningen att länsstyrelsen alltid bör efterfråga mer information från dammägaren.

Utredningen gör vidare bedömningen att det är olyckligt att planerad tillsynsverksamhet inte blir genomförd när händelsestyrd tillsyn i form av klagomåls- och anmälningsärenden tar den större

delen av tillgänglig tid i anspråk. Det vore därför önskvärt att särskilja dammsäkerhetstillsynen från den övriga vattenverksamhetstillsynen.

Slutligen anser utredningen att handläggare bör ha relevant kompetens för att kunna bedriva en erforderlig dammsäkerhetstillsyn. Utredningen återkommer i kapitel 10 till hur tillsynen bör bedrivas och vilken kompetens en dammsäkerhetshandläggare bör ha.

5.4. Samverkan och utvecklingsprojekt

I detta avsnitt redovisas ett antal olika samverkansgrupperingar, samverkans- och utvecklingsprojekt som dammsäkerhetsaktörer i landet medverkar i eller har medverkat i under senare år.

5.4.1. Älvgrupper

För varje större älv i Sverige finns det en älvgrupp. Syftet med älvgrupperna är att bygga upp kunskap om älven bland deltagande aktörer, skapa nätverk för att underlätta samarbete inför situationer med höga flöden och dammbrott samt bygga upp kompetens kring vattenhantering. Det ger bättre lokala förutsättningar för att hantera en högflödessituation när den inträffar. I älvgrupperna ingår bland annat representanter från länsstyrelser, kommuner, dammägare, larmcentraler, Trafikverket, Polisen, SMHI samt andra organisationer med ansvar och uppgifter längs det aktuella vattendraget.

Länsstyrelserna brukar, med stöd av det regionala samordningsansvaret, vara sammankallande och inneha ordförandeskap i dessa grupper. MSB ska initiera att älvgrupper bildas för det fall sådana inte finns.

Älvgrupperna bildades efter förslag från Älvsäkerhetsutredningen, SOU 1995:40. Utredningen föreslog att länsstyrelserna skull bilda och leda regionala samordningsorgan för flödesfrågor. Uppgifterna för dessa samordningsorgan skulle enligt Älvsäkerhetsutredningen innefatta

  • att bedöma behovet av planeringsunderlag i fråga om översvämningar, t.ex. riskzonskartor och samordna anskaffandet,
  • att överlägga med dammägarna om dammsäkerhetsfrågor utöver den regelmässiga tillsynen och att vid behov utföra eller komplettera studier av flodvågor efter tänkta dammbrott och deras konsekvenser, andra riskanalyser m.m.,
  • att biträda vid samordningen av planeringen av räddningstjänsten, däribland anskaffandet av uppgifter om flöden med tanke såväl på dammbrott som naturliga höga flöden,
  • att analysera behovet och värdet av möjligheterna till flödesdämpning och förtida tappning, att sammanjämka de kommunala intressena samt att överlägga med dammägarna om principerna för sådana åtgärder, inkl. ersättningsfrågor,
  • att bedöma var det bör gälla restriktioner för bebyggelsen med hänsyn till att höga flöden kan förekomma samt
  • att se till att informationen planeras och att ansvaret för denna fördelas mellan SMHI, dammägarna, länsstyrelser, räddningstjänsterna, kommunerna i övrigt och andra berörda organ, dels vad gäller uppgifterna dem emellan, dels uppgifter till allmänhet och massmedia.

I anslutning till förslaget om samordningsorgan föreslog Älvsäkerhetsutredningen även att det i länsstyrelsernas instruktion skulle anges att myndigheten skulle svara för den regionala samordningen av arbetet med dammsäkerhet och skydd mot översvämningar. Någon sådan bestämmelse i instruktionen har inte införts.

15

15 Från MSB:s hemsida www.msb.se.

5.4.2. Samordningsgruppen för information vid höga flöden

Samordningsgruppen16 är en operativ grupp som bildades 1994 och är representerad av:

  • Vattenregleringsföretagen (Umeälven, Ångermanälven, Indalsälven, Ljungan, Ljusnan och Dalälven)
  • Länsstyrelsen i Dalarnas, Gävleborgs, Jämtlands, Västernorrlands och Västerbottens län
  • Räddningstjänsten Östersund
  • SOS Alarm Jämtlands län
  • Polismyndigheten Jämtlands län
  • SMHI
  • Trafikverket
  • Försvarsmakten – Jämtlandsgruppen

Gruppens huvudsakliga uppgift är att svara för samordning av information vid höga flöden i de aktuella vattendragen, samt lämna förslag till åtgärder för att minska verkningarna av höga flöden inom berörda älvars avrinningsområden. Vid dammbrott eller överhängande fara för dammbrott ska gruppen bistå räddningsledaren med information som grund för beslut om åtgärder. Vattenregleringsföretagen är sammankallande i gruppen.

5.4.3. Krisberedskapssamverkan mellan länen

I dag sker krisberedskapssamverkan mellan länen i huvudsak i tre regionala nätverk, Nordsam, Ösam och Sydlänssamverkan. Inom dessa nätverk arbetar länsstyrelserna med att utveckla förmågan och beredskapen för att hantera kriser samt förmågan inom området skydd mot olyckor.

De tre regionala nätverken har en liknande organisation där samverkan leds av en styrgrupp som utgörs av beredskapsdirektörerna eller motsvarande samt ett antal arbetsgrupper och nätverk inom olika delområden. En gång om året träffas både

16 Vattenregleringsföretagens hemsida www.vattenreglering.se

handläggare och chefer inom respektive region, för kompetensutveckling och nätverksbyggande. De olika arbetsgrupperna träffas också regelbundet, cirka två till fyra gånger per år och därutöver per videokonferens.

Nordsam är ett samarbete mellan länsstyrelserna i Norrbotten, Västerbotten, Västernorrland, Jämtland, Gävleborg och Dalarna. Nordsam har en samordnare anställd på halvtid. Nordsams visionen med samarbetet är att få en god förmåga att vid kriser kunna avlösa och förstärka varandras resurser, en likvärdig tillsyn och handläggning samt en möjlighet att förstärka varandra i det dagliga arbetet.

Ösam är ett samarbete mellan länsstyrelserna i Värmland, Örebro, Södermanland, Västmanland, Stockholm, Uppsala, Östergötland och Gotland. Samarbetet i Ösam syftar till att minska sårbarheten och höja krishanteringsförmågan i de aktuella länen. Det sker främst genom utbyte av erfarenheter och kunskap, utarbetande av gemensamma inriktningar och samverkan vid planering.

Sydlänssamverkan är ett samarbete mellan Jönköping, Kronoberg, Kalmar, Blekinge, Skåne, Halland och Västra Götalands län.

5.4.4. Samordnad beredskapsplanering för dammbrott

Beredskapsplanering för dammbrott – Ett pilotprojekt i Ljusnan

År 2005 avslutades en pilotstudie för utveckling av samordnad beredskapsplanering för dammbrott17 som bedrivits av Svenska kraftnät, länsstyrelsen, kommuner och dammägare med Ljusnan som exempel. Syftet med pilotprojektet var att skapa en förebild för utveckling av beredskapsplanering för dammbrott i första hand för de stora kraftverksälvarna. Ett förslag till arbetsmodell för samordnad beredskapsplanering för dammbrott utarbetades i projektet. Projektet begränsades till att omfatta det akuta skedet från att ett problem vid en damm upptäcks till evakuering.

Framtagning av det gemensamma planeringsunderlaget omfattade flygfotografering av den aktuella älvsträckan, terrängmodellering, hydraulisk modellering, dammbrottsberäkningar och generering av GIS-skikt för vattenutbredningar. För Ljusnan

17 Elforskrapport 05:38 Dammsäkerhet - Beredskapsplanering för dammbrott - Ett pilotprojekt i Ljusnan, Elforsk (2005).

skapades en hydraulisk modell för hela huvudfåran och primära dammbrott beräknades för 11 dammar i vattendraget. Tre olika dammbrottsscenarier beräknades; dammbrott vid normalflöde, 100-årsflöde samt flödesdimensioneringsklass I-flöde. Dessutom gjordes beräkningar för 100-årsflöde och flödesdimensioneringsklass I-flöde utan dammbrott. Det gemensamma planeringsunderlaget utgörs av GIS-skikt och kartor som visar vattenutbredningen längs älven och information om flodvågens egenskaper. Det färdiga planeringsunderlaget distribuerades av länsstyrelsen med beaktande av behov av sekretess till dem som behöver informationen för beredskapsplaneringen såsom berörda kommuner, länsstyrelser, dammägare, Trafikverket och el- och teleoperatörer.

En central del av den samordnade beredskapsplaneringen är larmrutiner och larmplaner. I projektet utarbetades en larmplan för Ljusnan som beskriver dammägarens larm till berörda aktörer via SOS Alarm.

Dammägarens beredskap syftar i första hand till att förhindra dammbrott och i andra hand till att minimera konsekvenserna om ett dammbrott trots allt inträffar. I projektet redovisas en beredskapsplan som innehåller handlingsplaner för de aktiviteter som dammägaren ska vidta vid dammbrott, olika typer av allvarliga problem samt antagonistiska hot.

Rapporten nämner att kommunens beredskap syftar till att förbereda och planlägga agerandet hos kommunens förvaltningar vid ett dammbrott för att skydda liv samt begränsa skador. Projektet var i huvudsak begränsat till det inledande räddningstjänstskedet. I projektet utarbetade länsstyrelsen i Gävleborgs län en plan för agerande vid dammbrott i Ljusnan där grundsynen var att:

  • Länsstyrelsen ska stödja kommunerna och vara beredd att ta över ansvaret för räddningstjänst om behov av detta skulle uppstå. Kommunerna ska dock ha gjort sådan planering att de kan agera självständigt efter larm.
  • Länsstyrelsen ska vara beredd att efter larm skapa gemensam lägesuppfattning och stämma av varnings- och informationshanteringen med alla berörda aktörer samt följa och analysera det faktiska förloppet som underlag för agerande i kommunerna "nedströms".
  • Länsstyrelsen ska svara för rapportering till och kontakter med den nationella nivån.

Rapporten nämner vidare att information om beredskapsplaneringen till invånarna i kommunen bör utformas av respektive kommun i samverkan med dammägarna och länsstyrelsen. I projektet konstaterades att samordning bör ske mellan de olika kommunerna längs älven beträffande innehållet i informationen och tidpunkt för när allmänheten informeras. Vidare konstaterades att förebyggande information bland annat bör omfatta vilka områden som riskerar att översvämmas till följd av dammbrott samt instruktioner för evakuering. I projektet har ett exempel på information till allmänheten utarbetats.

Lägesbeskrivning avseende beredskapsplanering för dammbrott i de stora kraftverksälvarna

Utveckling av samordnad beredskap för dammbrott i de stora vattenkraftsälvarna pågår som älvvisa samverkansprojekt med pilotstudien i Ljusnan som förebild.

Utvecklingen stimuleras genom ekonomiskt stöd från Svenska kraftnät förutsatt bl.a. att berörda aktörer längs älven kommit överens om att utveckla samordnad beredskapsplanering. Ofta sker beslutet om att utveckla beredskapsplaneringen vid älvgruppsmöten anordnade av länsstyrelsen. Beredskapsplaneringsarbetet bedrivs per älv. En arbetsgrupp tillsätts för att genomföra projektet som bedrivs i olika faser.

  • Fas 1: Dammägare låter utarbeta gemensamma planeringsunderlag i form av översvämningskartor i GIS och tabeller som visar flodvågsutbredningen längs älven efter det att ett dammbrott skett. Dammägarna är ansvariga för genomförandet av fas 1.
  • Fas 2: Med planeringsunderlaget som underlag upprättas och samordnas beredskapsplaner av dammägare, kommuner, länsstyrelser m.fl. aktörer. Övningar hålls. Larmplaner upprättas. Länsstyrelserna samordnar fas 2.
  • Fas 3: Information till allmänheten upprättas och distribueras till berörda. Kommunerna är ansvariga för denna fas.

Svenska kraftnät genomförde en uppföljning under hösten 201118där berörda länsstyrelser fick frågor om hur beredskapsplaneringsarbetet fortskrider för de respektive älvarna. Enkätundersökningen visade att för de älvar där planeringsunderlaget var framtaget hade de flesta aktörerna påbörjat eller planerat upprättandet av sina beredskapsplaner men de var inte helt färdiga och samordnade med övriga aktörers planer.

Information till allmänheten om konsekvenser av dammbrott och beredskapsplaner försenades i Ljusnan då man ansåg att frågan om hur allmänheten ska varnas inte varit tillräckligt väl utvecklad. Detta föranledde att ett utvecklingsprojekt om varning av allmänheten genomfördes. Med ledning av det projektet lämnades information ut till invånare längs Ljusnan år 2010.

Övningar används för att stimulera planering och vidareutveckling, och kan dessutom fungera som avstämning vid koordinering av beredskapsplanerna och inför att information lämnas till allmänheten.

Två kompletterande utvecklingsprojekt19 i Elforsks regi har genomförts under 2008–2011 med det övergripande målet att främja utvecklingen avseende särskild varning av allmänheten vid dammbrott. Inriktningen har varit att verka för att särskilda varningssystem kommer till stånd i de stora reglerade älvarna. Representanter från Svenska kraftnät, MSB, dammägare, länsstyrelser och kommuner har medverkat i projekten.

Det konstateras att tidig varning vid dammbrott är helt avgörande för att människor så långt möjligt ska kunna sätta sig i säkerhet på egen hand, så att samhällets tillgängliga och i dessa sammanhang i praktiken begränsade resurser skall kunna användas för att stödja de personer som av något skäl inte själva kan sätta sig i säkerhet.

Utvecklingsprojekten tog som utgångspunkt att varningsfrågan för de stora reglerade älvarna behöver lösas samordnat för hela vattendraget. Dammarna ligger efter varandra vilket innebär att olika dammars översvämningsområden överlappar varandra och olika dammar kan föranleda varning i samma område.

18 Minnesanteckningar från workshop ”Stärkt dammsäkerhet – utvecklad tillsynsvägledning, tillsyn och beredskap” den 16 november 2011, Svenska kraftnät (2011). 19 Elforskrapport 09:53 ”Varning av allmänheten vid dammbrott – En studie av behov och möjligheter”, Elforsk (2009) och Elforskrapport 11:81 ”Varning av allmänheten vid dammbrott – En studie av behov och möjligheter kompletterad version 2011”, Elforsk (2011).

I Elforskrapport 09:53 rekommenderas att de berörda parterna – dammägare, kommuner, länsstyrelser och MSB – samråder på nationell nivå om ansvar och roller avseende varning och alarmering för dammbrott. Målet med ett samråd är att tydliggöra ansvarsfördelningen vilket skulle vara en gemensam grund för implementering av varningssystem längs älvarna.

Rapporten rekommenderar vidare att ett projekt med syftet att få till stånd system för varning av allmänheten vid dammbrott där det är skäligt genomförs i en av de reglerade älvarna. Arbetet bör göras med ledning av samrådet, Elforskrapporterna och den pilotstudie som utförts för en älv inom utvecklingsprojektet. När varningssystem är infört längs en älv bör utvecklingen fortsätta i övriga älvar med den första älven som förebild och arbetsgången förslagsvis dokumenteras tillsammans med en uppdaterad beskrivning av arbetsgången för samordnad beredskapsplanering för dammbrott.

5.4.5. Utredningens bedömning

Utredningen anser att beredskapen för dammbrott bör stärkas. Beredskap för dammbrott syftar till att i första hand om möjligt förhindra ett påbörjat skadeförlopp att utvecklas till dammbrott. För den händelse att dammbrott inte kan undvikas krävs också beredskap för att begränsa skadorna. Detta kräver en mellan dammägare, kommuner, länsstyrelser och andra aktörer genomförd samordnad beredskapsplanering samt att allmänheten har fått information om planeringen i förväg. Möjligheterna att rädda liv ökar betydligt om beredskap för varning och utrymning samt avspärrning av hotade områden har organiserats i förväg. Utredningen anser att den samordnade beredskapen för dammbrott behöver utvecklas och att det är angeläget att utvecklingsarbetet som beskrivits i avsnitt 5.4.4 fullföljs.

6. Verksamhetsutövarnas riktlinjer och dammsäkerhetsarbete

6.1. Verksamhetsutövarnas dammsäkerhetsarbete

Verksamhetsutövaren ska enligt MB fortlöpande planera och kontrollera verksamheten för att motverka eller förebygga sådana verkningar, se avsnitt 3.8. Syftet med egenkontrollen är alltså att verksamhetsutövaren ska ha kontroll över vilken påverkan verksamheten har på omgivningen.

Ägarna till dammar med stora konsekvenser vid dammbrott är med få undantag medlemmar i branschorganisationerna Svensk Energi eller SveMin, vilket innebär att de har förbundit sig att arbeta enligt branschorganisationernas riktlinjer för dammsäkerhet, RIDAS respektive GruvRIDAS. Dessa riktlinjer för dammsäkerhet har utarbetats av Svensk Energi och SveMin vilket medför att ägare som inte är medlemmar i dessa branschorganisationer, ofta ägare av mindre dammar med små eller försumbara konsekvenser vid dammbrott, inte har några riktlinjer för dammsäkerhet. Några ägare har förbundit sig att arbeta enligt RIDAS trots att de inte är medlemmar i branschorganisationen.

En verksamhetsutövares dammsäkerhetsarbete består av flera arbetsuppgifter. För dammägare med flera 10-tal dammanläggningar är prioritering och planering av såväl tillståndskontroll som underhållsåtgärder och upprustningsprojekt en viktig uppgift. För att styra sitt dammsäkerhetsarbete upprättar dammägarna rutiner och instruktioner. Dessa kan även användas för uppföljning.

Tillståndskontroll genomförs med olika intervall vid de olika dammanläggningarna. Tillståndskontroll kan vara allt från driftmässig tillsyn, inspektioner och okulär besiktning av dammen, till komplexa ekolodningar av uppströmsslänten, dykarbesiktningar och fördjupade dammsäkerhetsutvärderingar. Att övervaka dammarna är också en viktig arbetsuppgift för dammägare. Över-

vakningen kan genomföras med hjälp av mätinstrument som är kopplade till en driftcentral eller som avläses manuellt. Onormala värden kan föranleda olika typer av utredningar eller åtgärder.

För att kunna prioritera och planera åtgärder krävs kunskap om dammanläggningarnas funktioner, om avvikelser och brister vid dammanläggningarna samt en metod för att analysera dessa avvikelsers och bristers betydelse för dammsäkerheten. En transparant metod som visar både anläggningens sårbarhet och potentiella konsekvenser vid dammbrott ger en möjlighet att upptäcka, värdera och därefter reducera en dammanläggnings risker.

En annan viktig del av dammsäkerhetsarbetet är att tillse att de personer som på något sätt arbetar med dammarna har erforderlig kunskap om dammsäkerhet. Det gäller såväl egen personal som konsulter och entreprenörer som anlitas för olika arbeten vid dammanläggningarna. Det rör sig om de som arbetar i driftcentralerna, de som genomför tillståndskontroller, de som värderar de svagheter och brister som upptäcks samt de som planerar och prioriterar åtgärder och de som genomför projekt.

6.2. Riktlinjer

6.2.1. RIDAS – Kraftföretagens riktlinjer för dammsäkerhet

Kraftindustrin antog 1997 Kraftföretagens riktlinjer för dammsäkerhet (RIDAS) som består av dels ett huvuddokument, dels mer detaljerade tillämpningsanvisningar. En första revidering genomfördes 2002 och därefter 2008 då det dessa år utkom nya utgåvor av RIDAS. Kontinuerligt har skett och fortsatt sker en utveckling av de tillämpningsvägledningar som är knutna till RIDAS. Under 2010 startade ett arbete utifrån ställningstaganden i branschens arbetsgrupper, erfarenheter från pilotprojekt och från RIDAS systemrevisioner med en översyn av 2008 års utgåva med tillhörande tillämpningsvägledningar vars resultat föreligger i RIDAS 2012. Styrelsen för Svensk Energi har beslutat att anta dessa riktlinjer för tillämpning av berörda medlemsföretag med start under 2012.

Nedan redovisas några väsentliga tillägg och ändringar i RIDAS 2012, jämfört med RIDAS 2008 i punktform:

  • innebörden i policyn har utvecklats utifrån begreppet svår påfrestning på samhället
  • tydliggörande av vikten av ett systematiskt arbetssätt
  • en ny konsekvensklass med tillhörande kriterier har införts för att särskilja dammar där konsekvenserna vid dammbrott vad gäller sannolikheten för svår påfrestning på samhället är hög
  • utvecklade kompetenskrav framförallt avseende tillståndskontrollaktiviteter
  • funktionsprovning av system kopplade till avbördningssäkerheten har införts i tillståndskontrollen samt att begreppet besiktning ersatts av fördjupad inspektion
  • förslag till frekvens och innehåll i program för tillståndskontroll har förändrats
  • utvecklad systemrevision av de företag som har dammar i den högsta konsekvensklassen

De övergripande målen för kraftindustrins dammsäkerhetsriktlinjer är att:

  • definiera krav och ange riktlinjer för god och enhetlig dammsäkerhet
  • utgöra grund för enhetlig bedömning av dammsäkerheten och identifiering av behovet av dammsäkerhetshöjande åtgärder genom systematiskt genomförd egenkontroll
  • vara stöd för myndigheters dammsäkerhetstillsyn

RIDAS 2012 tydliggör att riktlinjerna inte ska betraktas som lag, föreskrift eller dylikt, utan ses som ett stöd i respektive medlemsföretags dammsäkerhetsarbete. Eventuella avsteg från riktlinjerna, och förutsättningarna för det, redovisas och dokumenteras. Tilllämpningen av riktlinjerna förutsätts leda till en utveckling mot bättre lösningar. Det viktigaste är att riktlinjernas andemening genomsyrar respektive medlemsföretags dammsäkerhetsarbete.

Nedan ges en kortfattad beskrivning av RIDAS 2012 och dess innehåll.

Svensk Energis dammsäkerhetspolicy

Svensk Energis policy för dammsäkerhet:

Medlemsföretagens dammsäkerhetsarbete är inriktat på att så långt möjligt skydda människors liv och hälsa samt samhället mot svåra påfrestningar, men beaktar även andra skyddsbehov. Kraven på dammsäkerhet ställs i relation till bedömda konsekvenser i händelse av dammbrott.

Detta innebär att:

  • sannolikheten för dammbrott där svår påfrestning på samhället och förlust av människoliv kan förväntas, ska hållas på lägsta möjliga nivå
  • konsekvenserna i händelse av dammbrott ska genom god planering såvitt möjligt reduceras.
  • dammsäkerheten ska hållas på god internationell nivå

Dammsäkerhetsarbetet ska bedrivas på ett kvalitetssäkrat sätt och ska kännetecknas av fortlöpande förbättringar. I praktisk handling förutsätts att:

  • arbetet genomförs på ett ansvarsfullt sätt och i enlighet med gällande lagar och förordningar
  • insatser styrs och prioriteras utifrån säkerhetsvärderingar baserade på analyser av dammanläggningarnas status och konsekvenserna i händelse av dammbrott
  • ledningen av dammsäkerhetsarbetet bedrivs systematiskt och med ett långsiktigt perspektiv
  • samverkan sker med berörda myndigheter.

Konsekvensklassificeringen

Enligt kraftindustrins policy för dammsäkerhet ställs kraven på dammsäkerhet i relation till bedömda konsekvenser av dammbrott. I praktisk handling förutsätts att dammsäkerhetsarbetet styrs och prioriteras utifrån analyser av dammanläggningarnas status och konsekvenserna i händelse av dammbrott. Medlemsföretagens dammar ska därför klassificeras utifrån en bedömning av den maximala skada som kan bli följden av ett dammbrott. Verksamhets-

utövarna ska genomföra och dokumentera klassificering av dammanläggningarna.

Kraftindustrin har för detta ändamål utarbetat ett system för konsekvensklassificering där konsekvenserna av dammbrott värderas med avseende på sannolikheten för svår påfrestning på samhället, förlust av människoliv eller allvarlig personskada, övriga skador på miljö, samhällsanläggningar och ekonomiska värden.

Nedan redovisas konsekvensklassificeringssystemet i RIDAS 2008 och 2012.

Organisation

Enligt RIDAS ska ägaren av en dammanläggning tillse att dammsäkerhetsarbetet organiseras på ett ändamålsenligt sätt och att alla verksamma i dammsäkerhetsorganisationen har erforderlig kompetens samt skriftliga förebilder för sitt arbete.

Organisation och ansvarsfördelning med avseende på dammsäkerheten ska vara fastlagd och dokumenterad.

Personal engagerad i dammars drift, beredskap, tillståndskontroll, underhåll och projektverksamhet ska ha relevant kompe-

tens för sin uppgift. Personalens kompetens ska vara dokumenterad och innefatta uppgifter om utbildning och erfarenhet.

Den som är ansvarig för dammsäkerheten, Dammsäkerhetsansvarig, ska namnges i organisationen liksom RIDAS-ansvarig och Dammtekniskt sakkunnig. Andra nyckelpersoner avseende dammsäkerhet utgörs av personal som handhar vattenhushållning, driftledning/arbetsledning, fjärrövervakning och -styrning, drift och underhåll samt beredskap. Dessutom kan även ingenjörer, tekniker och kontrollanläggningspersonal med arbetsuppgifter som berör dammsäkerhetsfunktioner räknas hit.

Manual för Drift, Tillståndskontroll och Underhåll (DTU-manual)

För varje anläggning ska det enligt RIDAS finnas en särskild manual med alla nödvändiga skriftliga förebilder i form av dokumentation, rutiner och tillvägagångssätt för dammägarens drift, tillståndskontroll och kontinuerliga underhåll.

Tillståndskontroll

Syftet med dammägarens tillståndskontroll är enligt RIDAS att fortlöpande övervaka och kontrollera en damms aktuella status i förhållande till dess ursprungliga status eller funktionskrav samt eventuella förändringar i lagar och riktlinjer.

Vid kontroll av tillståndet hos en damm ska programmet för denna kontroll baseras på dammens konsekvensklass och innehålla följande aktiviteter:

  • driftmässig tillsyn
  • dammätning
  • inspektion
  • besiktning/fördjupad inspektion
  • fördjupad dammsäkerhetsutvärdering (FDU)

Syftet med en FDU är att fastställa dammsäkerhetsstatus med beaktande av aktuella säkerhetskrav. Bland aktuella säkerhetskrav ingår förutom eventuella skärpningar av lagar, förordningar och

normer även förändringar i dimensionerande flöden för dammen ifråga.

Utvärderingen ska vara en heltäckande och systematisk analys och värdering av säkerheten hos en dammanläggning baserad på en totalanalys av alla säkerhetskomponenter och hela systemet. Utvärderingen ska innefatta besiktning av alla dammdelar, funktionsprovning och funktionsbedömning, utvärdering av drifterfarenheter, genomgång och utvärdering av konstruktionsförutsättningar och konstruktionshandlingar samt DTU-manual och beredskapsplan med beaktande av aktuella säkerhetskriterier och krav. Utvärderingen ska också innefatta analys av drifterfarenheter och av säkerhetsarbetets uppläggning.

Felrapportering

Rapportervärda omständigheter ska enligt RIDAS rapporteras i kraftindustrins felrapporteringssystem. Syftet med rapporteringen är i första hand att åstadkomma en gemensam bank av erfarenheter som ger möjlighet för de enskilda dammägarna att genomföra fortlöpande förbättringar. Rapporterade erfarenheter kan även nyttjas som underlag för gemensam statistik samt utvärderingar i branschen. System för bedömning av avvikelser, se avsnitt 6.2.4, tillämpas vid rapporteringen.

Underhåll

En damm ska enligt RIDAS underhållas i den omfattning som är nödvändig för att fortlöpande vidmakthålla dess dammsäkerhetsstatus. Underhåll ska planeras och utföras på ett systematiskt sätt. Underhåll ska baseras på resultatet av genomförd tillståndskontroll samt krav på dammsäkerhet ställda i lagar och riktlinjer.

Drift och beredskap

Med drift avses i RIDAS planering, övervakning och hantering av en vattenkraftanläggning. Ordet drift inriktar sig således, vad dammen beträffar, på operativa verksamheter samt personella insatser för övervakning av dammens status och manövrering av

dess rörliga delar, t.ex. luckor. Den ordinarie organisationen svarar i normala driftsituationer för dammens säkra drift.

För att tillgodose behovet av förstärkning av organisationen vid onormala driftsituationer och vid fara för dammbrott ska planeringsåtgärder vara vidtagna som leder till personella och materiella resurser i beredskap.

Dammägaren ska ha god beredskap för att kunna hantera situationer som kan leda till dammbrott eller på annat sätt okontrollerad utströmning med risk för allvarliga skador på människor, miljö och värdefull egendom samt i händelse av dammbrott minimera konsekvenserna därav. Regler och rutiner för arbetsgång och åtgärder i sådana situationer ska finnas fastlagda och dokumenterade i en beredskapsplan.

Åtgärder i samband med och inför ett möjligt dammbrott ska vara beskrivna i en beredskapsplan. Planen ska ange organisation, ansvar och gränser mot externa organisationer. I beredskapsplanen ska dessutom framgå vilka driftåtgärder som bör vidtas och vilka personella och materiella resurser som finns att tillgå för att i första hand förhindra dammbrott eller i händelse av dammbrott i möjligaste mån mildra konsekvenserna därav. Motivet är att minimera de skador på människor, värdefull egendom och miljö som kan bli följden av ett eventuellt dammbrott. Dammägarens beredskap avser förutom god planering för egna insatser vid dammen även information till och samverkan med räddningstjänst och andra berörda aktörer.

Syftet med beredskapsplaneringen är att genom förberedda åtgärder:

  • minimera risken för att dammbrott uppstår
  • minimera konsekvenserna i händelse av dammbrott
  • minska risken för felaktiga beslut och åtgärder i krissituationer
  • säkerställa gott utnyttjande av tillgängliga resurser
  • identifiera och säkerställa ansvar på olika nivåer
  • säkerställa att alla i organisationen erhåller nödvändig information.

Resultatet av beredskapsplaneringen ska utgöras av en beredskapsplan enligt ovan som även inkluderar handlingsplaner för anläggningsorienterade åtgärder i händelse av förhöjd risk för damm-

skada/dammbrott eller att dammbrott inträffat. Alla åtgärder i samband med och inför ett möjligt dammbrott ska vara beskrivna. I förberedelseskedet ska, så långt som möjligt, alla onormala händelser som kan medföra risk för skada på människor, anläggningen och/eller miljön identifieras, värderas och analyseras. Bland onormala händelser ingår även skador på anläggningen som kan förorsakas av intrång och sabotage. Resultaten utgör grund för planeringen.

För en effektiv beredskapsplanering ska samverkan, planering, information och kommunikation ske med aktörer som berörs i händelse av dammskada. Huvudaktörerna utgörs av dammägare, vattenregleringsföretag, länsstyrelse och kommunal räddningstjänst.

Dammsäkerhetsrevisioner

Att dammsäkerhetsarbetet bedrivs i enlighet med RIDAS ska kontrolleras vid revisioner. Den fristående granskningen ska utföras av två revisorer med Svensk Energi som huvudman. Revisionen avser företagets samlade dammsäkerhetsprogram och verksamhet. Revisorerna rapporterar till Svensk Energi. Vid revision av företag som äger eller förvaltar dammar i konsekvensklass 1+ ska revisorerna grundligt pröva hur riktlinjerna tilllämpas bl.a. avseende principer för säkerhet, ledning och kvalitet i dammsäkerhetsarbetet.

6.2.2. GruvRIDAS – Gruvindustrins riktlinjer för dammsäkerhet

Föreningen för gruvor, mineral och metallproducenter i Sverige (SveMin) utgav 2007 gruvindustrins riktlinjer för dammsäkerhet (GruvRIDAS). GruvRIDAS är framtagen med utgångspunkt från RIDAS och gruvindustrin följer i princip samma rutiner som kraftindustrin tillämpar. En reviderad utgåva av GruvRIDAS utgavs 2010 och ändringarna innebar en anpassning till RIDAS struktur 2008. SveMin har sedan 2005 en dammsäkerhetspolicy för sina medlemsföretag:

Medlemsföretagens dammsäkerhetsarbete är i första hand inriktat på skyddet av hälsa, säkerhet och miljö, men beaktar även andra aspekter.

Medlemsföretagen åtar sig att, med beaktande av de krav som följer av lagar och andra bestämmelser, följa de principer som läggs fast i föreliggande riktlinjer. Med denna inriktning ska

  • kraven på dammsäkerhet ställas i relation till bedömda konsekvenser i händelse av dammbrott,
  • stabilitet och säkerhet mot dammbrott vara ett avgörande kriterium vid lokalisering av dammar,
  • dammar utformas, byggas, övervakas, underhållas och efterbehandlas så att sannolikheten för funktionsstörningar, skador och dammbrott hålls på lägsta möjliga nivå,
  • konsekvenserna i händelse av dammbrott genom god planering och förebyggande åtgärder så långt möjligt reduceras,
  • den förutsedda livslängden vara en styrande faktor vid utformning av dammar samt
  • dammsäkerheten hållas på god internationell nivå. Medlemsföretagen åtar sig att följa rutiner som säkerställer att dammsäkerhetsarbetet kvalitetssäkras och fortlöpande utvecklas.

Även gruvindustrin har ett felrapporteringssystem där fel och brister rapporteras, på samma sätt som kraftindustrin gör i sitt felrapporteringssystem.

6.2.3. Riktlinjer för bestämning av dimensionerande flöden

Våren 1985 bildade kraftindustrin och SMHI den s.k. Flödeskommittén för att skapa riktlinjer för bestämning av dimensionerande flöden för dammanläggningar. Arbetet resulterade i en slutrapport 1990. En ny utgåva med riktlinjer för bestämning av dimensionerande flöden för dammanläggningar kom 2007, nu med delat huvudmannaskap mellan Svenska kraftnät, Svensk Energi och SveMin.1 Innebörden i de ursprungliga riktlinjerna är i huvudsak oförändrad, men tillägg och ändringar som tillkommit efter 1990 har inarbetats och språket har förenklats och förtydligats.

Enligt riktlinjerna delas dammanläggningarna in i flödesdimensioneringsklasser, beroende på konsekvenserna i händelse av dammbrott i samband med höga flöden. Dammanläggningar där ett dammbrott inte bedöms orsaka skada för någon annan än dammägaren omfattas inte av riktlinjerna.

1 Riktlinjer för bestämning av dimensionerande flöden för dammanläggningar, Svensk Energi, SveMin, Svenska kraftnät, 2007.

Källa: Svensk Energi, SveMin, Svenska kraftnät.

Dammanläggningar i flödesdimensioneringsklass I ska utan allvarlig skada på dammen kunna hantera en mycket extrem flödessekvens, som bestäms genom hydrologisk modellering. De dimensionerande flödenas återkomsttid kan inte anges men jämförelser med frekvensanalys indikerar att flöden som beräknats på detta sätt i genomsnitt har återkomsttider på mer än 10 000 år.

Dammanläggningar i flödesdimensioneringsklass II ska vid dämningsgränsen kunna släppa fram ett tillrinnande flöde med återkomsttid om minst 100 år. Klass II-anläggningar ska dessutom anpassas till ett flöde som bestäms genom kostnads/nyttoanalys. De lägre kraven jämfört med kraven för dammanläggningar i flödesdimensioneringsklass I motiveras av att konsekvenserna för samhället om en dammanläggning i klass II går till brott bedöms bli

relativt måttliga och att risken för förlust av människoliv bedöms vara försumbar.

I nyutgåvan av riktlinjerna behandlas frågan om riktlinjernas tillämpning i ett föränderligt klimat, och följande rekommendationer lämnas:

Mot bakgrund av bland annat de osäkerheter som ett förändrat klimat tillför, bör beräkningsförutsättningar ses över regelbundet. Jämförelser mellan inträffade flödessituationer och beräknade dimensionerande flöden bör utföras fortlöpande. Systemet känslighet för klimatförändringar bör analyseras genom utnyttjande av klimatscenarier. Nya förutsättningar kan leda till att dimensionerings-beräkningarna behöver revideras. Osäkerheter kring det framtida klimatet får dock inte hindra att nödvändiga dammsäkerhetshöjande åtgärder vidtas. På grund av dessa osäkerheter bör dessutom flexibilitet och marginaler skapas där så är lämpligt.

Uppföljning av riktlinjernas relevans sker fortlöpande genom den så kallade Flödeskonferensen, där SMHI, Svenska kraftnät, Svensk Energi och SveMin är representerade.

6.2.4. System för bedömning av dammsäkerhetsanmärkningar

Svenska kraftnät och Svensk Energi lät 2004 upprätta ett system för klassificering av dammsäkerhetsanmärkningar, s.k. standardiserade bedömningsklasser. Genom bedömningssystemet har en gemensam nomenklatur etablerats. Den gemensamma nomenklaturen och det systematiska sättet att bedöma en svaghets betydelse för dammsäkerheten syftar bl.a. till tydligare kommunikation mellan olika parter om hur stor betydelse en brist eller skada har ur dammsäkerhetssynpunkt. I samverkan även med SveMin utgavs en ny version2 2010 i syfte att förtydliga bedömningssystemet för att bidra till en god tillämpning och ge utökat stöd för dem som arbetar med dammsäkerhet.

2 System för bedömning av dammsäkerhetsanmärkningar. Svenska kraftnät, Svensk Energi och SveMin (reviderad 2010).

Källa: Svensk Energi, SveMin och Svenska kraftnät.

6.3. Verksamhetsutövarnas rapporterade dammsäkerhetsarbete

Nedanstående redogörelse över verksamhetsutövarnas dammsäkerhetsarbete utgår ifrån riktlinjerna i RIDAS och GruvRIDAS och Svenska kraftnäts sammanställning av rapportering avseende dammsäkerhet år 20103. Redogörelsen sammanfattar det dammsäkerhetsarbete som bedrivs av ägare till dammar i konsekvensklass 1A, 1B och 2. Se mer om rutinen för årsrapportering i avsnitt 5.3.2.

Konsekvensklass och flödesdimensioneringsklass

Enligt RIDAS ska dammägare konsekvensklassificera sin dammanläggning utifrån konsekvenser vid dammbrott. I årsrapporteringarna uppger de flesta verksamhetsutövare konsekvensklass för dammanläggningarna. För de större dammanläggningarna anges dessutom flödesdimensioneringsklass. Sammanställningen av rapportering avseende dammsäkerhet år 2010 omfattade 510 dammanläggningar med fördelningen:

  • 87 i konsekvensklass 1A
  • 132 i konsekvensklass 1B
  • 291 i konsekvensklass 2

3 Sammanställning av rapportering avseende dammsäkerhet år 2010, Svenska kraftnät, (2011).

DTU-manualer

Enligt RIDAS ska det för varje dammanläggning finnas en särskild manual för drift, tillståndskontroll och underhåll (DTU-manual). Enligt dammägarnas rapportering hade 98 procent av anläggningarna i klass 1A, 91 procent av anläggningarna i klass 1B och 73 procent av anläggningarna i konsekvensklass 2 en DTU-manual.

Fördjupade dammsäkerhetsutvärderingar

Enligt RIDAS ska en FDU för dammar tillhörande konsekvensklass 1A, 1B och 2 utföras, med varierande frekvens beroende på konsekvensklass.

Att genomföra FDU:er är ett fortlöpande utvecklingsarbete som pågår av dammägare som tillämpar RIDAS. Enligt dammägarnas rapportering hade en FDU genomförts för 92 procent av anläggningarna i konsekvensklass 1A, 70 procent av anläggningarna i konsekvensklass 1B och 27 procent av anläggningarna i konsekvensklass 2. Sammanställningen visar att FDU:er ännu inte genomförts för en relativt stor andel av dammbeståndet. Under 2010 uppges 21 FDU:er ha genomförts/färdigställts.

Identifiering av svagheter och genomförande av åtgärder

Uppgifter om under året identifierade svagheter, genomförda åtgärder samt rapporterade händelser med betydelse för dammsäkerheten efterfrågas i årsrapporten. Det efterfrågas om det framkommit några allvarligare svagheter med betydelse för dammsäkerheten samt hur och när avhjälpande åtgärder vidtagits eller kommer att vidtas.

Avseende 2010 rapporterar nio dammägare om allvarliga svagheter fördelade på 29 anläggningar, 12 dammägare om genomförda åtgärder vid 37 anläggningar och fem dammägare om driftstörningar med avseende på dammsäkerhet vid åtta anläggningar. Cirka 55 procent av de rapporterade svagheterna handlade om problem kopplade till avbördningsanordningarna och cirka 10 procent vardera om stabilitetsproblem respektive sjunkhål/sättningar.

Beredskapsplanering för dammbrott

I RIDAS beskrivs att det för varje anläggning ska finnas en beredskapsplan för allvarliga händelser på dammen samt för dammbrott.

De dammägare som har anläggningar i de stora kraftverksälvarna medverkar i projekten för samordnad beredskapsplanering som påbörjades 2005, se vidare avsnitt 5.4.4. I dessa projekt upprättas översvämningskartor samt tabeller med information om vattnets framfart vid dammbrott. Denna information kallas planeringsunderlag. Därefter ingår att berörda parter upprättar eller ser över sina beredskapsplaner och att koordinering och övningar genomförs. Detta innebär att de dammägare som har anläggningar längs dessa älvar ser över sina beredskapsplaner i samband med projekten.

Sammanställningen av årsrapporteringen 2010 innehåller inga uppgifter om beredskapsplanering. För årsrapporteringen som omfattar år 2011 har Svenska kraftnät infört att även uppgifter om beredskapsplaner och larmplaner ska rapporteras till tillsynsmyndigheten4.

Anpassning till dimensionerande flöden

De flöden som dammanläggningar i flödesdimensioneringsklass I ska kunna hantera enligt riktlinjerna för dimensionerande flöden har en återkomsttid som har uppskattats till att i genomsnitt vara längre än 10 000 år. Svenska kraftnät konstaterar i sin sammanställning att anpassningen av dammanläggningarna till kraven i riktlinjerna för dimensionerande flöden är ett omfattande arbete. Arbetet innefattar beräkning av dimensionerande flöden genom hydrologisk modellering, utredning, projektering, tillståndsprövning och slutligen genomförande av erforderliga ombyggnadsåtgärder.

I Svenska kraftnäts sammanställning beskrivs hur anpassningsarbetet till riktlinjerna för dimensionerande flöden följs upp. Den så kallade Flödeskonferensens, se avsnitt 2.6.7, har en förteckning över dammanläggningar i flödesdimensioneringsklass I som tillhör Svensk Energis medlemsföretag. Förteckningen innehåller uppgifter om åtgärdsbehov som har konstaterats för anläggningarna, samt de åtgärder som utförts eller planeras att utföras av

4 Årsrapportering av dammsäkerhet, Hur görs rapporteringen? Anvisning till dammägare Version 2011-12-20, Svenska kraftnät.

dammägarna. Förteckningen uppdateras efterhand som anpassningsarbetet fortskrider. Uppföljningen omfattar dammanläggningar inom Svensk Energis medlemsföretag och omfattade vid årsskiftet 2010/2011 145 stycken anläggningar. Svenska kraftnäts sammanställning visar:

  • För cirka 57 procent av anläggningarna har anpassning till dimensionerande flöde utförts, alternativt krävdes inte någon anpassning för att klara riktlinjerna.
  • Åtgärder för anpassning till dimensionerande flöde pågår vid cirka 6 procent av anläggningarna.
  • För cirka 38 procent av anläggningarna har åtgärdsbehov ännu inte utretts eller åtgärder påbörjats.

Svenska kraftnät konstaterar vidare att anpassningsåtgärder vid årsskiftet 2010/2011 hade utförts vid totalt 60 anläggningar och pågick vid 8 anläggningar.

6.4. Utvecklingsarbete

6.4.1. Utvecklingsarbete inom ICOLD och SwedCOLD

ICOLD utgör ett forum för att främja utbyte av kunskap och erfarenhet inom planering, projektering, byggande, skötsel och underhåll av höga dammar. ICOLD grundades 1928 och har över 90 medlemsländer och cirka 6 000 individuella medlemmar. Sverige har varit medlem i ICOLD sedan 1931 och bedriver sin verksamhet genom Svenska Nationalkommittén för Höga Dammar, benämnd SwedCOLD, (Swedish Committee on Large Dams). SwedCOLD skall bl.a. främja forskning och utveckling inom dammbyggnadstekniken, bekosta avgifter till ICOLD, representera Sverige vid ICOLD:s årliga möten, ombesörja information om ICOLD och om angelägna frågor rörande dammar, uppmuntra svensk representation av artiklar till ICOLD:s kongresser5.

ICOLD upprättar genom sina cirka 25 tekniska kommittéer löpande bulletiner inom valda områden. Svenska representanter medverkar i kommittéer med verksamhet inom områden som är viktiga ur svenskt perspektiv. SwedCOLDs exekutivkommitté väljer ut de svenska representanterna. Inom dammsäkerhetskommittén

5 SwedCOLDs hemsida www.swedcold.org

pågår t.ex. ett utvecklingsarbete med att upprätta en bulletin om dammsäkerhetsarbete utifrån verksamhetsutövares perspektiv6. Bulletinen förväntas publiceras under 2012.

Bulletinen beskriver hur ett företags dammsäkerhetsarbete kan bedrivas med utgångspunkt från ett dammsäkerhetsledningssystem som en del av ett företags övergripande ledningssystem. Dammsäkerhetsledningssystemet och dess olika ingående processer beskrivs grundligt i bulletinen. De ingående processerna är: policy och övergripande inriktning, planering, genomförande, mätning och utvärdering, revisioner och rapportering samt ständiga förbättringar. Syftet för en dammägare med att ha ett dammsäkerhetsledningssystem är att säkerställa att dammsäkerhetsrisker hanteras på systematiskt sätt samt att alla delar av dammsäkerhetsarbetet integreras med övrig verksamhet.

6.4.2. Utvecklingsarbete inom kraftindustrin

Svensk Energi ansvarar för utvecklingen av RIDAS. Arbetet bedrivs i projektform med styrning och medverkan från Svensk Energis Dammsäkerhetskommitté, dammsäkerhetsspecialister från medlemsföretagen och med projektledning från Svensk Energi.

Elforsk AB startade sin verksamhet 1993 och ägs av Svensk Energi och Svenska kraftnät. Det övergripande syftet med Elforsk är att rationalisera den branschgemensamma forskningen och utvecklingen. Verksamheten inom Elforsk bedrivs i form av samlade ramprogram och som enskilda projekt. Elforsks ”Ramprogram dammsäkerhetstekniskt utvecklingsarbete” syftar till att bidra till en uthålligt hög dammsäkerhet och stödja branschens dammsäkerhetspolicy, bl.a. genom att ha en förebyggande prägel. Programmet bedrivs till stora delar i samverkan med Svenska kraftnät (i rollen som myndighetsfunktion för dammsäkerhet) och innehåller ett väsentligt internationellt utbyte7. Verksamheten bidrar dessutom till vidareutveckling av branschens riktlinjer för dammsäkerhet (RIDAS). Inom ramprogrammet bedrivs olika utredningar som resulterar i rapporter som finns att hämta på Elforsks hemsida. Aktuella utvecklingsprojekt handlar bl.a. om kvantitativ riskanalys, drivgods och höga flöden, framtagande av en svensk

6 Dam Safety Management: Operational Phase of the Dam Life Cycle, arbetsdokument, ICOLD, 2011. 7 http://www.elforsk.se/Programomraden/Vattenkraft/Dammsakerhet1/.

kortversion av ovan nämnda ICOLD bulletin, se avsnitt 6.4.1, samt varning av allmänheten vid dammbrott, se avsnitt 5.4.4.

6.5. Utredningens kontakter med dammägare

Utredningen har vid samråd med Svensk Energis Dammsäkerhetskommitté samt med två av de största dammägarna i landet, Fortum och Vattenfall, fått ta del av hur dammägarna lägger upp sitt dammsäkerhetsarbete. Det har framkommit att flera av de större dammägarna beaktar den nya ICOLD-bulletinens (se avsnitt 6.4.1) innehåll och strukturerar sitt dammsäkerhetsledningssystem i enlighet med bulletinens förslag.

Utredningen konstaterar att dammägarna noterat att tillsynen bedrivs olika i olika län och att dammar i olika konsekvensklasser hanteras olika mellan länen. Ägarna tror att det beror på bristande kompetens, resurser och dålig koordinering mellan länsstyrelserna. Ägarna menar att länsstyrelserna endast i undantagsfall efterfrågar något annat än årsrapporteringarna och önskar mer dialog och engagemang avseende dammägarnas egenkontroll av dammsäkerheten från länsstyrelsens sida.

Länsstyrelsens engagemang i dammägarnas egenkontroll av vattenverksamhet med avseende på fiske och minimitappning är enligt dammägarnas mening större än för dammsäkerhet. För att öka engagemang och dialog avseende dammsäkerhet önskar dammägarna att tillsyn av dammsäkerheten särskiljs från tillsyn av vattenverksamheten i övrigt.

Utredningen konstaterar att dammägarna har en god kontakt med beredskapshandläggarna på länsstyrelsen och att utvecklingen av samordnad beredskapsplanering för dammbrott bidragit till det.

6.6. Utredningens bedömning

Utredningen ser det som viktigt att staten och branschen även fortsättningsvis stödjer forskning och utveckling gemensamt.

Det är nödvändigt för ett litet land som Sverige att svenska representanter deltar i internationellt utvecklingsarbete via bl.a. ICOLD för att inhämta nya kunskaper till Sverige.

Utredningen anser att det är av stor vikt att branschen via Svensk Energi och SveMin fortsätter att vidareutveckla RIDAS och

GruvRIDAS. Dessa riktlinjer med sina tillhörande tillämpningsvägledningar kommer med sin detaljeringsgrad alltid att fylla en viktig funktion för verksamhetsutövarna även när ett dammsäkerhetsregelverk träder i kraft. De tekniska krav och den detaljeringsnivå som finns i RIDAS och GruvRIDAS passar bättre i riktlinjer än i en reglering.

Utnyttjandet av Elforsk för olika utvecklingsprojekt är enligt utredningen en lämplig lösning, men Svensk Energi bör ha en långsiktig plan för RIDAS utveckling och på så sätt styra vilka utvecklingsprojekt som bör initieras.

Utredningen finner det vällovligt att verksamhetsutövarna arbetar systematiskt med alla aspekter som berör anläggningarnas säkerhet, i linje med det arbetssätt som beskrivs i ICOLDbulletinen och även är en utgångspunkt i RIDAS. Utredningen bedömer att de större dammägarna är på god väg att anamma detta arbetssätt. Mindre dammägare har inte nått lika långt, troligen beroende på att bulletinen ännu inte publicerats.

Utredningen noterar att de två dammbrott som inträffade under hösten 2010, som beskrevs i kapitel 2, visar på brister i verksamhetsutövarnas egenkontroll. Det är av stor vikt att verksamhetsutövare identifierar och åtgärdar säkerhetsbrister som ett led i sin egenkontroll. Utredningen anser vidare att det är viktigt att verksamhetsutövare drar lärdom av inträffade dammbrott, både i Sverige och i andra länder, för att liknande händelser inte ska inträffa igen.

Anläggningarnas anpassning till riktlinjerna för dimensionerande flöden är enligt utredningen ett angeläget men långsiktigt arbete som successivt bör fortsätta att genomföras. Utredningen noterar att för en stor del av anläggningarna har åtgärdsbehov ännu inte utretts eller åtgärder påbörjats och betonar vikten av att det görs. De stora vattenkraftälvarna är komplexa system med många dammanläggningar som påverkar varandra och anpassningsarbetet kräver samverkan mellan flera intressenter.

7. Utgångspunkter

7.1. Utgångspunkter för utredningen

Detta kapitel beskriver utgångspunkterna för utredningen. Syftet är att ge en kortfattad problematisering av utgångsläget i landet avseende dammsäkerhet. Utgångspunkterna är strukturerade enligt nedan:

  • Samhället är mer säkerhetsmedvetet och ställer höga krav på säkerheten
  • Dammar medför både nytta och risk för samhället
  • Ett dammbrott i en av de största dammarna i Sverige skulle ge katastrofala konsekvenser
  • Ett specifikt och samlat regelverk för dammsäkerhet finns inte i Sverige
  • Tillsynen av dammsäkerhet är otillräcklig
  • Dammarna måste ha tillräckliga säkerhetsmarginaler för tänkbara händelser och påfrestningar
  • Verksamhetsutövarnas egenkontroll förutsätter ansvarsfull förvaltning och relevant kompetens

Diagram 7.1 redovisar nuläget och några av de utmaningar som dammsäkerheten står inför.

7.1.1. Samhället är mer säkerhetsmedvetet och ställer höga krav på säkerheten

Arbetet med samhällets säkerhet utvecklas och får ökad uppmärksamhet, såväl nationellt som inom EU och internationellt. Riksdagen har slagit fast att målet för arbetet med att successivt utveckla samhällets säkerhet syftar till att värna befolkningens liv och hälsa samt samhällets grundläggande värden och funktionalitet. Regeringens mål för säkerhet är1:

  • att värna befolkningens liv och hälsa,
  • att värna samhällets funktionalitet och
  • att värna vår förmåga att upprätthålla våra grundläggande värden som demokrati, rättsäkerhet och mänskliga fri- och rättigheter.

Samhällsutvecklingen har medfört att tekniska och ekonomiska system fått allt större betydelse för det moderna samhällets funktionalitet i stort. Samtidigt har olika verksamheter blivit allt mer sammanflätade och beroende av varandra. Ett omfattande och lång-

1Prop. 2008/09:140.

Yttre "nya" laster/hot - Klimatförändringar - Antagonistiska hot

Yttre kända laster/hot

Genomförande av projekt

Nytta: Elproduktion och gruvdrift m.m.

Risk: Dammbrott med allvarliga konsekvenser

Dammägaren - kompetensförsörjning - resurser/prioriteringar - systemanalys, riskanalyser - människa-teknik-organisation

Ändrade förutsättningar/krav

Tillsynsmyndigheten - kompetensförsörjning - resurser/prioriteringar

Omvärlden - För liknande verksamheter med risker finns bindande specifika regelverk, vilket saknas för dammsäkerhet för vattenkraftdammar

- Flera andra länder med stora dammar har centrala myndigheter med ansvar för tillsyn och normering av dammsäkerheten

Inre laster/hot - Materialval - Design/Konstruktion - Grundläggning - Åldringsprocesser - Blandning av gammalt och nytt - Övervakning

Samhället - Ökad säkerhetsmedvetenhet, risker ställs samman och analyseras, krav på säkerhet ökar

- Sverige är beroende av elproduktion från vattenkraft för lång tid framöver

- Dammar är en förutsättning för elproduktion från vattenkraft samt för gruvdrift

- Vattenkraftverk med dammar innebär både nytta och risk för samhället

- Ett dammbrott kan innebära svår påfrestning på samhället

varigt elavbrott skulle t.ex. medföra närmast oöverblickbara konsekvenser genom störningar och uteblivna funktioner på en rad samhällsviktiga områden. Vattenkraftdammar dämmer inte bara upp vatten för kraftproduktion utan de är i många fall även broar för allmän trafik.

Energiproduktionen har identifierats som en samhällsviktig verksamhet i landet. Dammar är en förutsättning för att vattenkraftverk ska kunna producera el. Samhällsviktiga system behöver byggas, underhållas och drivas på ett robust och motståndskraftigt sätt. Sårbarheter i systemen kan dock inte helt förebyggas eller byggas bort, varför även en god beredskap för att hantera störningar, allvarliga olyckor och kriser behöver finnas.

Inom EU pågår en process för att utröna vilka risker som finns. Varje medlemsland ska göra en nationell riskbedömning där de allvarligaste riskerna för samhället sammanställs. MSB har genomfört en första nationell riskbedömning2. Dammbrott är en av 24 identifierade risker i Sverige. Avbrott i elförsörjningen, översvämningar samt ras och sked är några andra relaterade risker som identifierats. På några års sikt ska riskerna dessutom bedömas och planer för att minimera och hantera riskerna tas fram. Detta kan leda till omprioritering av samhällets resurser för riskhantering.

  • För dammar med särskilt stora konsekvenser i händelse av dammbrott är det av nationellt intresse att hålla säkerheten på en mycket hög nivå.

7.1.2. Dammar medför både nytta och risk för samhället

Dammar medför en stor nytta till samhället. Nyttan är främst i form av vattenkraft för elproduktion men även gruvdrift och andra verksamheter är beroende av dammar. Kanaldammar och slussar är viktiga för sjöfarten. Skyddsvallar utestänger vatten och invallningar torrlägger marker för bebyggelse och jordbruk.

Utbyggnaden av vattenkraften har möjliggjort elektrifieringen av landet. De flesta av de stora vattenkraftverken byggdes under 1950-, 1960- och 1970-talen. Dammar har därigenom bidragit till utvecklingen av ett modernt samhälle. Vattenkraften är viktig för elproduktionen i Sverige i dag. Vattenkraft har använts för elproduktion i över 100 år och är fortfarande den viktigaste energikällan

2 Ett första steg mot en nationell riskbedömning, MSB, 336-2011.

för förnybar elproduktion i Sverige. Det finns drygt 200 vattenkraftverk med en installerad effekt av 10 MW eller mer. Tillsammans producerar vattenkraftverken ungefär 45 procent av den el vi använder i landet. Genom att vatten kan sparas i magasinen ger vattenkraft både baskraft och reglerkraft. Den svenska elproduktionen består av en mix av kraftslagen vattenkraft, kärnkraft, kraftvärme och vindkraft.

Gruvindustrin är en av Sveriges viktigaste industrier. Dammar för deponering av anrikningssand är ofta en förutsättning för gruvdriften. Tillgången till el från vattenkraft och kärnkraft är en viktig förutsättning för gruvindustrin. Dammbrott med allvarliga konsekvenser har skett vid gruvdammar både i Sverige, Europa och övriga världen de senaste decennierna. Det har bland annat lett till EG:s direktiv om hantering av avfall från utvinningsindustrin (2006/21/EG) som implementeras genom utvinningsavfallsförordningen i Sverige 2008. I den förordningen skärps kraven på egenkontroll för gruvdammar och andra berörda anläggningar.

Att stora mängder vatten däms upp i magasinen innebär inte bara en tillgång utan utgör även en risk för samhället. Om en damm som dämmer upp vatten i ett magasin havererar frigörs det uppdämda vattnet vilket kan få svåra konsekvenser till följd. Översvämningsområdets utbredning är beroende av nedströmsområdets topografi, den frisläppta vattenvolymen och dammbrottsöppningen. Konsekvenserna av haveriet beror på översvämningsområdets beskaffenhet, dvs. om området är tät- eller glesbefolkat, om samhällsviktig infrastruktur eller kultur- och miljövärden påverkas m.m. Dammbrottssimuleringar görs för ta reda på vilka områden som skulle bli översvämmade, när vattnet börjar stiga, vilken hastighet vattnet skulle ha samt hur länge områden blir översvämmade. Det pågår arbeten med att genomföra simuleringar av dammbrott i de stora vattenkraftälvarna med syftet att använda resultatet som underlag för beredskapsplaneringen för dammbrott.

Ett dammbrott i en av de största dammarna belägna långt upp i någon av de reglerade älvarna skulle medföra konsekvenser längs hela älvdalen och innebära svåra påfrestningar för samhället både i den akuta fasen och flera år framöver. Med tanke på de katastrofala konsekvenserna ett sådant dammbrott skulle få är det av största vikt för samhället att det inte inträffar.

Att omgående nå ut till och varna allmänheten i områden som inom kort kommer att påverkas av flodvågen om ett dammbrott sker är av yttersta vikt för att minimera konsekvenserna. I dags-

läget är det endast möjligt att varna befolkningen i större samhällen genom kommunernas sirener samt genom Viktigt Meddelande till Allmänheten (VMA) via radio och TV.

  • Att dammarna är säkra är en viktig faktor för att allmänheten ska ha förtroende för vattenkraften och gruvdriften
  • Att konsekvenserna av dammbrott kan bli mycket omfattande ställer krav på att såväl så långt möjligt förebygga dammbrott, som på samhällets beredskap för dammbrott.

7.1.3. Ett specifikt och samlat regelverk för dammsäkerhet finns inte i Sverige

Det finns inte någon särskild lag om dammsäkerhet i Sverige. Dammsäkerheten regleras i flera regelverk där MB och LSO är de två viktigaste. Reglernas innebörd är att verksamhetsutövare är skyldiga att skaffa den kunskap som behövs, undersöka och bedöma riskerna med verksamheten från hälso- och miljösynpunkt, utarbeta och följa rutiner för egenkontroll samt i övrigt vidta erforderliga åtgärder och ha beredskap för att undvika skador.

MB:s allmänna hänsynsregler och reglerna för egenkontroll gäller för alla typer av verksamheter. Regelverkets karaktär innebär dock att det ges ett stort tolkningsutrymme och att mer precis vägledning för dammsäkerhetsarbetet saknas.

Den som är underhållsansvarig för en damm – i regel ägaren – är skyldig att underhålla dammen. Om ett dammbrott ändå skulle inträffa är ägaren strikt ansvarig för de skador som uppstår till följd av dammbrottet. Det strikta ansvaret omfattar dammar för vattenreglering, inte dammar för andra verksamheter, exempelvis gruvindustrin.

Kraft- och gruvindustrin har utarbetat branschriktlinjer för dammsäkerhet som har kommit att utgöra ett system för egenkontrollen. Riktlinjerna har haft stor betydelse som stöd för att utveckla dammsäkerheten och bidrar till dammägarnas kontinuerligt arbete med dammsäkerhet. De fungerar även som drivkraft och stöd för investeringar för förstärkningar och vidmakthållande åtgärder som görs av dammägarna. Det bör understrykas att riktlinjerna inte är att betrakta som rättsligt bindande; de är branschernas tolkning av gällande regleringar.

Sverige har hittills varit förskonat från dammbrott med exceptionella konsekvenser. Under hösten 2010 inträffade dock två dammbrott i södra Sverige som hade kunnat leda till allvarliga konsekvenser. I andra länder har inträffade dammbrott som orsakat stora skador med bl.a. många dödsoffer lett till att allmänhetens och politikernas syn på de risker som dammar medför snabbt har förändras från relativ omedvetenhet till medvetenhet. Detta har i sin tur lett till förstärkta statliga insatser för kontroll av dammsäkerheten genom t.ex. införande av särskilda regelverk för dammsäkerhet. Andra länder, inom EU-området och internationellt, med dammar där dammbrott skulle innebära risk för människoliv, har tydliga regelverk för dammsäkerheten. Ofta omfattas dammarna av landets vattenlag eller motsvarande och därtill finns en förordning med specifika dammsäkerhetskrav. De flesta länder har obligatorisk klassificering av dammarna utgående från dammarnas höjd eller potentiella konsekvenser vid dammbrott. I andra länder regleras dammar ur ett säkerhetsperspektiv, i Sverige rör det sig snarare om ett miljöperspektiv.

Omstruktureringen och internationaliseringen inom kraftindustrin har medfört att en stor del av dammanläggningarna i Sverige ägs av koncerner som är verksamma i flertal länder. Systemen för dammsäkerhet bygger i flera europeiska länder på en mer aktiv myndighetsutövning baserad på särskild dammsäkerhetslagstiftning och detaljerade myndighetsföreskrifter. Ledningen för koncerner med hemvist i andra länder kan uppleva de svenska kraven som otydliga med åtföljande risk för att ansvaret för egenkontroll inte tas fullt ut.

Tydliga regelverk för andra typer av verksamheter som är jämförbara med verksamheten vid vattenkraftdammar finns i Sverige i dag. Exempelvis utvinningsavfallsförordningen (avsnitt 3.10) Sevesolagen (avsnitt 4.2.2) samt lagen om kärnteknisk verksamhet och strålskyddslagen (avsnitt 4.2.1).

  • Utan ett tydligt och samlat regelverk för dammsäkerhet är det svårt för tillsynsmyndigheten att ställa krav på verksamhetsutövarna och även svårt för verksamhetsutövarna att veta vad som krävs.
  • Att ett tydligt och samlat regelverk för dammsäkerhet saknas kan dessutom bidra till att tillsynen ges låg prioritet.

7.1.4. Tillsynen av dammsäkerheten är otillräcklig

Länsstyrelserna är tillsynsmyndighet för vattenverksamheter enligt MB och häri ingår dammsäkerhet. Länsstyrelserna är därmed de myndigheter som utövar den operativa tillsynen direkt gentemot verksamhetsutövarna. Tillsynen omfattar kontroll av att gällande regler efterlevs, åtgärder för att åstadkomma rättelse, bedömning av om villkoren för tillståndsgivna vattenverksamheter är tillräckliga samt rådgivning och information till verksamhetsutövarna.

Dammsäkerheten ingår som en ospecificerad del i vattenverksamheten i länsstyrelsens tillsynsplaner. Dammsäkerhetstillsynen hanteras oftast av vattenhandläggare, utan erfarenhet av dammsäkerhetsarbete från tidigare anställningar. Länsstyrelserna har begränsade resurser för tillsyn av vattenverksamheter. Ingen eller mycket liten tid används för egeninitierad tillsyn av dammsäkerhet. Tillsyn av dammsäkerheten består i huvudsak av insamling och genomgång av dammägarnas årsrapporter samt i varierande grad av uppföljande muntliga och skriftliga kontakter.

Länsstyrelsernas handläggning av inkommande vattenärenden, klagomål etc. samt bevakning av och medverkan vid tillståndsprövningar i mark- och miljödomstolen prioriteras i dag. Detta medför mindre tid för tillsynen över dammsäkerheten.

Andra länder med stora dammar har i de flesta fall en central, nationell dammsäkerhetsmyndighet som har dammsäkerhet som sin huvuduppgift. Dammsäkerhetsmyndigheternas arbetsuppgifter variera något men omfattar oftast upprättande av föreskrifter och anvisningar, tillsynsbesök samt granskningar baserat på dammägarnas rapportering till myndigheten.

  • En ändamålsenlig tillsyn är en viktig komponent i det svenska systemet för dammsäkerhet. Det förutsätter en förstärkning av både kompetens och resurser. Dammsäkerhetstillsynen måste prioriteras.
  • För dammar med särskilt stora konsekvenser i händelse av dammbrott är det av nationellt intresse att hålla säkerheten på en mycket hög nivå. En kvalificerad tillsyn av dammsäkerheten för dammar i denna kategori bör innefatta såväl anläggningsgranskning som granskning av ägarföretagens säkerhetsledningssystem och rutiner för egenkontroll.

7.1.5. Dammarna måste ha tillräckliga säkerhetsmarginaler för tänkbara händelser och påfrestningar

Flera tusentals av dammarna i Sverige är små och konsekvenserna av ett dammbrott skulle bli obetydliga ur ett samhällsperspektiv. För en dammägare innebär dock ett dammbrott att verksamheten slås ut under lång tid. Det leder till att ägaren så långt rimligt minimerar sannolikheten för dammbrott.

Vid drygt 500 dammanläggningar skulle ett dammbrott medföra samhällskonsekvenser. Samhällets säkerhetskrav för dessa dammar bör vara större än för de mindre dammarna.

Majoriteten av de stora dammarna i Sverige är vattenkraftdammar. Dammarna är belägna i de reglerade älvarna och är nu 50– 100 år gamla. Dammarna har två huvudsakliga funktioner, att dämma upp vatten i magasinet och att släppa vatten förbi dammen när det finns behov av det. Utskovsluckorna manövreras sällan men när de ska manövreras är det av största vikt att de fungerar. Utskovens styr- och reglersystem är därför viktiga tekniska delsystem i en dammanläggning. Möjligheten för verksamhetsutövarna att övervaka dammens olika funktioner via fjärrsystem blir viktigare när den mänskliga närvaron vid dammarna minskar.

Dammanläggningens tekniska system åldras och har olika livslängd samtidigt som krav på teknisk prestanda och säkerhet höjs. Dammar kan ha olika inbyggda svagheter som måste åtgärdas, exempelvis återkommande sjunkhål eller en utskovslucka som drar snett. Den verkliga avbördningskapaciteten vid en damm kanske inte motsvarar det beräknade dimensionerande flödet för dammanläggningen. Detta leder till att verksamhetsutövare planerar och genomför stora upprustningsprojekt med syftet att stärka och vidmakthålla anläggningarna. Att genomföra ett projekt medför en förhöjd risk för dammbrott. Exempelvis innebär upprustningsprojekt på utskoven att hela eller delar av avbördningskapaciteten inte är tillgänglig under byggtiden. En annan risk är att dammen blir en byggplats där långt fler personer vistas än normalt. Innan personer ges tillstånd att arbeta på eller vid anläggningen bör säkerhetskontroller och utbildning om dammsäkerhet genomföras.

  • Dammar blir äldre samtidigt som nya laster måste analyseras och kraven på säkerhet och tillförlitlighet ökar. Upprustningsprojekt genomförs för att förstärka och vidmakthålla anläggningarna.

7.1.6. Verksamhetsutövarnas egenkontroll förutsätter ansvarsfull förvaltning och relevant kompetens

Ägandet av dammarna i Sverige är fördelat på ett flertal ägare, från internationella storföretag till kommuner och privatpersoner. De drygt 500 dammanläggningarna som skulle medföra konsekvenser för samhället i händelse av ett dammbrott ägs till största delen av stora energiföretag. De sex största ägarna äger tillsammans cirka 75 procent av dessa dammanläggningar. Utöver dessa innehar ytterligare omkring 60 ägare dammanläggningar som skulle medföra konsekvenser för samhället. Många ägare är medlemmar i branschorganisationerna Svensk Energi eller SveMin, men långt ifrån alla.

Verksamhetsutövarna i kraft- och gruvindustrin arbetar med dammsäkerheten vid anläggningarna baserat på de egenframtagna riktlinjerna. Verksamhetsutövare som inte är medlemmar i branschorganisationerna använder inte nödvändigtvis riktlinjerna i sitt dammsäkerhetsarbete.

På uppmaning av länsstyrelserna rapporterar verksamhetsutövare årligen om dammsäkerheten vid anläggningarna till tillsynsmyndigheten enligt en upprättad rutin. Rapporteringen är en basrapportering som är tänkt att vara ett underlag för myndigheternas tillsyn. Rapporteringen är kortfattad och ger en översiktlig bild av egenkontroll, svagheter och åtgärdsbehov, men saknar detaljer.

Företagens personal har till uppgift att förvalta befintliga anläggningar. Förvaltningen handlar om att upptäcka när dammens säkerhetsmarginaler inte är tillräckliga och genomföra åtgärder i tid. Förvaltningen handlar inte bara om att upprätthålla dammarnas tekniska prestanda utan det blir mer och mer fokus på dammanläggningen som ett system, där också organisationen och människan spelar en roll. Därför är systemperspektiv en viktig kompetens. Riskanalyser genomförs i ökande omfattning, i olika skeden och med olika syften.

För ägarna är det av stor vikt att känna till de laster som kan påverka dammarna, hur dammarna reagerar då de utsätts för laster samt de konsekvenser ett dammbrott skulle medföra. Speciell vikt bör läggas på sådan typ av laster som kan förändras över tiden. Exempel på faktorer som kan påverka dammarna är klimatförändringar. Eftersom dammarna har en lång livslängd är det viktigt att tänka långsiktigt vid upprustningar av dammarna.

Klimatförändringar kan innebära förändringar i nederbörd och temperaturer vilket påverkar vattenflödena. En annan typ av påverkan som verksamhetsutövarna måste uppmärksamma och hantera är antagonistiska hot.

För ägarföretagen är det en utmaning att finna personer med djupgående dammsäkerhetskompetens både att anställa och att anlita som konsulter och entreprenörer. Det har byggts få nya dammar de senaste decennierna vilket innebär att färre personer med djupgående erfarenhet av dammdesign och -konstruktion finns att tillgå. Erfarna dammingenjörer går i pension. Nya dammingenjörer och doktorander utbildas genom gemensamma satsningar mellan högskola, industri och myndigheter, som exempelvis SVC. Under en längre tid har det varit en liten efterfrågan på dammingenjörer vilket har lett till att relativt få utbildade sig till det och många som gjorde det valde andra yrken. Detta har lett till ett glapp mellan äldre och yngre ingenjörer.

Den operativa personalstyrkan som arbetar vid anläggningarna är dimensionerad efter normala förhållanden. Vid långvariga höga flöden eller vid ansträngda situationer kan det finnas behov av att kalla in ytterligare personal vilket måste planeras i förväg.

  • Djupgående dammsäkerhetskompetens är en förutsättning för en ansvarsfull förvaltning av dammanläggningarna.
  • Systemanalys och riskanalys är områden där mer kompetens behövs och ett utvecklingsbehov finns.

8. Klassificeringssystem och styrande principer

8.1. Begrepp som används i betänkandet

Detta kapitel inleds med en kort redogörelse över begrepp som används i betänkandets överväganden och förslag.

8.1.1. Dammägare, verksamhetsutövare eller underhållsskyldig

Med underhållsskyldig avses den fysiska eller juridiska person som enligt 11 kap. 17 MB har ett ansvar att underhålla en vattenanläggning. Utpekande av den underhållsskyldige såsom ansvarig skiljer sig från hur det i övrigt är reglerat i MB angående ansvar för vidtagande av åtgärder. I andra kapitel i balken används istället begreppen verksamhetsutövare och den som bedriver verksamheten eller vidtar en åtgärd. Det finns således ingen särskild för hela balken gällande definition av det subjekt mot vilket krav enligt balken kan ställas. Utredningen bedömer att det är lämpligt att även fortsättningsvis använda uttrycket den som är skyldig att underhålla i fråga om adressaten för de krav som föreslås i betänkandet. Den fysiska och juridiska person som avses med uttrycket överensstämmer enligt utredningen med den som har den faktiska och rättsliga möjligheten att efterkomma de åtgärder som krävs enligt utredningens förslag. Utredningen menar att man i fråga om dammar kan använda begreppen underhållsskyldig synonymt med verksamhetsutövare. I dagligt tal används ofta dammägare eller ägare. Utredningen har därför valt att i löpande text använda begreppen underhållsskyldig, verksamhetsutövare och dammägare synonymt med varandra.

8.1.2. Dammar som tillsammans innehåller en vattenvolym utgör en dammanläggning

En damm är en vattenanläggning vars syfte är att innehålla eller utestänga vatten eller en blandning av vatten och annat material. En damm kan även benämnas dammkropp, dammkonstruktion eller dammenhet. Utredningen har valt att använda ordet damm.

Ibland innesluts en vattenvolym i ett magasin av flera dammar. I betänkandet används begreppet dammanläggning som samlingsnamn för den eller de dammar som innehåller eller utestänger en och samma vattenvolym. Om det bara är en damm som innesluter magasinet så benämns även den dammen dammanläggning, se diagram 8.1.

Inom både vattenkraft- och gruvindustrin är dammanläggning ett välkänt begrepp. Exempelvis upprättande av dokument inom ramen för egenkontroll samt rapportering görs per dammanläggning. Även tillsynen utövas av tillsynsmyndigheten över dammanläggningen i sin helhet. I betänkandet används därför dessa begrepp på det sätt som nu redogjorts för.

8.1.3. Dammbrott, dammhaveri och frisläppt vattenvolym

En damm ska upprätthålla en dämmande och en avbördande funktion. Det senare gäller enbart dammar med en avbördningsanordning. Om någon av dessa funktioner inte fungerar och detta leder till ett genombrott i dammen med okontrollerat utströmmande av vatten eller blandning av vatten och annat material utgör

Damm Z

Damm X

Damm Y

Dammanläggning YY

Damm X

Dammanläggning XX

det ett dammhaveri. I betänkandet har ordet dammbrott använts synonymt med dammhaveri.

Ett dammhaveri föreligger både om dammen hastigt havererar eller om den eroderas successivt. Även när ett genombrott i dammen på grund av felmanövrering leder till okontrollerad utströmning föreligger ett dammhaveri. Dammhaveri föreligger däremot inte när dammen fullgör sin dämmande och avbördande funktion men vattnet ändå strömmar över den.

Ett dammhaveris konsekvenser beror till stor del på den mängd vatten som frisläpps från magasinet i händelse av ett dammhaveri, dvs. det vatten som okontrollerat strömmar ut ur magasinet.

8.1.4. Dammsäkerhet

Som redan nämnts finns ingen definition av vad dammsäkerhet är i vare sig MB eller tillhörande författningar. För att tydliggöra vad dammsäkerhet är anser utredningen att begreppet ska definieras i 11 kap. MB. En sådan definition underlättar för såväl dammsäkerhetstillsynen som ägarens rutiner för egenkontroll och rapportering.

Som nämnts i avsnitt 2.3 är följande tre faktorer viktiga för en god dammsäkerhet:

  • Säker dammkonstruktion
  • Säkert handhavande (drift och tillståndskontroll)
  • Beredskap för dammbrott och allvarliga problem

Utredningen anser att en definition av dammsäkerhet måste innehålla dessa tre komponenter och menar att dammsäkerhet kan definieras som ”dammens egenskaper och de åtgärder som vid drift och underhåll av dammen vidtas för att förhindra ett dammhaveri och för att begränsa skador till följd av ett sådant haveri”.

Dammens egenskaper omfattar de inneboende egenskaperna hos en damm, dammens aktuella säkerhetstillstånd och -status. Egenskaperna är beroende av dammens design, konstruktion, historik och drifterfarenheter, m.m.

De åtgärder som vid drift och underhåll av dammen vidtas för att förhindra ett dammhaveri omfattar den tillståndskontroll, övervakning och skötsel samt de underhållsåtgärder som genomförs på dammen. Här inkluderas även djupgående utredningar och analyser

avseende säkerhetsstatus samt upprustningsprojekt för att stärka och vidmakthålla dammen.

De åtgärder som vidtas för att begränsa skador till följd av ett dammhaveri omfattar den beredskapsplanering som genomförs för att förhindra att dammhaveri sker men även att minimera konsekvenserna av ett dammhaveri.

För att en dammanläggning ska vara säker ska dammanläggningens dämmande och avbördande funktioner vara rätt dimensionerade och fungera vid alla tänkbara driftförhållanden. För att säkerställa detta krävs planering av dammsäkerhetsverksamheten, planering och genomförande av tillståndskontrollåtgärder för att upptäcka brister samt åtgärdande av brister som upptäcks.

8.2. Styrande dammsäkerhetsprinciper

Utredningens förslag: Styrande principer ska utgöra en grund

för det klassificeringssystem och regelverk för egenkontroll som utredningen föreslår. Följande styrande principer bör gälla för dammar där dammbrott kan orsaka konsekvenser för samhället, dvs. mer än små lokala konsekvenser:

  • Sannolikheten för dammbrott ska hållas på lägsta rimliga nivå med hänsyn till föreliggande kunskaper och tillgänglig teknik.
  • Konsekvenserna av dammbrott ska så långt möjligt reduceras eller förhindras.

De styrande principerna för dammsäkerhetsarbetet ska utgöra grunden för den kravställning som ska gälla avseende dammarnas utformning, dammägarnas dammsäkerhetsarbete, tillsynsmyndighetens dammsäkerhetstillsyn samt samhällets beredskap för dammbrott.

Om ett dammbrott inträffar kan det medföra konsekvenser av olika art och omfattning för samhället och omgivningen. För de dammar där ett dammbrott kan få konsekvenser för samhället är det enligt utredningen motiverat och rimligt att ställa högre krav på tillsynsmyndighetens insyn och dammägarens säkerhetsarbete än för de dammar där konsekvenserna av ett dammbrott inte skulle bli

lika omfattande. För att kunna differentiera kraven på såväl myndighetstillsyn som dammägarens säkerhetsarbete och dammars säkerhet behövs ett rättsligt reglerat klassificeringssystem som kan användas för alla dammar i landet. Som grund för klassificeringssystemet och regelverket för egenkontroll och tillsyn behövs enligt utredningen styrande principer för dammsäkerhetsarbetet. Principerna är en uttolkning av samhällets mål och MB:s krav på verksamhet som kan medföra skada eller olägenhet för människors hälsa, miljö eller skada för enskilda eller allmänna intressen.

Med stöd av de styrande principerna kan krav på dammarna, dammsäkerhetsarbetet och tillsynen över dem differentieras. För att möjliggöra en differentiering behövs ett klassificeringssystem som också har sin utgångspunkt i de styrande principerna.

Styrande principer behövs som stöd för tillsynsmyndighet och verksamhetsutövare i deras planering av verksamheten. Tillsynsmyndigheten kan ta hjälp av de styrande principerna för sin planering och prioritering av dammsäkerhetstillsynen. För dammanläggningar med stora konsekvenser i händelse av dammbrott är det motiverat med mer resurser och dammsäkerhetskompetens än för dammanläggningar med mindre konsekvenser. Likaså bör en dammägare som äger dammar som kan medföra konsekvenser för samhället prioritera dammsäkerhetsarbetet vid dammarna utifrån de styrande principerna.

8.2.1. Styrande principer för dammar grundade på dammbrottskonsekvenser

Följande styrande principer bör gälla för dammar där dammbrott kan orsaka konsekvenser för samhället, dvs. mer än små lokala konsekvenser:

  • Sannolikheten för dammbrott ska hållas på lägsta rimliga nivå med hänsyn till föreliggande kunskaper och tillgänglig teknik.
  • Konsekvenserna av dammbrott ska så långt möjligt reduceras eller förhindras. Beroende på de konsekvenser som ett dammbrott skulle kunna förorsaka ska principerna tillämpas olika. Vad som är lägsta rimliga nivå respektive så långt som möjligt skiljer sig åt beroende på vilka konsekvenser ett dammbrott kan medföra. Utredningen anser att

principerna i förhållande till dammbrottets konsekvenser ska tilllämpas på följande sätt.

Dammar som kan orsaka samhällskris

Med kris menas en händelse som drabbar många människor och stora delar av samhället och hotar grundläggande värden och funktioner. Om ett dammbrott i en damm kan orsaka en kris finns det nästan inga resurser som är för stora för att förhindra att ett dammbrott sker. Konsekvenserna vid ett dammbrott skulle bli så omfattande att det så gott som alltid är motiverat och rimligt att vidta alla tänkbara åtgärder för att förhindra brott. Nyttan av en skyddsåtgärd och andra försiktighetsmått överstiger praktiskt taget alltid kostnaden för åtgärden. Det gäller även beredskapsåtgärder. Utrymmet för att mildra kraven på dammägaren i den rimlighetsavvägning som ska göras med stöd av 2 kap. 7 § MB är således mycket litet. Dammsäkerheten ska hålla en hög internationell nivå för jämförbara dammar.

Dammar som kan orsaka långvariga störningar eller stora regionala konsekvenser

För dammar där dammbrott kan orsaka långvariga störningar eller stora regionala konsekvenser är utrymmet för mildare krav på dammägaren i rimlighetsavvägningen aningen större än för dammar som kan orsaka en kris. En mycket kostsam säkerhetsåtgärd kan i vissa fall inte anses rimlig. Vid bedömningen av hur långtgående dammbrottsförebyggande åtgärder som är rimliga får begränsning av skador genom samordnad beredskapsplanering beaktas, t.ex. planer som säkerställer evakuering av människor från ett översvämningsområde. Även för dessa dammar ska dammsäkerheten hålla en hög internationell nivå för jämförbara dammar.

Dammar som kan orsaka tillfälliga störningar eller lokala konsekvenser

För dammar vars dammbrott kan orsaka tillfälliga störningar eller lokala konsekvenser ska en minsta acceptabel säkerhetsnivå alltid uppfyllas. För att klara mer ovanliga laster och förhållanden ska en

sådan damm även ha en höjd säkerhetsnivå för det fall det inte kan anses orimligt. Kostnader för ytterligare säkerhetsåtgärder vägs då mot kostnader för potentiella skador p.g.a. dammbrott vid mer ovanliga laster eller förhållanden.

8.3. Utformningen av ett klassificeringssystem

Utredningens förslag: Dammar som vid ett dammbrott kan

orsaka konsekvenser för samhället ska klassificeras enligt ett klassificeringssystem för dammsäkerhet. Syftet med dammsäkerhetsklassificeringen är att identifiera dessa dammar samt möjliggöra att särskilda dammsäkerhetskrav ställs på dammägarens egenkontroll och rapportering. Systemet ska innehålla tre dammsäkerhetsklasser, A till C, där dammar i klass A är de dammar som bedöms ha störst konsekvenser vid ett dammbrott. Dammar där dammbrott inte bedöms ha mer än små lokala konsekvenser ska tillhöra kategorin övriga dammar.

Klassificeringen ska utgå från en konsekvensutredning som ger en beskrivning av de konsekvenser på omgivningen som ett dammbrott vid en dammanläggning kan förväntas medföra. Med konsekvenser innefattas bl.a. fara för förlust av människoliv, förstörelse av bostäder, kulturmiljö och byggnader, förstörelse av samhällsviktig infrastruktur eller störningar på samhällsviktiga funktioner såsom elförsörjningen, dammanläggningar, vatten- och avloppsanläggningar, broar, vägar, järnvägar, telekommunikation m.m., miljöskada och ekonomisk skada.

Dammägaren ansvarar för att upprätta konsekvensutredningen och ska utifrån denna lämna förslag till tillsynsmyndigheten om vilken klass dammen anses tillhöra. Tillsynsmyndigheten fattar därefter beslut om dammsäkerhetsklass i samråd med den centrala myndighetsfunktionen för dammsäkerhet. Beslutet ska endast kunna överklagas av ägaren. Om en damm tillhör kategorin övrig damm fattar inte tillsynsmyndigheten något beslut om detta.

Svenska kraftnät ska bemyndigas att meddela föreskrifter om innehållet i samt omfattning och dokumentation av konsekvensutredningarna.

8.3.1. Bedömning av ett dammbrotts konsekvenser

Som redan angetts i avsnitt 8.2 kan ett dammbrott medföra olika konsekvenser. Det är de sammanlagda konsekvenserna som ett dammbrott skulle kunna medföra som ska ligga till grund för bedömningen av hur de styrande principerna ska uttolkas. Denna uttolkning ligger även till grund för det klassificeringssystem som utredningen föreslår i 8.3.3.

Det är inte möjligt att exakt förutse och beskriva hur ett dammbrott kan ske, hur flodvågen följer terrängen nedströms, vilka områden som skulle bli översvämmade eller vilka konsekvenser på omgivningen det skulle få. Med dagens beräkningsmetoder kan emellertid uppskattningar göras av dammbrottets utveckling och flodvågens utbredning. Man kan göra ungefärliga bedömningar av vilka områden som skulle översvämmas. Dessa beräkningsmetoder förutsätter rent vatten i flodvågen och en konstant terräng, dvs. att vattnet inte drar med sig drivgods eller att erosion sker. Om ett dammbrott sker är det troligt att vattnet både drar med sig drivgods och att erosion sker som förändrar terrängen. Det går inte heller att exakt förutse vilka effekter och skador på omgivningen som kan uppstå till följd av flodvågens framfart. Man kan dock kartlägga vad som finns i det område som enligt beräkningarna kommer att översvämmas och göra en grov bedömning av vilka effekter ett dammbrott kan få för dessa.

En konsekvensutredning ska ligga till grund för beslutet om dammsäkerhetsklass. I grova drag menar utredningen att ägaren i en konsekvensutredning ska beskriva följande:

1. en beskrivning av hur dammen antas haverera. Ett haveri kan

antas ske olika utifrån dammens egenskaper och konstruktion. Det påverkas bl.a. av tidsförloppet och hastigheten på det utströmmande vattnet. T.ex. havererar en betongdamm på ett annat sätt än en fyllningsdamm.

2. en kartläggning av det område som kan antas komma att över-

svämmas av flodvågen.

3. en kartläggning av de objekt som finns i det område som skulle

översvämmas och en grov bedömning av konsekvenserna för dessa.

Anledning finns att återkomma mer detaljerat till konsekvensutredningens innehåll, se avsnitt 8.4.4.

I vissa fall kan dammägaren behöva samråda med andra aktörer såsom länsstyrelser och kommuner för att få en övergripande bild av konsekvenserna. Länsstyrelser och kommuner bör ha en uppfattning om vad som kan tänkas skadas i det område som kan komma att översvämmas.

8.3.2. Vilka konsekvenser ska bedömas?

Utredningen har bedömt att det är lämpligt att klassificera dammarna efter vilka konsekvenser ett dammbrott kan förorsaka på omgivningen. I avsnitt 8.3.4 görs en jämförelse mellan alternativa sätt att klassificera dammar.

Det går inte att lämna en uttömmande uppräkning av de följder som kan uppstå av ett dammbrott och som därmed ska läggas till grund för bedömningen av konsekvenser. Utredningen har nedan redogjort för de konsekvenser på omgivningen som kan uppstå och hur de bör bedömas. Med konsekvenser på omgivningen avses bl.a.:

  • Förlust av människoliv
  • Förstörelse av bostäder, kulturmiljö och byggnader
  • Förstörelse av eller störningar på samhällsviktiga funktioner och infrastruktur såsom elförsörjningen, dammanläggningar, vatten- och avloppsanläggningar, broar, vägar, järnvägar, telekommunikation etc.
  • Miljöskada
  • Ekonomisk skada

Det ska i varje enskilt fall göras en för den dammen specifik bedömning om vad som kan komma att skadas vid ett dammbrott.

Förlust av människoliv samt förstörelse av eller störningar på samhällsviktiga funktioner och infrastruktur blir ofta utslagsgivande vid bedömningen av vilken dammsäkerhetsklass som ska gälla.

Förlust av människoliv

Vid bedömningen om ett dammbrott kan medföra förlust av människoliv ska man utgå från huruvida människor normalt förväntas vistas i det aktuella område som kommer att beröras av översvämning. Området måste påverkas av översvämningen i en sådan omfattning att människor kan förväntas skadas av vattnets hastighet eller nivå. Är det fråga om bebyggda områden med bostadshus, arbetsplatser, andra byggnader eller samlingsplatser där människor normalt vistas föreligger det en risk för förlust av människoliv. Detsamma gäller för välbesökta friluftsområden där människor kan förväntas vistas mer frekvent. Är det däremot fråga om ett skogsområde där människor mer sällan uppehåller sig föreligger inte en sådan risk.

Förstörelse av bebyggelse, samhällsviktig verksamhet och kulturmiljö

Med kulturmiljö avses ett sådant område som är utpekat som riksintresse för kulturmiljövården enligt 3 kap. 6 § MB. Vid bedömningen av konsekvenserna på dessa områden ska man beakta hur omfattande skadorna kan komma att bli och om det är möjligt att återställa dessa. Går det att återställa skadorna ska bedömningen även avse hur lång tid det kan ta. Bedömningen ska också avse kostnaderna för ett återställande. Med byggnader avses bl.a. bostadshus, arbetsplatser och skolor m.m. Även för dessa ska omfattningen av skadorna bedömas samt kostnaderna för ett återställande beaktas.

Störning i elförsörjning kan uppstå på såväl nationell, regional som lokal nivå. En störning kan t.ex. avse brott på stam-, region- eller lokalnätet. Med infrastruktur avses väg- och järnvägsnät men också flygplatser. Samhällsviktig verksamhet utgörs av bl.a. sjukhus, vatten- och avloppsanläggningar samt telenätet. Bedömningen ska avse hur omfattande skadorna kan bli och hur lång tid det skulle ta att återställa det som skulle förstöras. Även kostnaden för återställandet bedöms. Förstörelse av eller störningar på samhällsviktiga funktioner och infrastruktur blir ofta utslagsgivande vid bedömningen om vilken dammsäkerhetsklass som ska gälla.

Miljöskada

Med miljöskada avses skador på skyddade arter och skyddade naturliga livsmiljöer eller andra skador på mark. Bedömningen ska avse om nyss nämnda skador kan uppstå i det område som antas kunna bli översvämmat eller beröras på annat sätt av ett dammbrott. Därefter måste bedömningar göras av skadornas omfattning, hur bestående skadorna skulle bli samt om det är möjligt att återställa området.

Allvarlig miljöskada definieras i 10 kap. 1 § MB och förordningen (2007:667) om allvarliga miljöskador. Utredningen bedömer att man kan använda begreppet allvarlig miljöskada såsom det definieras i dessa bestämmelser. För att en allvarlig miljöskada ska ha uppstått i vatten ska den ha en betydande negativ effekt på kvaliteten på vattenmiljön. En allvarlig miljöskada på den biologiska mångfalden utgörs av en skada som i en betydande omfattning skadar eller försvårar bevarandet av djur- eller växtarter eller livsmiljön för en sådan art. Den biologiska mångfalden som avses är avgränsad på sätt som anges i 10 kap. 1 § 3 a–c MB. Det avser bl.a. sådana områden som har pekats ut med stöd av de s.k. fågelskyddsdirektivet1 och art- och habitatsdirektivet2.

Ekonomisk skada

Med ekonomiska skador menas de indirekta konsekvenser som uppstår till följd av andra skador orsakade av ett dammbrott. Det kan t.ex. vara förlust av kraftproduktion när vattenkraftverk förstörs, produktions- och inkomstbortfall för industrier och att transporter förhindras till följd av förstörd infrastruktur.

8.3.3. Dammsäkerhetsklasser

Utredningen har bedömt att klassificeringssystemet ska innehålla tre dammsäkerhetsklasser A–C som korresponderar med de styrande principerna i avsnitt 8.2.1. I tabell 8.1 framgår utredningens förslag på dammsäkerhetsklasser.

1 Rådets direktiv 79/409/EEG av den 2 april 1979 om bevarande av vilda fåglar, senast ändrat genom direktiv 97/49/EG5. 2 Rådets direktiv 92/43/EEG av den 21 maj 1992 om bevarande av livsmiljöer samt vilda djur och växter, ändrat genom direktiv 97/62/EG7.

Dammsäkerhetsklass A

För att en damm ska klassificeras i dammsäkerhetsklass A ska konsekvenserna av ett dammbrott kunna leda till en kris. Vad som avses med kris redovisades kort i avsnittet om styrande principer, se avsnitt 8.2.1. Kris är ett tillstånd som inte kan hanteras med normala resurser och organisation. En kris är oväntad, utanför det vanliga och vardagliga. Att lösa krisen kräver samordnade åtgärder från flera aktörer. Definitionen överensstämmer med den som regeringen anger i regeringens skrivelse3.

Ett dammbrott i en damm i klass A skulle innebära en allvarlig påfrestning på samhället såväl nationellt som regionalt och lokalt. Om det är möjligt att återuppbygga förstörda funktioner och

3 2009/10:124 Samhällets krisberedskap – stärkt samverkan för ökad säkerhet.

byggnader skulle detta ta flera år och kostnaderna för detta vara många miljarder kronor.

Utströmningen av uppdämt vatten skulle medföra översvämningar längs större delen av älvens lopp med risk för bl.a.:

  • förlust av människoliv,
  • förstörelse av många människors hem och egendom, kulturmiljö och byggnader,
  • allvarliga störningar i landets elförsörjning p.g.a. skador på elnätet och förstörda dammanläggningar och vattenkraftstationer nedströms,
  • allvarliga störningar av transporter till följd av förstörda broar på älvsträckan och skador i övrigt på vägar och järnvägar,
  • omfattande förstörelse av infrastruktur och störningar i andra samhällsviktiga verksamheter, t.ex. anläggningar för vattenförsörjning samt radio- och telekommunikationer,
  • allvarliga miljöskador och
  • mycket stor ekonomisk skada.

Svenska kraftnäts bedömning är att cirka 25 dammanläggningar har dammar som skulle klassificeras i klass A. Det är i flertalet fall fråga om vattenkraftdammar belägna i den övre delen av de tio stora kraftverksälvarna. Ett dammbrott där skulle leda till dammbrott även i nedströms liggande dammar längs hela älvdalen. Dessa dammar bedöms ingå bland de dammar som är klassade i konsekvensklass 1A enligt RIDAS 2008, och fördelas över de sju länen Norrbotten, Västerbotten, Västernorrland, Jämtland, Dalarna, Värmland och Västra Götaland.

I RIDAS 2012 har klassificeringssystemet omarbetats och de dammar som i dagsläget tillhör det övre skiktet av 1A betecknas klass 1+. Denna nya klass bedöms praktiskt taget motsvara utredningens förslag på dammsäkerhetsklass A.

Dammsäkerhetsklass B

Ett dammbrott i en damm i klass B skulle kunna leda till stora lokala och regionala konsekvenser. Störningarna till följd av ett dammbrott i en damm i klass B kan förväntas bli långvariga. Skill-

naden mellan dammsäkerhetsklass A och B är att omfattningen av skadorna inte bedöms bli nationell. De konsekvenser som kan komma att uppstå vid ett dammbrott skulle således inte innebära en kris för samhället.

Föreligger risk för bl.a. följande konsekvenser ska dammen klassificeras i dammsäkerhetsklass B:

  • förlust av människoliv,
  • allvarlig störning eller skada på samhällsviktiga funktioner och infrastruktur,
  • allvarlig miljöskada och
  • stor ekonomisk skada.

Dammar i denna klass är i princip desamma som i dag omfattas av konsekvensklass 1A och 1B enligt RIDAS 2008 och av konsekvensklass 1 enligt RIDAS 2012. Antalet kända dammanläggningar med dammar som skulle höra till klass B uppgår till cirka 200.

Dammsäkerhetsklass C

Ett dammbrott i en damm i klass C skulle kunna leda till tillfälliga störningar med lokala konsekvenser, exempelvis skador på lokal infrastruktur, skador på egendom eller miljöskador. Ett dammbrott i denna klass antas inte typiskt sett leda till förlust av människoliv. Kan ett dammbrott i typisk mening befaras leda till förlust av människoliv ska dammen, oavsett övriga konsekvenser, alltid klassificeras i dammsäkerhetsklass A eller B.

Dammar i denna klass är i princip desamma som hänförs till konsekvensklass 2 enligt RIDAS 2008 och RIDAS 2012. Antalet kända dammanläggningar med dammar som skulle hamna i klass C uppgår till cirka 300.

Övriga dammar

För det stora antalet dammar i Sverige kommer ett dammbrott inte att medföra konsekvenser av den art och omfattning som beskrivs för dammsäkerhetsklasserna A, B eller C. Ett dammbrott i sådana dammar skulle endast medföra små lokala konsekvenser som kan återställas. Utredningen menar att det inte är motiverat att ställa

särskilda säkerhetskrav på dessa dammar och de ska därför inte tillhöra någon specifik dammsäkerhetsklass. För dessa dammar krävs inte någon särskild insyn för staten och inte heller någon mer omfattande tillsyn med avseende på dammsäkerhet.

8.3.4. Alternativa sätt att klassificera dammar

Utredningen har valt att föreslå ett konsekvensbaserat klassificeringssystem som betonar faran som ett dammbrott medför snarare än det kvantifierade skadeutfallet. Det finns dock andra sätt att dela in dammar i klasser. Nedan redogörs kort för olika sätt att dela in dammar och varför utredningen inte valt dessa sätt.

Dammbrottskonsekvens och sannolikhet för skadeutfall

Det klassificeringssystem som finns i RIDAS är också konsekvensbaserat. Konsekvensklassificeringssystemet i RIDAS tar hänsyn till sannolikheten för svår påfrestning på samhället, förlust av människoliv eller allvarlig personskada och de sociala, miljömässiga och ekonomiska värden som kan förloras vid ett dammbrott. Systemet bygger således på en bedömning av sannolikheten för skadeutfall. Sannolikheten ska värderas i hög, icke försumbar eller beaktansvärd sannolikhet.

Utredningen menar att det är att gå för långt att kvantifiera sannolikheten för ett skadeutfall. I stället förespråkas som tillräckligt att det klargörs vilka skadeobjekt som berörs av översvämningsområdet samt att det görs en grov bedömning av konsekvenserna för att avgöra klassningen. Utredningen anser att det är rimligtvis förväntade konsekvenser som ska vara styrande för klassificeringen, inte osannolika konsekvenser som under vissa ovanliga förhållanden eller tidpunkter skulle inträffa.

En anläggning där verksamheten innebär fara för att en olycka ska orsaka allvarliga skador på människor eller miljön utgör, efter beslut av länsstyrelsen, en farlig verksamhet enligt 2 kap. 4 § LSO. Vid bedömningen om en damm ska omfattas av bestämmelsen måste bl.a. konsekvenserna av ett dammbrott bedömas. Kan dammbrottet orsaka allvarlig skada kan beslut fattas om farlig verksamhet. Bestämmelsen ger förutsättningar för att dela in verksamheter i två kategorier, farlig verksamhet eller inte.

Skillnaderna mellan dessa två verksamheter är enligt utredningen för onyanserad. Det behövs en mer differentierad uppdelning för att kunna ställa differentierade krav utifrån anläggningens påverkan på omgivningen. T.ex. skiljer klassningen inte ut dammar där ett dammbrott kan förmodas leda till en kris för samhället. Utredningen har därför funnit att det inte är lämpligt att använda indelningen enligt 2 kap. 4 § LSO.

Dammegenskaper

Internationellt kan man ibland se klassificeringssystem baserade på dammegenskaper såsom måttangivelser för dammhöjd och magasinsvolym. Det är egenskaper som kännetecknar dammens skadepotential och den flodvåg som ett dammbrott kan medföra. En hög damm med stor magasinsvolym kan medföra stora konsekvenser vid ett dammbrott. Likaså har en låg damm med liten magasinsvolym vanligtvis små konsekvenser på omgivningen om den havererar. Metodiken tar däremot inte hänsyn till skadeobjekt i området som påverkas av översvämningar. Oavsett höjden eller magasinsvolymens storlek kan ett dammbrott få stora eller små konsekvenser på omgivningen beroende på vad som kan tänkas skadas i händelse av ett dammbrott. Utredningen anser därför att dammegenskaper inte är en tillräcklig grund för dammsäkerhetsklassningen.

8.4. Process för dammsäkerhetsklassificering

8.4.1. Vattenanläggningar som innehåller eller utestänger vatten ska omfattas av klassificeringssystemet

Utredningen föreslår att samtliga vattenanläggningar vars syfte är att innehålla eller utestänga vatten eller blandningar av vatten och annat material, t.ex. anrikningssand ska omfattas av det föreslagna klassificeringssystemet. Med vattenanläggning menas en sådan anläggning som har kommit till genom en vattenverksamhet, tillsammans med manöveranordningar som hör till anläggningen, se 11 kap. 3 § MB. Vattenkraftverk, avbördningsanordningar och intag i fall där de utgör en vattenanläggning, eller del av en sådan, som innehåller eller utestänger vatten ska omfattas av klassificeringssystemet. Slussar utgör också vattenanläggningar som innehåller

eller utestänger vatten varför även dessa ska omfattas av klassificeringssystemet. Kravet ska omfatta såväl nya som befintliga anläggningar.

Dammar som innehåller blandningar av vatten och annat material, t.ex. anrikningssand eller industriavfall, är också vattenanläggningar och omfattas av klassificeringssystemet.

Hydrauliska konstruktioner såsom tryckrör, tunnlar och vägtrummor ska enligt utredningen inte omfattas av klassificeringssystemet.

Även permanenta skyddsvallar är vattenanläggningar enligt 11 kap. 2 § 4 MB och ska omfattas av det föreslagna klassificeringssystemet. Med skyddsvall avses en sådan invallning som byggts upp kring ett visst område för att förhindra översvämning i samband med höga flöden och/eller högvatten i hav/sjö. Sådana skyddsvallar finns i dag vid Kristianstad och Vansbro där bebyggelse ligger nära vatten och riskerar att översvämmas vid höga vattenstånd. Dessa invallningar är permanenta dammkonstruktioner. Syftet med invallningar är att på ett varaktigt sätt förhindra översvämning av angränsande områden vid höga vattenstånd. Områdena nedströms skyddsvallen är bebyggda. Skulle invallningarna brista vid höga vattenstånd skulle konsekvenserna kunna bli stora.

8.4.2. Vilka dammar ska konsekvensutredas?

Syftet med konsekvensutredningen är att identifiera vilka dammanläggningar som ska omfattas av klassificeringssystemet och vilka konsekvenser som ett dammbrott i någon av de ingående dammarna skulle medföra. Baserat på konsekvensutredningen beslutas om dammarna ska klassificeras i någon dammsäkerhetsklass. För att identifiera de anläggningar som ska omfattas av klassificeringssystemet krävs att fler anläggningar än dessa konsekvensutreds. Vi vet inte i dag exakt vilka dammanläggningar som skulle medföra de ovan angivna konsekvenserna, se avsnitt 8.3.3. Det behövs därför ett initialt urval.

Utredningen har bedömt att det för befintliga dammanläggningar som har en eller flera dammar som vid dammbrott kan frisläppa en vattenvolym större än 50 000 m3 ska upprättas en konsekvensutredning. Med vatten innefattas även blandningar av vatten och annat material, exempelvis anrikningssand. Enligt utred-

ningen har anläggningar med den angivna volymen en sådan potential att åsamka skada på omgivningen att de faktiska konsekvenserna av ett haveri bör utredas och dokumenteras.

Befintliga dammanläggningar med en eller flera dammar som vid dammbrott skulle frisläppa en vattenvolym på mellan 10 000 och 50 000 m3 ska också konsekvensutredas om det finns bebyggelse, samhällsviktig infrastruktur eller skyddsvärd naturmiljö som skulle kunna skadas vid ett dammbrott. Dammanläggningar som innehåller farliga sediment i magasinet ska särskilt beaktas.

Dammanläggningar som vid dammbrott skulle frisläppa en vattenvolym på mindre än 10 000 m3 anser utredningen inte behöver konsekvensutredas.

Utredningen menar att Svenska kraftnät ska bemyndigas att beskriva hur vattenvolymen som kan frisläppas ska definieras. Det kan vara olika för olika typer av dammar. Exempelvis skyddsvallar längs ett vattendrag är att betrakta som specialfall. I många fall innehåller eller utestänger skyddsvallar inte vatten vid normalförhållanden utan endast vid höga flöden.

8.4.3. Konsekvensutredning av nya dammar

Inför uppförandet av nya dammar ska konsekvenser av ett dammbrott beskrivas. Konsekvensutredningen bifogas tillståndsansökan. För mycket små dammar räcker det att konstatera att ett haveri inte skulle förorsaka konsekvenser för liv, hälsa eller miljö.

8.4.4. Konsekvensutredningens innehåll

Med konsekvensutredning avses som redan nämnts en beskrivning av de konsekvenser som dammbrott vid en dammanläggning kan orsaka. Enligt utredningen bör konsekvensutredningen innehålla:

  • Grunddata om dammanläggningen såsom geografiskt läge, dammtyp, dammhöjd, typritningar för plan, tvärsektion och längdprofil etc.
  • En redogörelse över hur dammen eller dammarna antas kunna haverera. Haverier kan ske på olika sätt beroende på en damms egenskaper och konstruktion, vilket bl.a. påverkar tidsförlopp och hastigheten på det utströmmande vattnet.
  • Beskrivning av den översvämning som dammbrott uppskattas leda till, lämpligen på ett kartunderlag.
  • Beskrivning av de skadeobjekt som finns i det område som skulle översvämmas.
  • En beskrivning av hur beräkningar och bedömningar gjorts.
  • Förslag på dammsäkerhetsklass eller motiverad bedömning om att dammanläggningen inte behöver omfattas av klassificeringssystemet.

För en dammanläggning där flera dammar innesluter ett magasin, dvs. en vattenvolym, ska konsekvenserna av ett dammbrott beskrivas för respektive damm. Både konsekvenser uppströms (t.ex. släntras) och nedströms den aktuella dammen ska beskrivas. Ett dammbrotts inverkan på nedanförliggande dammar samt risken för fortlöpande dammbrott (dominoeffekt) ska beaktas vid konsekvensutredningen av ett dammbrott.

Dammbrott vid olika flödesförhållanden ska analyseras. Om de olika flödesförhållandena innebär väsentliga skillnader avseende konsekvenserna ska detta redogöras för. Det är den totala översvämningen som ska beskrivas men endast den merskada som själva dammbrottet ger upphov till som blir styrande för klassningen. Det dammbrott som ger upphov till störst konsekvenser blir underlag för dammens dammsäkerhetsklass. Vid höga flöden och liten vattenvolym i magasinet kan ett dammbrott orsaka endast en mindre ökning av den resulterande översvämningen och därmed den skada på omgivningen som det höga flödet ger. En sådan omständighet ska redogöras för.

Utredningen menar att det inte behöver föreskrivas en exakt metod för hur konsekvensutredningen ska genomföras. Metodvalet måste överlåtas åt dammägaren. Det viktiga är att det av underlaget går att bedöma om metoden ger en rättvisande bedömning av dammbrottets konsekvenser.

Konsekvenserna av dammbrott ska för varje damm dokumenteras och förslag på dammsäkerhetsklass motiveras. Kraven på utredning och innehåll i dokumentationen kan variera från fall till fall beroende på arten och omfattningen av skador vid ett eventuellt dammbrott. I konsekvensutredningen ska förslag på dammsäkerhetsklass för de ingående dammarna ges.

I vissa fall kan det vara enkelt att konstatera vilka konsekvenser ett dammbrott kan medföra. Det kan handla om uppenbara fall där konsekvenserna bedöms vara försumbara trots att anläggningen uppfyller de angivna kraven på volym för att omfattas av kravet på konsekvensutredning. I sådana fall behöver inte konsekvensutredningen vara så omfattande. Likaså måste man beakta att vissa dammägare redan har ett omfattande material som tagits fram i samband med konsekvensklassificeringen enligt RIDAS. I dessa fall kan det räcka med en sammanställning av det underlaget med eventuella kompletteringar.

För att kunna differentiera kraven på konsekvensutredning utifrån nyss nämnda omständigheter föreslår utredningen att Svenska kraftnät bemyndigas att meddela föreskrifter om konsekvensutredningens omfattning och innehåll.

Dammanläggningens konsekvensutredning ska hållas uppdaterad. Dammägare ska informera tillsynsmyndigheten om förhållanden ändras på så sätt att det kan bli aktuellt att ändra klass. Sådana omständigheter kan vara att anläggningen byggs om eller att det tillkommit bebyggelse i det område som kan kommat att översvämmas.

8.4.5. Ägaren upprättar konsekvensutredning

Utredningen föreslår att ansvaret för att upprätta en konsekvensutredning ska åligga dammägaren.

Om en dammanläggning består av flera olika dammar eller dammdelar som ägs av olika dammägare måste respektive dammägare upprätta en konsekvensutredning för sin del, men de bör samverka när de tar fram konsekvensutredningarna. T.ex. kan en damm bestå av en intagskonstruktion till ett vattenkraftverk med en anslutande damm på var sida om kraftverket. Kraftverket kan ägas av en ägare och dammarna av en annan. Vid ett sådant förhållande ska en konsekvensutredning upprättas av respektive ägare för var och en av delarna. Ägarna bör samråda med varandra eftersom haveri i en dammdel kan ge följdhaveri i den andra ägarens dammdel.

8.4.6. Konsekvensutredning för dammar med oklara ägarförhållanden (herrelösa dammar)

Kravet att upprätta en konsekvensutredning ska enligt utredningens förslag åligga underhållsskyldiga av anläggningar som vid ett dammbrott kan frisläppa en vattenvolym större än 50,000 m3. Utredningens uppfattning är att för de allra flesta anläggningar som kommer i fråga råder inga oklarheter om vem som är underhållsskyldig. I de fall där verksamheten sedan länge har upphört kan det uppstå svårigheter med att hitta en ansvarig för underhållet.

Det är dock utredningens bedömning att flertalet av de dammar där ägarförhållandena är oklara kan hänföras till kategorin ”Övriga dammar”. Dessa dammar bedöms i allmänhet ha en mindre vattenvolym än 50 000 m3 som kan frisläppas vid dammbrott. Ett dammbrott i någon av dessa dammar skulle i de allra flesta fall endast medföra små lokala konsekvenser. I dessa fall aktualiseras inte frågan om vem som ska ansvara för konsekvensutredningens utförande och kostnaden för det.

Det kan emellertid finnas dammar som skulle kunna medföra konsekvenser av betydelse där ägarförhållandena är oklara. Dessa ska liksom för övriga anläggningar klassificeras i en dammsäkerhetsklass.

Enligt utredningen bör det kunna krävas av ägaren till den fastighet där anläggningen är belägen att ansvara för att ta fram en konsekvensutredning. Det faktum att man har en damm på sin fastighet som påverkar omgivningen gör att man kan anses vara verksamhetsutövare för den verksamheten.

Av praxis framgår att för det fall det inte går att fastslå vem som är ägare till en vattenanläggning kan krav riktas mot den som har rådighet över vattenområdet i fråga, se MÖD 2006:2. Rådighet har man bl.a. om man äger det aktuella området. Domstolen menade i det angivna fallet att den som har rådighet över vattenområdet även har de faktiska och rättsliga möjligheterna att följa det i målet aktuella föreläggandet om utrivning. Vattenanläggningen som avsågs var en tillståndspliktig brygga. Motsvarande bedömning i fråga om ansvar för anläggningen bör enligt utredningen kunna göras även för andra vattenanläggningar än bryggor.

Om fastighetsägaren inte vill åta sig ansvaret i fråga om utredning och även övrigt ansvar som följer med ägandet kan han eller hon ansöka om utrivning. I samband med ett sådant ärende

måste dammens potentiella risker vägas mot eventuella positiva effekter med att ha dammen kvar.

8.4.7. Klassificeringsprocessen

Utredningen bedömer att arbetet med dammsäkerhetsklassificeringen initialt kommer att pågå under en period av tre år och därefter löpande under nästföljande år, se diagram 8.2. Det är enligt utredningen angeläget att dammar med störst konsekvenser för samhället klassificeras så snart som möjligt och därför föreslås en prioriteringsordning.

År 1: Utredningen föreslår att de dammanläggningar som vid ett dammbrott kan frisläppa en vattenvolym större än 5 miljoner m3ska konsekvensutredas och beslut om dammsäkerhetsklass fattas av tillsynsmyndigheten senast ett år efter det att bestämmelserna trätt i kraft. Dessa dammanläggningar är med största sannolikhet redan klassificerade enligt branschens riktlinjer och därmed lätta att identifiera. Utredningen uppskattar antalet dylika dammanläggningar till 100–150 stycken.

År 2 och 3: Därefter ska övriga dammanläggningar som vid ett dammbrott kan frisläppa en vattenvolym större än 50 000 m3konsekvensutredas och klassificeras i två steg, först de som innesluter en vattenvolym över 0,5 miljoner m3 och därefter de som innesluter en volym på över 50 000 m3.

År 4 och framöver: I ett sista steg ska även dammanläggningar som vid dammbrott skulle frisläppa en vattenvolym på mellan 10 000 och 50 000 m3 konsekvensutredas om det finns bebyggelse, samhällsviktig infrastruktur eller skyddsvärd naturmiljö som skulle kunna skadas vid ett dammbrott. Konsekvensutredningen upprättas av dammägaren på uppmaning av tillsynsmyndigheten. I detta steg kan även de invallningar längs vattendrag vars syfte är att utestänga vatten vid höga flöden konsekvensutredas. Även här ska en bedömning göras av skadeområdets värde innan konsekvensutredningar upprättas.

Denna uppdelning medför att dammarna med störst konsekvenser i händelse av ett dammbrott hanteras först.

Inför klassificeringsperioden identifierar tillsynsmyndigheten dammanläggningar med dammar som kan komma att beröras av krav på konsekvensutredning. Tillsynsmyndigheten informerar ägarna till anläggningarna om de nya kraven. De ägare som omfattas av skyldigheten att upprätta en konsekvensutredning ska lämna den till tillsynsmyndigheten tillsammans med ett förslag om dammsäkerhetsklass sex månader innan det att klassificeringsbeslutet ska ha meddelats.

Året efter att dammsäkerhetsklasserna har beslutats träder det nya regelverket i kraft, se diagram 8.3. Avseende rutiner för egenkontroll och rapportering hänvisas till kapitel 9.

Volym = vattenvolym som kan frisläppas vid dammhaveri

Konsekvensutreds år 3

Konsekvensutreds endast om skadeobjekt finns i närheten

Volym < 0,01 Mm3

Större konsekvenser

i händelse av

dammbrott

Mindre konsekvenser

i händelse av

dammbrott

Volym > 0,05 Mm3

Volym mellan 0,01 och 0,05 Mm3

Behöver inte konsekvensutredas

Konsekvensutreds år 2

Volym > 0,5 Mm3

Konsekvensutreds år 1

Volym > 5 Mm3

Process för dammsäkerhetsklassificering av en dammanläggning

1. Ägaren upprättar en konsekvensutredning och förslag om dammsäkerhetsklass för de ingående dammarna i dammanläggningarna och skickar till tillsynsmyndigheten.

2. Tillsynsmyndigheten granskar konsekvensutredningen.

  • Om tillsynsmyndigheten anser att konsekvensutredningen inte uppfyller kraven och behöver kompletteras kontaktar tillsynsmyndigheten dammägaren. Med stöd av bestämmelserna i 26 kap. MB kan tillsynsmyndigheten förelägga en ägare om komplettering.
  • Om tillsynsmyndigheten utifrån konsekvensutredningen anser att dammbrott i de ingående dammarna i dammanläggningen enbart skulle medföra små lokala konsekvenser bestämmer tillsynsmyndigheten att dammanläggningen kan hänföras till ”Övriga dammar”.
  • Om tillsynsmyndigheten utifrån konsekvensutredningen anser att dammbrott i någon av de ingående dammarna i dammanläggningen skulle ge mer än små lokala konsekvenser upprättar tillsynsmyndigheten ett beslutsdokument där det framgår vilka dammsäkerhetsklasser de ingående dammarna i dammanläggningen beslutas tillhöra. Klassificerade dammar omfattas därefter av de specifika dammsäkerhetskrav som ställs på dammar i dammsäkerhetsklass A, B eller C, se kap. 9.

Konsekvensutredning och klassificering

Rutiner för egenkontroll

Rutiner för rapportering

År 1

År 2

År 3

År 4

År 5

År 6

Konsekvensutredning

Volym >5 Mm

3

Volym > 0,5 Mm

3

Volym > 0,05 Mm

3

Volym mellan 0,01 och 0,05 Mm

3

Volym >5 Mm

3

Volym > 0,5 Mm

3

Volym > 0,05 Mm

3

Volym mellan 0,01 och 0,05 Mm

Volym >5 Mm

3

Volym > 0,5 Mm

3

Volym > 0,05 Mm

3

Volym mellan 0,01 och 0,05 Mm

3

3. Tillsynsmyndigheten för in uppgifter om dammarna som beslutats tillhöra dammsäkerhetsklass A, B eller C i den dammsäkerhetsdatabas som föreslås utvecklas för dammar som omfattas av de särskilda dammsäkerhetskraven, se avsnitt 11.4.4. Även dammar där konsekvensutredning har upprättats och som beslutats tillhöra ”Övriga dammar” förs in i dammsäkerhetsdatabasen.

I betänkandet benämns en dammanläggning med minst en damm i dammsäkerhetsklass A för dammanläggning i dammsäkerhetsklass A. På samma sätt benämns en dammanläggning med minst en damm i dammsäkerhetsklass B men ingen damm i klass A för dammanläggning i dammsäkerhetsklass B. Motsvarande gäller för dammanläggningar i dammsäkerhetsklass C, dvs. att de har minst en damm i dammsäkerhetsklass C men ingen damm i vare sig klass A eller B.

8.4.8. Länsstyrelsens beslutar om dammsäkerhetsklass

Utredningen föreslår att det är länsstyrelserna som tillsynsmyndighet som ska besluta om dammsäkerhetsklass. Den kompetens som behövs för granskning av konsekvensutredningar och för

Damm i dammsäkerhetsklass C

Damm i dammsäkerhetsklass B

Damm i dammsäkerhetsklass A

Dammanläggning i dammsäkerhetsklass A

Utförs/Upprättas per dammanläggning men innehåller information om alla dammar i dammanläggningen

Damm i dammsäkerhetsklass B

Dammanläggning i dammsäkerhetsklass B

Konsekvensutredning Beslut om klass Helhetsbedömning (kap 9) Myndighetsrapportering (kap 9) Tillsyn (kap 10)

beslut om dammsäkerhetsklass finns till stor del på länsstyrelserna i dag. Länsstyrelserna har lokalkännedom och genom arbetet med risk- och sårbarhetsanalyser kompetens att bedöma risker. Därutöver har länsstyrelserna redan erfarenhet av liknande beslut genom dess ansvar att fatta beslut om verksamhet vid dammarna ska utgöra farlig verksamhet enligt LSO. Det finns dock en viss eftersläpning i systemet vad gäller att fatta beslut om farliga verksamheter. Utredningen menar att det är viktigt att länsstyrelserna fattar beslut om dammsäkerhetsklass för att möjliggöra att regelverkets bestämmelser kan träda i kraft.

En nackdel med att länsstyrelserna beslutar om klass kan enligt utredningen vara att olika länsstyrelser kan besluta olika, dvs. besluten blir inte likriktade över landet. Utredningen anser därför att det är lämpligt att länsstyrelserna i svårbedömda fall tar stöd av Svenska kraftnät vid beslut om klass. Det är dock alltid tillsynsmyndigheten som beslutar om klass.

Om tillsynsmyndighetens beslut väger mellan två klasser anser utredningen att den högre klassen bör väljas med stöd av försiktighetsprincipen. Tillsynsmyndighet får bestämma att ett sådant beslut ska gälla omedelbart även om det överklagas, se 26 kap. 26 § MB.

8.4.9. Finansiering av dammsäkerhetsklassificering

Att granska konsekvensutredningar och besluta om dammsäkerhetsklass är en ny och i huvudsak tillfällig uppgift för länsstyrelserna. Granskning av konsekvensutredningar och beslut om klassificering kommer även löpande att behöva göras. Den stora arbetsbördan infaller dock under processens tre första år. Som utredningen kommer att återkomma till i avsnitt 14.1.5 föreslås att den initiala klassificeringsprocessen finansieras med anslag. Utredningen uppskattar tidsåtgången för granskning av konsekvensutredning och beslut om klassificering till 0,5–1 dag per dammanläggning. I avsnitt 8.5 uppskattas antalet dammanläggningar som under denna period ska konsekvensutredas till omkring tusen dammanläggningar. Det innebär att tiden för att granska konsekvensutredningarna och besluta om klass kommer att uppgå till totalt knappt tre årsarbetskrafter.

8.4.10. Klassificeringsbeslutets överklagbarhet

Utredningen har i avsnitt 3.6.1 redogjort för bestämmelserna om ett tillsynsbesluts överklagbarhet enligt MB. Av redogörelsen framgår bl.a. att rätten att överklaga ett beslut enligt MB har den som beslutet angår, om avgörandet har gått honom eller henne emot, se 16 kap. 12 § MB. Därutöver tillkommer rätten att överklaga ett antal i MB angivna aktörer såsom Naturvårdsverket, Kammarkollegiet, MSB, länsstyrelsen och kommunen i fråga om allmänna intressen eller i de fall det är särskilt föreskrivet. Av 16 kap. 13 § MB följer även att ideella föreningar eller annan juridisk person får överklaga en dom eller ett beslut under förutsättning att föreningen eller den juridiska personen uppfyller vissa i bestämmelsen angivna krav. Rätten att överklaga för sådana ideella föreningar och juridiska personer som bestämmelsen avser omfattar däremot inte tillsynsbeslut.

Huruvida någon är berörd av ett beslut har överlåtits åt rättstillämpningen. Av motiven till MB framgår bl.a. att beslutet i fråga antingen ska påverka den klagandes rättsliga ställning eller beröra ett intresse som på något sätt erkänts av rättsordningen för att det ska föreligga en rätt att klaga.4

Av praxis följer att bedömningen av talerättsfrågan måste göras med utgångspunkt i de intressen som ska beaktas vid tillämpningen av de materiella regler som är aktuella. Detta innebär att i mål som endast ansetts gälla en avvägning mellan allmänna och verksamhetsutövarens intresse har andra enskilda intressen avvisats. Vidare har i praxis anförts att någon rätt att klaga inte föreligger på ett beslut som i sig inte skapar några rättigheter för sökanden och därmed inte har någon faktisk effekt gentemot klagandena, se bl.a. MÖD 2007:6. Likaså har en enskild inte ansetts vara berörd av ett beslut enbart med åberopande av endast ett allmänt intresse som grund, se bl.a. MÖD 2005:8.

Tillsynsmyndigheten ska enligt utredningens förslag fatta ett beslut om vilken dammsäkerhetsklass en damm ska klassificeras i. Syftet med beslutet är att kunna identifiera de dammar som kan medföra konsekvenser för samhället vid dammbrott. Beslutet utgör en förutsättning för att kunna ställa särskilda krav i fråga om bl.a. egenkontroll och rapportering. Kraven som följer med anledning av beslutet riktar sig enbart mot dammägaren.

4Prop. 1997/98:45, s. 483.

Utredningen bedömer att beslutet om dammsäkerhetsklass i sig inte medför några konsekvenser eller effekter för andra än ägaren i fråga. Rätten att överklaga ett klassificeringsbeslut ska därför begränsas till att endast avse ägaren av den anläggning som beslutet avser. För att tydliggöra detta förhållande föreslår utredningen att en sådan begränsning förs in i lag.

Utredningen bedömer att en sådan bestämmelse inte står i konflikt med berörda konventioner. Möjligheten för en enskild att påkalla allmänna tillsynsåtgärder och beslut i anledning av dessa kvarstår.

8.5. Antal dammanläggningar som omfattas av krav på konsekvensutredning

Utredningen gör i detta avsnitt en uppskattning av antal dammanläggningar och ägare som kommer att omfattas av kravet på konsekvensutredning. Även var de finns i landet beskrivs.

Som nämnts i kapitel 2 finns inget aktuellt dammregister, vilket försvårar uppskattningen. Utredningen har utgått från SMHI:s dammregister och Svenska kraftnäts sammanställning av dammanläggningar som årsrapporterats från dammägare till länsstyrelserna.

Ett utdrag ur SMHI:s dammregister visar att 730 dammar har en vattenvolym större än 50 000 m3. Det är oklart om det är dammar eller dammanläggningar som är upptagna i registret, troligtvis är det en blandning. Dammanläggningarna är fördelade på 320 ägare. Drygt 500 av dammarna ägs av företag, drygt hundra av privatpersoner och föreningar och drygt 100 av kommuner. Dammarna i två län saknar i registret uppgifter om vattenvolymens storlek. Utredningen bedömer att antalet anläggningar som har en vattenvolym som skulle frisläppas vid dammbrott större än 50 000 m3 till fler än 730 eftersom dammregistret är under uppbyggnad.

Sammanställningen av dammanläggningar som årsrapporterats omfattar som tidigare nämnts 510 dammanläggningar i konsekvensklass 1A, 1B och 2 enligt klassificeringssystemen i RIDAS och GruvRIDAS. Denna sammanställning omfattar troligen de flesta dammar med betydande konsekvenser i händelse av dammbrott. Totalt sett är det cirka 700 dammar i sammanställningen. Cirka 70 ägare äger dessa 510 dammanläggningar. Ägarna är främst företag, men även kommuner och privatpersoner. Som nämnts i

avsnitt 2.5.2 ägs 350 av de största dammarna av sex stora dammägare inom vattenkraftindustrin.

Vid en samkörning av de två sammanställningarna framkommer att det måste vara minst 915 dammanläggningar som omfattas av kraven på konsekvensutredning, dvs. dammar som kan frisläppa mer än 50 000 m3. I tids- och kostnadsuppskattningar har utredningen använt sig av siffran tusen dammanläggningar som ska konsekvensutredas. Sammanfattningsvis är det allt ifrån privatpersoner som äger en damm till stora kraftbolag som kommer att omfattas av konsekvensutredningskravet.

Samkörningen visar även att den geografiska fördelningen av dammar/dammanläggningar varierar över länen mellan SMHI:s dammregister och Svenska Kraftnäts sammanställning. I SMHI:s register har de flesta län mellan 2–10 procent av dammarna i sina län men Värmland har över 25 procent av dammarna. Dammanläggningarna i Svenska kraftnäts sammanställning har en annan fördelning, där är de flesta dammanläggningarna belägna i Norrbotten, Västerbotten, Jämtland, Västernorrland, Dalarna, Gävleborg, Värmland och Örebro.

8.6. Regleringen om klassificering i miljöbalken

Utredningen har haft att överväga om den föreslagna regleringen om dammsäkerhet ska införas i MB eller i en helt ny lag.

Dammar, inkluderat gruvdammar och skyddsvallar, utgör vattenanläggningar enligt 11 kap. MB. Dessa tillståndsprövas i enlighet med bestämmelserna i nämnda regelverk. Regler om tillsyn över dessa anläggningar liksom bestämmelser om egenkontroll finns likaså i MB och därtill hörande förordning.

En ny dammsäkerhetslag skulle innebära att bestämmelser om klassificeringssystem, tillsyn och egenkontroll avseende dammar skulle specialregleras. Fördelen med ett sådant system skulle vara att det blir tydligt för aktörerna vad som är särskilt reglerat för dammar. Ett sådant system finns t.ex. i Finland där motsvarande bestämmelser finns i en dammsäkerhetslag. Till skillnad från Sverige har dock Finland inte någon motsvarighet till MB utan har sin vattenrättsliga reglering i en särskild vattenlag. Även Norge har en motsvarande vattenlag. Den särskilda dammsäkerhetsregleringen med bestämmelser om bl.a. klassificering, tillsyn och egenkontroll finns i en särskild dammsäkerhetsföreskrift.

En särskild dammsäkerhetslag i Sverige skulle ändå juridiskttekniskt behöva kopplas ihop med MB eftersom den grundläggande regleringen kring anläggningarna om bl.a. tillstånd, strikt ansvar och underhållsskyldighet finns där. Om en utgångspunkt tas i MB innebär det också att balkens generella bestämmelser om tillsyn, avgifter m.m. kan tillämpas.

Sammanfattningsvis har utredningen funnit att det är ett lämpligt förfarande att reglera de nya bestämmelserna om klassificeringssystemet i MB. I samband med att detta förslag föreslår även utredningen vissa redaktionella ändringar i 11 kap MB. Syftet med dessa ändringar är inte att ändra bestämmelsernas innebörd.

8.7. Jämförelser mellan klassificeringssystem

Som nämnts i kapitel 6 har branschen i sina riktlinjer ett system för konsekvensklassificering. Utredningens bedömning är att det system som finns framtaget inom ramen för RIDAS kan utgöra en utgångspunkt för bedömningen av konsekvenser enligt utredningens förslag. Dammsäkerhetsklasserna enligt utredningens förslag kan även jämföras med annan riskindelning enligt andra regelverk som berör dammar. Utöver konsekvensklasserna i RIDAS kan de föreslagna dammsäkerhetsklasserna även jämföras med klassificeringar i riktlinjerna för dimensionerande flöden, LSO och utvinningsavfallsförordningen. I tabellen nedan redogörs för utredningens syn på hur förhållandena kan se ut mellan regelverken.

1 Konsekvensklass 2 Flödesdimensioneringsklass 3 I de fall grunden för beslut om farlig verksamhet är konsekvenser av ett dammbrott 4 I de flesta fall

I den mån en dammanläggning redan omfattas av legala regleringar eller branschriktlinjer förhåller sig klassificeringen enligt dessa bestämmelser och riktlinjer till dammsäkerhetsklasserna enligt ovanstående tabell. Utredningen menar att det system för dammsäkerhetsklassificering som nu föreslås bör kunna ersätta eller vara vägledande för andra konsekvensbaserade klassificeringar. Det innebär att andra klassificeringar såsom konsekvensklasserna enligt RIDAS och GruvRIDAS kan komma att ersättas på sikt. När riktlinjerna uppdateras kan dammsäkerhetsklasserna ersätta konsekvensklasserna.

Även flödesdimensioneringsklasserna kan ersättas av dammsäkerhetsklasser på sikt. När riktlinjerna uppdateras kan dammsäkerhetsklasser föras in i stället för flödesdimensioneringsklasser. Metoderna för beräkning av dimensionerande flöden kan därefter utgå från dammsäkerhetsklassen för anläggningen i stället för

anläggningens flödesdimensioneringsklass. Särskild hänsyn får dock tas till att det är konsekvenser av dammbrott vid höga flöden som avses vilket ska framgå av konsekvensutredningen.

En anläggning där verksamheten innebär fara för att en olycka ska orsaka allvarliga skador på människor eller miljön kan efter länsstyrelsens beslut omfattas av 2 kap. 4 § LSO. Enligt utredningen överensstämmer de konsekvenser som ett dammbrott i en damm i klass A och B kan medföra med sådana allvarliga skador som åsyftas i samma lagstiftning. Detta innebär att klassificeringen av dammar i dammsäkerhetsklass A och B och de konsekvensutredningar som upprättats för sådana dammar kan vara vägledande för länsstyrelserna även i deras överväganden och beslut om verksamhet vid dammarna ska betraktas som farlig verksamhet enligt LSO.

I utvinningsavfallsförordningen avses med riskanläggning en avfallsanläggning som vid en riskbedömning, där man beaktar anläggningens nuvarande och framtida storlek, lokalisering och miljöpåverkan, ger grund för antagandet att en allvarlig olycka skulle kunna inträffa om ett upplag kollapsar, en fördämning rämnar eller till följd av någon annan brist i anläggningen eller felaktig drift av den. Gruvdammar i dammsäkerhetsklasserna A och B kan enligt utredningen säkerligen likställas med riskanläggningar enligt utvinningsavfallsförordningen och detsamma lär troligen gälla för gruvdammar i dammsäkerhetsklass C.

9. Egenkontroll och rapportering

9.1. Egenkontroll och rapportering

Utredningens förslag: Ägare av en dammanläggning med en

eller flera dammar i dammsäkerhetsklass A–C ska upprätta övergripande mål och handlingsprinciper för kontroll av risken för dammbrott. Ägaren ska upprätta och arbeta enligt ett säkerhetsledningssystem som klargör hur målen ska uppfyllas. Säkerhetsledningssystemet ska omfatta de metoder, rutiner och instruktioner som behöver fastställas och tillämpas i fråga om

1. organisation och definierade uppgifter, ansvarsområden och

kompetenskrav för den personal som deltar i arbetet med dammsäkerhet,

2. identifiering och bedömning av allvarliga risker,

3. drift, tillståndskontroll och underhåll,

4. hantering av förändringar,

5. planering för nödsituationer, och

6. revision och översyn.

Ägare av en dammanläggning i dammsäkerhetsklass A–C ska utföra periodiska helhetsbedömningar av dammanläggningens säkerhet. Bedömningen ska utföras vart tionde år eller oftare om särskilda skäl föreligger.

Ägare av en dammanläggning i dammsäkerhetsklass A–C ska årligen genomföra en dammsäkerhetsrapportering till tillsynsmyndigheten. Dammägare som inte lämnar sin dammsäkerhetsrapportering inom angiven tid ska kunna påföras en miljösanktionsavgift.

Svenska kraftnät ska bemyndigas att meddela ytterligare föreskrifter om innehållet i samt omfattning och dokumentation av säkerhetsledningssystem, helhetsbedömning och dammsäkerhetsrapportering. Föreskrifterna kan ange differentiering mellan dammsäkerhetsklasserna.

Ägare till sådana gruvdammar som utgör en riskanläggning enligt förordningen (2008:722) om utvinningsavfall omfattas inte av kravet på säkerhetsledningssystem eftersom detta krav redan finns i nämnda förordning.

MB:s efterlevnad bygger i huvudsak på att ägaren har en väl fungerande egenkontroll och att tillsynsmyndigheten genom tillsyn kontrollerar att den är ändamålsenligt utformad. Utredningen har enligt sitt direktiv haft i uppdrag att föreslå preciserade krav på verksamhetsutövarens strategi och ledningssystem samt rutiner för egenkontroll. Därutöver ska utredningen föreslå lagstiftning eller andra åtgärder för att möjliggöra en strukturerad rapportering från dammägare till tillsynsmyndigheten. Syftet med en sådan reglering är att möjliggöra en god insyn för tillsynsmyndigheten men också att stärka ägarnas egenkontroll.

De förslag som anges nedan ska gälla endast för dammanläggningar med en eller flera dammar i dammsäkerhetsklass A, B eller C. För gruvdammar görs emellertid ett undantag då dessa för det fall de utgör riskanläggningar redan omfattas av vissa av de angivna kraven genom utvinningsavfallsförordningen.

9.2. Säkerhetsledningssystem och övergripande mål

För att planera och följa upp en verksamhet behövs mål. Utredningen föreslår att ägare till dammanläggningar i dammsäkerhetsklass A, B och C upprättar övergripande mål för dammsäkerhetsarbetet och handlingsprinciper för kontroll av risken för dammbrott. De styrande principerna i avsnitt 8.2.1 bör utgöra en grund för de övergripande mål och handlingsprinciper som en dammägare bör utarbeta för sin verksamhet. Dessa övergripande mål och handlingsprinciper bör i sin tur genomsyra det säkerhetsarbete som beskrivs i ett säkerhetsledningssystem.

Säkerheten vid en verksamhet är beroende av den övergripande organisationen. För att en verksamhet ska kunna drivas säkert krävs att man inom denna övergripande organisation upprättar och

bibehåller ett system av strukturer, ansvarsområden och rutiner, med lämpliga resurser och tillgängliga tekniska lösningar. Det kan åstadkommas genom ett säkerhetsledningssystem och ska avse en beskrivning av hur ägaren arbetar med ovanstående frågor.

Utredningen föreslår därför att det införs ett krav för ägaren av en dammanläggning med en eller flera dammar i dammsäkerhetsklass A, B eller C att utforma och arbeta i enlighet med ett säkerhetsledningssystem. Systemet bör omfatta den del av det allmänna ledningssystemet som gäller organisationsstruktur, ansvarsfördelning samt metoder, förfaranden, processer och resurser. Utredningen har i framtagandet av nedanstående förslag utgått ifrån kravet på säkerhetsledningssystem som anges i utvinningsavfallsförordningen.

Följande delområden ska enligt utredningen inkluderas i dammägarens säkerhetsledningssystem:

1. organisation och definierade uppgifter, ansvarsområden och

kompetenskrav för den personal som deltar i arbetet med dammsäkerhet,

2. identifiering och bedömning av allvarliga risker,

3. drift, tillståndskontroll och underhåll,

4. hantering av förändringar,

5. planering för nödsituationer, och

6. revision och översyn.

Utrymme för enskilda dammägare att utforma system som är anpassade för den egna verksamheten bör ges, men alla delområden ska inkluderas. Respektive delområde beskrivs ytterligare i kommande avsnitt.

Ett säkerhetsledningssystem består av organisationsbeskrivningar och instruktioner som definierar ansvar och befogenheter, samt hur olika arbetsmoment ska utföras. Utredningen föreslår att ägaren i ett särskilt dokument översiktligt beskriver hur säkerhetsledningssystemet är uppbyggt. I dokumentet som beskriver säkerhetsledningssystemet bör även de övergripande målen och handlingsprinciperna för kontroll av risken för dammbrott anges. Dokumentet ska ges in till tillsynsmyndigheten i samband med årsrapporteringen, se avsnitt 9.4.

Ägare med ett stort antal dammanläggningar bör ha mer omfattande säkerhetsledningssystem än ägare med endast en eller

ett fåtal dammanläggningar. T.ex. skulle en mer omfattande DTUmanual kunna tjäna som säkerhetsledningssystem för en ägare av en eller ett fåtal dammanläggningar.

Det närmare innehållet och krav på dokumentation i de olika delområdena bör anges i föreskrifter meddelade av Svenska kraftnät. Säkerhetsledningssystemet samt dessa dokumentationskrav utgör utredningens förslag på preciserade krav på rutiner för egenkontroll. Kraven bör differentieras mellan de olika dammsäkerhetsklasserna.

9.2.1. Organisation och personal

Ägaren ska definiera uppgifter, ansvarsområden och kompetenskrav för den personal som deltar vid hanteringen av dammsäkerhet på alla nivåer inom organisationen. I förekommande fall ska även entreprenörers organisationer omfattas. Ägaren ska ha metoder och rutiner för att identifiera personalens utbildningsbehov och tillhandahålla den utbildning som är nödvändig.

9.2.2. Identifiering och bedömning av allvarliga risker

Ägaren ska ha metoder och rutiner för systematisk identifiering och bedömning av allvarliga risker. Identifieringen och bedömningen av risker ska avse sådana händelser och förhållanden som kan leda till dammbrott. Identifieringen kan ske genom tillståndskontroll av anläggningen, se avsnitt 9.2.3, eller genom analyser av olika slag. Bedömningen av risker ska göras med avseende på dammsäkerheten, dvs. risken för dammbrott.

Händelser på och vid anläggningen som kan leda till dammbrott ska identifieras och bedömas för respektive dammanläggning. Såväl normala som onormala driftförhållanden ska beaktas. Utredningen menar att det i föreskrift från Svenska Kraftnät bör ställas krav på en dokumenterad analys med ovanstående innehåll. Syftet med analysen är att såväl ägaren som tillsynsmyndigheten ska få en god bild av vilka händelser vid anläggningen som skulle kunna leda till dammbrott. Analysen måste därför utgå från anläggningens aktuella tillstånd och därmed beakta eventuella brister och svagheter som finns på anläggningen eller liknande anläggningar. Vidare ska omständigheter såsom tveksamheter i tillförlitligheten för avbörd-

ningssystem, problem med drivgods, osäkerhet om grundläggningsförhållanden anges. Antagonistiska handlingar ska också beaktas liksom händelser som kan inträffa inom den egna organisationen. Kartläggningen ska göras i rimlig utsträckning i förhållande till de konsekvenser ett dammbrott kan få.

Analysen kan användas som underlag för verksamhetsutövarens övervakning av dammens tillstånd och för att förebygga att en incident leder till dammbrott. Den kan även utgöra ett underlag för verksamhetsutövarens beredskapsplaner, så att de upprättas för händelser som kan vara kritiska för just den anläggningen.

Analysen ska förnyas i samband med helhetsbedömningen som föreslås i avsnitt 9.3 eller tidigare om det finns särskilda skäl. Förändringar i anläggningen, verksamheten, organisationen, bemanningen eller rutiner kan föranleda att analysen måste uppdateras. Analysens omfattning och detaljeringsgrad ska anpassas till den dammsäkerhetsklass anläggningen tillhör.

Även helhetsbedömningarna av anläggningarnas säkerhet görs med syftet att identifiera och bedöma allvarliga risker, se avsnitt 9.3.

I kapitel 8 föreslås att det för varje damm upprättas en konsekvensutredning i vilken det beskrivs de konsekvenser ett dammbrott skulle kunna medföra. Även arbetet med att bedöma konsekvenserna av ett dammbrott utgör en del av identifieringen av riskerna med verksamheten vid dammen. Rutiner för att hålla konsekvensutredningen uppdaterad ska därför utgöra en del av säkerhetsledningssystemet.

9.2.3. Drift, tillståndskontroll och underhåll

Ägaren ska ha metoder, rutiner och instruktioner för säker drift, tillståndskontroll och underhåll av företagets dammanläggningar. För detta bör ägaren för respektive dammanläggning ha en DTUmanual. En manual bör innehålla dokumentation, rutiner och tillvägagångssätt för dammanläggningens drift, övervakning, tillståndskontroll samt kontinuerliga underhåll och skötsel. Den bör även innehålla uppgifter om ansvarsfördelning och aktuell organisation för dammanläggningen.

Det närmare innehållet i DTU-manualen kan framgå i föreskrift. DTU-manualen ska enligt utredningen vara dokumenterad och hållas uppdaterad. I nödvändiga delar ska den vara tillgänglig för driftpersonalen vid anläggningen.

Det bör även i föreskrift anges att dammägaren ska ha dokumenterat hur beräkningar av dimensionerande flöden för anläggningen gjorts. Förutsättningar, underlag, beräkningsmetod och resultat ska framgå av dokumentationen. Beräkningarna och dokumentering av beräkningarna bör i dagsläget göras i enlighet med riktlinjer om bestämning av dimensionerande flöden för dammanläggningar. Riktlinjerna finns beskrivna i avsnitt 6.2.3.

9.2.4. Hantering av förändringar

Ägaren ska ha metoder och rutiner för planering och genomförande av ändringar av dammanläggningar och i förekommande fall för nybyggnation av anläggningar.

9.2.5. Planering för nödsituationer

Ägaren ska ha metoder och rutiner för att planera för förutsebara nödsituationer genom systematisk analys samt för att utarbeta, öva och se över beredskapsplaner som kan tillämpas vid sådana nödsituationer.

På såväl företags- som anläggningsnivå ska ägaren ha beredskapsplaner som specificerar de åtgärder som ska vidtas för att förebygga att en incident eller händelse leder till dammbrott samt hur alarmering av kommunens organisation ska göras i händelse av en incident. Beredskapsplanerna ska vara dokumenterade och revideras vid behov. Det specifika kravet och innehållet i en beredskapsplan bör enligt utredningen anges i föreskrift meddelad av Svenska kraftnät.

Rutiner för samverkan och övningar med kommunens organisation för räddningstjänst och med länsstyrelsen bör också beskrivas i verksamhetsutövarens beredskapsplan. När beredskapsplanen upprättas ska dammägaren samråda med kommun och länsstyrelse.

Beredskapsplanerna bör utgå ifrån den analys av händelser som kan leda till dammbrott enligt beskrivningen i avsnitt 9.2.2 och konsekvensutredningen som beskrivs i kapitel 8.

Beredskapsplanerna bör enligt utredningen innehålla följande information på företags- och/eller anläggningsnivå:

  • namn eller befattning på de personer som har befogenhet att starta en intern räddningsinsats, samt på de personer som har till

uppgift att sköta samordningen av omedelbara räddningsinsatser,

  • en beskrivning av vilka åtgärder som ska vidtas för att hindra och begränsa skador på dammanläggningen som skulle påverka människors hälsa och miljön för varje situation eller slag av händelse som kan förutses och som i verksamheten kan spela en avgörande roll för uppkomsten av en allvarlig olycka och andra incidenter, även omfattande en redogörelse för säkerhetsutrustning och tillgängliga resurser,
  • en beskrivning av rutiner för alarmering av kommunens organisation för räddningstjänst om allvarliga problem uppstår vid dammanläggningen samt vid konstaterade dammbrott och den information som ska lämnas vid alarmering,
  • en beskrivning av rutiner för samverkan med kommunens organisation för räddningstjänst vid en olycka, innefattande rutiner för hur stöd ska lämnas vid insatser utanför verksamheten,
  • en beskrivning av eventuella system för varning av allmänheten och de åtgärder som ska vidtas vid varning samt de åtgärder i övrigt som syftar till att begränsa skador på människors hälsa,
  • en beskrivning av hur personalen utbildas och övas och, i förekommande fall, hur samövning med kommunens organisation för räddningstjänst och länsstyrelsen genomförs.

9.2.6. Revision och översyn

Ägaren ska ha metoder och rutiner för regelbunden systematisk bedömning av, och efter behov uppdatering av, säkerhetsledningssystemet med avseende på de övergripande målen och handlingsprinciperna för kontroll av risken för dammbrott. Även säkerhetsledningssystemets effektivitet och lämplighet samt efterlevnaden ska bedömas vid den regelbundna systematiska bedömningen. Revisionerna bör dokumenteras och rapporteras till tillsynsmyndigheten i samband med årsrapporteringen, se avsnitt 9.4.

9.3. Helhetsbedömning av en dammanläggnings säkerhet

Som en del av de angivna kraven på egenkontrollrutiner inom ramen för säkerhetsledningssystemet som föreslagits i avsnitt 9.2 föreslår utredningen att det införs ett krav på en helhetsbedömning av dammanläggningens säkerhet.

Kravet på helhetsbedömning ska ställas på den som äger en dammanläggning i dammsäkerhetsklass A, B eller C. Det huvudsakliga syftet med en helhetsbedömning är att ge en övergripande bild av dammanläggningens säkerhetsstatus som kan användas som underlag för om organisatoriska eller strukturella förändringar behöver genomföras för att säkerställa en ändamålsenlig säkerhetsnivå. Helhetsbedömningen ska göras utifrån de styrande principer som gäller för aktuell anläggning, se avsnitt 8.2.1.

Helhetsbedömningar av en anläggnings säkerhet ska göras med ett visst intervall. Utredningen anser att ett intervall på tio år är lämpligt om inte särskilda förhållanden föreligger.

Helhetsbedömningen ska svara på om dammanläggningens konstruktion, funktion, organisation och verksamhet motsvarar krav i aktuell reglering, aktuella nationella och internationella föreskrifter och standarder, samt aktuella krav avseende acceptabel risknivå. Dessutom ska den svara på om den aktuella dammsäkerhetsorganisationen och verksamheten är tillräcklig för att säkerställa att säkerhetsnivån uppfylls fram till nästa helhetsbedömning under antagande om fortsatt drift.

Verksamhetsutövarens säkerhetsledningssystem ska beskriva processen för genomförandet av en helhetsbedömning. Bedömningen ska utföras av en expertgruppering i samverkan med ägaren. Grupperingen som utför helhetsbedömningen ska ha tillräckliga kunskaper och erfarenhet och all relevant information för dammens säkerhet ska finnas tillgänglig för gruppens granskning.

Helhetsbedömningen av anläggningens säkerhet ska av expertgrupperingen dokumenteras på ett systematiskt och överskådligt sätt i en samlad rapport och innefatta en sammanfattande bedömning av anläggningens säkerhet. Referenser till bakomliggande underlag och analyser ska vara tydligt angivna. De huvudsakliga slutsatserna och rekommendationerna som framkommer vid helhetsbedömningen ska rapporteras av dammägaren tillsammans med en åtgärdsplan till tillsynsmyndigheten i samband med dammsäkerhetsrapporteringen.

Tillsynsmyndigheten bör ges möjlighet att medverka vid genomförandet av helhetsbedömningen, att ta del av och lämna synpunkter på programmet för helhetsbedömningen och expertgruppens sammansättning samt att medverka vid ett slutseminarium.

Svenska kraftnät bör bemyndigas att meddela ytterligare föreskrifter om innehållet i samt omfattningen och dokumentationen av helhetsbedömningen. Utredningen anser att formerna för helhetsbedömningarnas genomförande bör utvecklas i samverkan mellan myndighet och kraftindustrin/gruvindustrin.

9.4. Årlig dammsäkerhetsrapportering

Ägare till dammanläggningar med en eller flera dammar i dammsäkerhetsklass A, B eller C ska genomföra en årlig dammsäkerhetsrapportering till tillsynsmyndigheten.

Dammsäkerhetsrapporteringens omfattning kan variera beroende på vilka dammsäkerhetsklasser ägarens dammar har. Den årliga rapporteringen föreslås omfatta basrapportering på företagsnivå respektive anläggningsnivå samt i förekommande fall fördjupad dammsäkerhetsrapportering med frekvens anpassad till dammsäkerhetsklassen. Rapporten ska skickas in till tillsynsmyndigheten senast vid ett visst angivet datum.

I avsnitt 11.4.4 föreslår utredningen att Svenska kraftnät ska ges i uppdrag att utreda formerna för en dammsäkerhetsdatabas med erforderliga uppgifter om dammarna som behövs för en god dammsäkerhetstillsyn. Databasen bör utvecklas så att dammägare ska kunna göra rapportering direkt in i databasen och också kunna se information om sina dammar i databasen.

Dessutom bör Svenska kraftnät bemyndigas att meddela ytterligare föreskrifter om innehållet i samt omfattningen av dammsäkerhetsrapporteringen.

Basrapportering

Basrapporteringen ska gälla för samtliga anläggningar med dammar som omfattas av klassificeringssystemet. Rapportering bör dock delas upp på en företags- respektive anläggningsspecifik rapportering.

Basrapporteringen för anläggningarna med dammar i klasserna A, B och C motsvarar i huvudsak den årsrapportering som Svenska

kraftnät har utarbetat rutiner för och som tillämpats i cirka tio år. Basrapportering för företag bör huvudsakligen innehålla:

  • beskrivning av företagets övergripande mål och säkerhetsledningssystem, organisationsförändringar, genomförda förändringar i säkerhetsledningssystemet, genomförda revisioner, dammbeståndet som helhet m.m.

Rapportering för respektive anläggning bör huvudsakligen innehålla:

  • årtal för upprättande av dammsäkerhetsdokument såsom konsekvensutredning, analys av händelser som kan leda till dammbrott, DTU-manual, beredskapsplan, helhetsbedömning av anläggningens säkerhet.
  • beskrivning av under året genomförd tillståndskontroll och identifierade svagheter och en bedömning av dessa med avseende på dammsäkerhet, samt orsaker till förhållandena,
  • beskrivning av under året rapporterade driftstörningar och andra händelser med avseende på dammsäkerhet, samt orsaker till och erfarenheter från händelserna,
  • beskrivning av under året genomförda samt planerade förändringar på anläggningen.

Fördjupad dammsäkerhetsrapportering

I ägarnas rutiner för egenkontroll bör det ingå att regelbundet sammanställa en samlad lägesbild av dammsäkerheten för respektive dammanläggning. En sådan dokumentation skulle fylla en viktig funktion i ägarens säkerhetsarbete och utgöra en viktig grund för myndigheternas tillsyn. Den fördjupade årsrapporteringen ska motsvara en sådan regelbunden sammanställning.

För dammanläggningar med dammar i dammsäkerhetsklass A ska rapporteringen vara mer omfattande och beskrivande än vad som krävs i basrapporteringen. Det kan vara motiverat att dammanläggningar med dammar i andra dammsäkerhetsklasser också ska omfattas av kravet på den fördjupade dammsäkerhetsrapporteringen. Det kan t.ex. vara fråga om dammanläggningar med dammar i dammsäkerhetsklass B som efter genomförd helhetsbedömning visar

brister som motiverar en mer noggrann uppföljning från tillsynsmyndigheten.

Svenska kraftnät erhöll 2010 ett regeringsuppdrag om förstärkt tillsynsvägledning vilket innebär att en process för fördjupad dammsäkerhetsrapportering nu utvecklas i samverkan med berörda dammägare och länsstyrelser, se avsnitt 5.2.5. Under 2012 genomförs försöksrapportering i enlighet med en mall för fördjupad dammsäkerhetsrapportering som innehåller följande:

  • Anläggningsdata
  • Organisation (dammsäkerhetsorganisation, säkerhetsledningssystem, beredskap)
  • Egenkontroll för aktuellt år (tillståndskontroll, oförutsedda händelser, utredningar och åtgärder)
  • Säkerhetsbedömning
  • Revideringsförteckning
  • Åtgärdsplan utifrån konstaterade svagheter

Detta utvecklingsarbete bör ligga till grund för utformningen av den fördjupade dammsäkerhetsrapporteringen.

9.4.1. Miljösanktionsavgift för rapportering

Som nämnts i avsnitt 3.9.2 utgör miljösanktionsavgifter ett av de påtryckningsmedel som används i fråga om bl.a. underlåtenhet att lämna in rapporter inom stadgad tid. Utredningen anser att det i likhet med miljörapporten för miljöfarlig verksamhet ska införas motsvarande möjlighet att påföra en miljösanktionsavgift om verksamhetsutövaren underlåter att inom rätt tid ge in dammsäkerhetsrapporten till tillsynsmyndigheten.

Liksom för miljöfarlig verksamhet kan avgiften differentieras i förhållande till dammsäkerhetsklass. Utredningen föreslår därför att avgiften för underlåtenhet att rapportera inom rätt tid för en anläggning i dammsäkerhetsklass A ska uppgå till 2 000 kr. Motsvarande avgift för anläggningar i dammsäkerhetsklass B och C bör uppgå till 1 000 kr.

9.5. Särskilt om gruvdammar

Gruvdammar omfattas såsom redan nämnts av utvinningsavfallsförordningen. För s.k. riskanläggningar ska verksamhetsutövaren ha en strategi för att förebygga allvarliga olyckor, ett säkerhetsledningssystem, en avfallshanteringsplan och en intern beredskapsplan, se närmare i avsnitt 3.10. Gruvdammar omfattas således redan av vissa av de krav som nu utredningen föreslår.

Utvinningsavfallsförordningen trädde i kraft den 1 september 2008 och är således relativt ny. Utredningen har vid kontakter med länsstyrelserna uppfattat det nya regelverket för gruvdammar som väl fungerande. Det har däremot inte gått att se hur reglerna verkar i alla avseenden. Utredningen har därför bedömt att man bör avvakta innan större förändringar föreslås vad gäller regleringen för gruvdammar. Det är inte heller lämpligt att dubbelreglera krav för vissa verksamheter.

Utredningen har däremot bedömt att det är motiverat att gruvdammar omfattas av de föreslagna dammsäkerhetsklasserna. Att kategorisera en anläggning i riskanläggning eller inte är enligt utredningen ett allt för trubbigt instrument när det kommer till att kunna ställa differentierade krav. Gruvdammar ska därför omfattas av utredningens förslag om att upprätta en konsekvensutredning. Förutom att ligga till grund för bedömningen av dammsäkerhetsklass är syftet med konsekvensutredningen att kartlägga vilka skador som kan uppstå om anläggningen havererar.

Utredningen har också bedömt det motiverat att gruvdammar som klassificerats i dammsäkerhetsklass A, B eller C omfattas av kravet på dammsäkerhetsrapportering. Innehållet och omfattningen av rapporteringen måste självklart anpassas till regleringen i utvinningsavfallsförordningen.

Utvinningsavfallsförordningen innehåller inte heller något krav som motsvarar utredningens förslag om helhetsbedömning av anläggningens säkerhet. Utredningen anser därför att även verksamhetsutövare med gruvdammar som klassificerats i dammsäkerhetsklass A, B eller C ska genomföra helhetsbedömningar av anläggningarnas säkerhet i enlighet med utredningens förslag.

9.6. Motivering till förtydligande av miljöbalkens krav

MB kräver av en dammägare att denne fortlöpande planerar och kontrollerar verksamheten för att motverka eller förebygga olägenheter för människors hälsa eller påverkan på miljön, 26 kap. 19 § MB. Dammägaren ska enligt samma stadgande även genom egna undersökningar eller på annat sätt hålla sig underrättad om verksamhetens eller åtgärdernas påverkan på miljön. Det är den som bedriver en verksamhet som har störst kunskap om den och dess verkningar. Verksamhetsutövarens ansvar inskränker sig inte till att kontrollera att balkens bestämmelser och för verksamheten särskilt meddelade villkor följs.1

För den som bedriver yrkesmässig verksamhet föreligger redan i dag krav på riskbedömning och undersökning i egenkontrollförordningen, se avsnitt 3.8. Enligt egenkontrollförordningen ska riskerna med verksamheten ifråga fortlöpande och systematiskt undersökas och bedömas från hälso- och miljösynpunkt, 6 §. Likaså ställer förordningen krav på att det ska finnas rutiner för att fortlöpande kontrollera att utrustning m.m. för drift och kontroll hålls i gott skick. Syftet med sådana rutiner är att förebygga olägenheter för människors hälsa och miljön, 5 §. De undersökningar och bedömningar som omnämns samt de kontrollrutiner som ska finnas ska även vara dokumenterade.

Egenkontrollförordningen ställer även krav på rapportering av driftsstörningar eller liknande händelse till tillsynsmyndigheten, 6 § andra stycket. Det är vanligt att det i tillståndet föreskrivs att verksamhetsutövaren ska utforma och inkomma med ett kontrollprogram till tillsynsmyndigheten. Tillsynsmyndigheten kan även enligt 26 kap. 19 § tredje stycket MB begära att verksamhetsutövaren ska lämna förslag på kontrollprogram eller förbättrande åtgärder.

Enligt utredningen finns det redan i dag utrymme för att ställa de krav på egenkontroll som i ovanstående avsnitt föreslagits med stöd av de allmänna hänsynsreglerna i 2 kap. MB och bestämmelserna om egenkontroll i balken samt egenkontrollförordningen. Dagens system ger dock stort utrymme för uttolkning av de krav tillsynsmyndigheten kan ställa i sin tillsynsutövning och vilken egenkontroll dammägaren anser sig vara skyldig att utföra. Det kan därför skilja stort mellan de olika tillsynsmyndigheternas tillsynsarbete och vilka krav myndigheterna ställer på dammägare inom sitt

1Prop. 1997/98:45 del 2 s. 279.

tillsynsområde. Likaså kan det skilja mellan olika dammägares åtgärder inom ramen för egenkontroll även om branschens riktlinjer för dammsäkerhet medför en likriktning. Statens insyn i dammägarens säkerhetsarbete blir med dagens system avhängigt hur tillsynsmyndigheten väljer att planera och genomföra sitt tillsynsarbete.

Med tanke på de förödande konsekvenser ett dammbrott i vissa dammar skulle kunna medföra anser utredningen att det är motiverat att ange mer preciserade bestämmelser för vad som ska gälla för dammägarens egenkontroll och vilka krav en tillsynsmyndighet ska ställa i sin tillsyn.

Årsrapportering från verksamhetsutövaren till tillsynsmyndigheten genomförs i dag i stor utsträckning trots att den inte är reglerad. Ett mörkertal avseende årsrapporteringen finns dock eftersom länsstyrelserna inte begär in årsrapportering varje år av alla aktuella dammägare i länet. Årsrapporteringen omfattar således inte alla dammar, alla dammägare eller alla län. I syfte att uppnå likformighet över landet, tydlighet för dammägarna och minskad administration föreslår utredningen att rutinen för verksamhetsutövarnas årsrapportering till tillsynsmyndigheten regleras samt att inrapportering ska göras i en dammsäkerhetsdatabas, se avsnitt 11.4.4. Många av uppgifterna ändras inte från år till år utan dammägaren kan bara bekräfta att förhållandena kvarstår. Enligt utredningen är de efterfrågade uppgifterna motiverade att kontrollera årligen.

Det kan emellertid finnas sådana anläggningar där någon yrkesmässig verksamhet inte bedrivs men där konsekvenserna bedöms bli så omfattande att anläggningen i fråga ska klassificeras i en dammsäkerhetsklass. Enligt utredningen kan det handla om s.k. historiska dammar men även andra anläggningar kan komma i fråga. För de anläggningar där någon yrkesmässig verksamhet inte bedrivs i dag gäller inte egenkontrollförordningens bestämmelser. De av utredningen föreslagna kraven om rutiner för egenkontroll är därför mer långtgående än vad som gäller idag. Utredningen anser dock att det är befogat att ställa dessa krav utifrån de konsekvenser ett dammhaveri kan medföra.

9.7. Uppgifternas användning i annan reglering

Det förenklar för en verksamhetsutövare att kunna använda delar av eller samma underlag för att uppfylla krav enligt olika regelverk. Utredningens bedömning är att de föreslagna rutinerna för egenkontroll och dokumentationen av dessa kan användas för att efterleva krav enligt bestämmelser i bl.a. elberedskapslagen, LSO och säkerhetsskyddslagen. Det är därför viktigt att dessa regelverk beaktas vid framtagandet av de föreskrifter som föreslås.

9.7.1. Elberedskapslagen – Risk- och sårbarhetsanalys

Syftet med elberedskapslagen är att reglera ansvaret för den planering och de åtgärder som behövs för att kunna tillgodose elförsörjningen vid höjd beredskap, se mer om elberedskapslagen i avsnitt 13.4. Fr.o.m. den 1 juli 20122 syftar lagen till att förebygga, motstå och hantera sådana störningar i elförsörjningen som kan medföra svåra påfrestningar på samhället.

Efter det att ändringarna i elberedskapslagen har trätt i kraft gäller lagen för elproducenter vilket innebär att ägare av vattenkraftverk med dammar omfattas av lagen. Mer än 95 procent av de dammar som skulle medföra konsekvenser för samhället i händelse av dammbrott används för elproduktion. Det betyder att ägare av dessa anläggningar efter ändringen i elberedskapslagen blir skyldiga att upprätta risk- och sårbarhetsanalyser avseende säkerheten i den egna verksamheten samt lämna uppgifter till elberedskapsmyndigheten som underlag till den nationella risk- och sårbarhetsanalysen.

Utredningen menar att det finns tydliga kopplingar mellan de krav på rutiner för egenkontroll som föreslås i avsnitten ovan och kravet på att upprätta risk- och sårbarhetsanalyser enligt elberedskapslagen. Såväl helhetsbedömningen som konsekvensutredningen och analys av händelser som kan leda till dammbrott kan utgöra underlag för risk- och sårbarhetsanalysen. Helhetsbedömningen tar sikte på anläggningens säkerhet och tillstånd. Konsekvensutredningen är relevant då den kan utgöra underlag för att beskriva de störningar i elförsörjningen som ett dammbrott kan medföra.

2Prop. 2011/12:89, Ändringar i elberedskapslagen.

9.7.2. Lagen om skydd mot olyckor – Riskanalys

Utredningen menar att konsekvensutredningen, analysen av händelser som kan leda till dammbrott samt dammsäkerhetsrapporten kan ligga till grund för både dammsäkerhetstillsynen enligt MB och kommunernas tillsyn enligt LSO. Tillsammans skulle dessa dokument kunna utgöra den riskanalys en ägare av en farlig verksamhet ska göra enligt 2 kap. 4 § LSO. Konsekvensbeskrivning som upprättas för att vara underlag för tillsynsmyndighetens beslut om dammsäkerhetsklass kan även utgöra ett underlag för länsstyrelsernas beslut om en anläggning ska omfattas av bestämmelserna i 2 kap. 4 § LSO.

Likaså kan konsekvensbeskrivningen och analysen av händelser som kan leda till dammbrott utgöra underlag för såväl dammägarens beredskapsplaner för dammbrott som för länsstyrelsens och kommunernas planering av räddningstjänst och krisberedskap.

9.7.3. Säkerhetsskyddslagen – Säkerhetsanalys

Utredningen har i kapitel 13 bedömt att dammanläggningar i dammsäkerhetsklass A bör utgöra sådana anläggningar som omfattas av säkerhetsskyddslagen. Det innebär att ägarna av dessa anläggningar bl.a. ska genomföra säkerhetsanalyser. Säkerhetsanalysen syfte är att identifiera skyddsvärda anläggningar och skyddsvärd information inom företaget.

Enligt det föreslagna säkerhetsledningssystemet ska dammägaren identifiera och bedöma allvarliga risker med avseende på dammsäkerhet, beroende såväl av naturliga laster som antagonistiska handlingar. Vidare ska ägaren genomföra systematisk identifiering av allvarliga risker som uppkommer under normala och onormala driftförhållanden samt göra en bedömning med avseende på dammsäkerheten. De föreslagna dokumenten som ska upprättas inom dammägarens egenkontroll kan utgöra ett underlag för säkerhetsanalysen. Särskilt kan konsekvensutredningen tillsammans med analyserna av händelser som kan leda till dammbrott utgöra underlag för att identifiera vilka anläggningar som är skyddsvärda och som bör omfattas av säkerhetsskyddslagen.

De dokument och den information som finns om dammanläggningarna ska analyseras i säkerhetsanalysen för att identifiera vad som är skyddsvärd information.

10. Tillsyn av dammsäkerhet

10.1. Länsstyrelsen som tillsynsmyndighet

Utredningens förslag: Länsstyrelsen ska även fortsättningsvis

vara tillsynsmyndighet för dammsäkerhet. Tillsyn av dammsäkerhet ska utgöra ett eget tillsynsområde som särskiljs från övrig vattenverksamhet. Det möjliggör planering och uppföljning av dammsäkerhetstillsynen.

I de län där det finns en dammanläggning i dammsäkerhetsklass A bör det finnas en dammsäkerhetshandläggare som uteslutande arbetar med dammsäkerhetstillsyn och andra ärenden som berör dammsäkerhet. Ett nätverk för dammsäkerhetshandläggare bör bildas. Nätverket ska bestå av dammsäkerhetshandläggarna på länsstyrelserna och Svenska kraftnät. Nätverket ska verka för utökad samverkan och utveckling av dammsäkerhetstillsynen.

I de län som inte har en dammanläggning i dammsäkerhetsklass A och därför inte någon särskild dammsäkerhetshandläggare, bör dammsäkerhetstillsynen över dammanläggningar i dammsäkerhetsklass B och C bedrivas av vattenhandläggare. Dessa handläggare svarar även för tillsynen över övrig vattenverksamhet. Dammsäkerhetstillsyn bör bedrivas i fyra steg; planera tillsynsverksamheten, skrivbordstillsyn av dammsäkerhetsrapportering, planera och genomföra tillsynsbesök samt utvärdera, dokumentera och rapportera.

Det behövs sammanlagt sju–nio årsarbetskrafter för den löpande operativa dammsäkerhetstillsynen av dammanläggningar i dammsäkerhetsklass A, B och C i hela landet.

För övriga dammanläggningar, dammanläggningar som inte enligt beslut tillhör dammsäkerhetsklass A, B eller C, kan tillsynen bedrivas på samma sätt som i dag. Det innebär att

handläggaren utför tillsyn över all vattenverksamhet, inklusive dammsäkerhet, vid dammanläggningen.

Dammsäkerhetshandläggare behöver ha kompetens inom framförallt dammbyggnad och dammsäkerhetsarbete. Därutöver behöver en handläggare kompetens inom tillsynsmetodik och juridik.

10.1.1. Utredningsuppdraget och kort bakgrund

Utredningen har i uppdrag att, om lämpligt, föreslå överföring av tillsyn avseende dammsäkerhet till en annan myndighet. Likaså ska utredningen utreda hur ansvarsfördelningen mellan tillsynsvägledande myndighet och tillsynsmyndighet lämpligen bör ordnas vad gäller tillsyn av dammar med särskilt stora konsekvenser i händelse av dammbrott.

Den operativa dammsäkerhetstillsynen enligt MB bedrivs av länsstyrelserna. Dammsäkerheten ingår som en del i länsstyrelsernas tillsyn över vattenverksamhet. Utredningen har bedömt att länsstyrelsernas dammsäkerhetstillsyn varit otillräcklig, se avsnitt 5.3.6. Det har berott på begränsade resurser för tillsyn av vattenverksamheter i allmänhet och dammsäkerhet i synnerhet. Generellt gäller att ingen eller mycket liten tid används för egeninitierad tillsyn av dammsäkerhet. Majoriteten av länsstyrelserna uppger att de ägnar 1–2 veckor per år åt dammsäkerhetstillsyn1.

Dammsäkerhetstillsynen hanteras oftast av vattenhandläggare på länsstyrelsen, utan erfarenhet av dammsäkerhetsarbete från tidigare anställningar. Flera länsstyrelser anser att det är svårt att upprätta och bibehålla erforderlig dammsäkerhetskompetens inom länsstyrelsen.

10.1.2. Länsstyrelsen kvar som tillsynsmyndighet

Länsstyrelsen är en etablerad tillsynsmyndighet med en omfattande kompetens och erfarenhet av tillsyn. Tillsyn såsom myndighetsuppgift utgör en central del i myndighetens verksamhet. Utifrån ett statligt helhetsperspektiv ska länsstyrelsen arbeta sektorsövergripande och inom myndighetens ansvarsområde samordna olika

1 Länsstyrelsernas Tillsyn – dagsläge, möjliga förbättringar, framtidsutsikter (Fi2008/3093).

samhällsintressen. Det innebär att länsstyrelsen har ett ansvar att väga olika intressen mot varandra.

Länsstyrelsen har ett brett tillsynsansvar. I fråga om dammar omfattar uppdraget vattenverksamhetstillsyn vari dammsäkerhetstillsyn ingår. Utöver det har länsstyrelsen ett omfattande ansvar för samordningen av krisberedskap inom länet. För att upprätthålla en god dammsäkerhet krävs en samordning mellan dessa ansvarsområden. Ibland kan avvägningar behöva göras mellan olika intressen. Förutsättning för en bra samordning och möjligheten att göra avvägningar kan enligt utredningen lättare uppnås om dammsäkerhetstillsynen ligger kvar på länsstyrelsen. Det finns därför stora fördelar med att tillsynsuppgiften för dammsäkerhet även i fortsättningen ligger kvar på länsstyrelsen.

Ett behov av lokalkännedom föreligger vad gäller bedömningen av konsekvenser och lämpliga beredskapsåtgärder. Kunskap om vilka risker som finns inom länet och hur dessa kan påverka omgivningen besitter länsstyrelsen.

Som utredningen kommer att återkomma till under avsnitt 10.2 krävs inte alltid ett besök på dammen i fråga för att tillsyn ska kunna utövas. Det är däremot enligt utredningen en fördel med inte allt för långa avstånd till tillsynsobjekten.

Trots goda förutsättningar för att utöva dammsäkerhetstillsyn anser utredningen att tillsyn över dammsäkerhet, såsom den utövats hittills, inte har varit tillfredsställande, se mer i avsnitt 5.3.6. För att uppnå en mer effektiv och likriktad tillsyn krävs att tillsynen utförs av handläggare med dammsäkerhetskompetens och enligt en utarbetad tillsynsrutin. En samlad kompetens är en förutsättning för en effektiv och ändamålsenlig dammsäkerhetstillsyn. Högre effektivitet förutsätter även att de som arbetar med tillsynen kan ägna sig fullt ut åt arbetsuppgiften under större delen av sin arbetstid. En arbetsuppgift utförs bättre ju mer frekvent den utförs. Under förutsättning att kompetensen ökar och betydligt mer resurser tillförs anser utredningen att dammsäkerhetstillsynen i dammsäkerhetsklass A–C kan utföras av länsstyrelsen. Dessutom krävs ett mer omfattande stöd från den tillsynsvägledande myndigheten.

10.1.3. Dammsäkerhetshandläggare på länsstyrelser i län med dammar i dammsäkerhetsklass A

I avsnitt 8.2.1 anges styrande principer för dammsäkerhetsarbetet. Principerna ska utgöra grunden för den kravställning som gäller för bl.a. för tillsynsmyndighetens tillsyn. För en dammanläggning i dammsäkerhetsklass A är det med stöd av de styrande principerna mer motiverat att tillsynsmyndigheten satsar mer resurser och dammsäkerhetskompetens än för dammanläggningar i de lägre klasserna. Konsekvenserna av ett dammbrott i en damm i dammsäkerhetsklass A skulle bli så omfattande att det bör krävas av tillsynsmyndigheten att hålla med den högsta kompetensen på tillsynsutövningen för dessa dammar. En ändamålsenlig dammsäkerhetstillsyn över dammanläggningar i dammsäkerhetsklass A bör därför bedrivas av tillsynshandläggare med särskild dammsäkerhetskompetens. Länsstyrelser i de län som har dammanläggningar i dammsäkerhetsklass A bör därför enligt utredningen ha en särskild dammsäkerhetshandläggare. Kompetensutveckling av dammsäkerhetshandläggare vid dessa länsstyrelser kommer även att främja dammsäkerheten i landet. Vilken kompetens som avses återkommer utredningen till i avsnitt 10.3.

Med stöd av Svenska kraftnäts pågående regeringsuppdrag där dammanläggningar som vid dammbrott kan orsaka svår påfrestning för samhället har identifierats, se avsnitt 5.2.5, uppskattar utredningen att dammanläggningar i dammsäkerhetsklass A kommer att finnas i följande sju län: Norrbottens län, Västerbottens län, Västernorrlands län, Jämtlands län, Dalarnas län, Värmlands län och Västra Götalands län. Utöver att samtliga dammanläggningar i dammsäkerhetsklass A troligtvis finns i dessa län finns enligt utredningens bedömning även cirka 70 procent av dammanläggningarna i dammsäkerhetsklass B och C här.

Källa: Svenska kraftnät.

8 län med dammanläggningar i dammsäkerhetsklass A och ca 75 % av dammanläggningarna i dammsäkerhetsklass A, B och C

13 län utan dammanläggningar i dammsäkerhetsklass A med ca 25 % av dammanläggningarna i dammsäkerhetsklass B och C

Tillsyn av anläggningar i dammsäkerhetsklass B och C kräver också dammsäkerhetskompetens. Utredningen anser emellertid att det är mest angeläget att kompetens byggs upp på de länsstyrelser som har tillsynsansvar över dammanläggningar i dammsäkerhetsklass A. Som angetts ovan kommer cirka 70 procent av dammanläggningarna i dammsäkerhetsklass B och C ligga i berörda län. Det innebär att även tillsynen över dessa anläggningar kommer att utövas av en särskild dammsäkerhetshandläggare.

10.1.4. Vilka län ska ha en dammsäkerhetshandläggare?

Som redan nämnts bedömer utredningen att antalet län med dammanläggningar i dammsäkerhetsklass A kommer att uppgå till sju. Dessa län har även flertalet av dammanläggningarna i dammsäkerhetsklass B och C.

Gävleborgs län har ingen dammanläggning i dammsäkerhetsklass A men relativt många dammanläggningar i B och C. Om även Gävleborgs län inkluderas i de antal län som bör ha en dammsäkerhetshandläggare kommer tillsynen över cirka tre fjärdedelar av dammanläggningarna i dammsäkerhetsklass A–C utövas av dammsäkerhetshandläggare. Gävleborgs län ligger i nedre delen av Ljusnan. Om även Länsstyrelsen i Gävleborgs län förstärks med en dammsäkerhetshandläggare kommer de tio stora kraftverksälvarna ligga i län vars länsstyrelser har en särskild dammsäkerhetskompetens. Det är en fördel för genomförande och uppföljning av samordnad beredskapsplanering för dammbrott som bedrivs älvsvis i de stora reglerade älvarna.

De åtta länen sammanfaller i princip med avgränsningen för de tre vattendistrikten Bottenviken, Bottenhavet och Västerhavet. Det är också en fördel då utvecklingsprojekt kan bedrivas inom ramen för vattendistrikten. Vattendistrikten är viktiga geografiska områden som utgörs av huvudavrinningsområden i Sveriges vattenförvaltning, vilka utgör grund för genomförandet av EU:s ramdirektiv för vatten2samt för genomförandet av översvämningsdirektivet3.

2 Europaparlamentets och rådets direktiv 2000/60/EG av den 23 oktober 2000 om upprättande av en ram för gemenskapens åtgärder på vattenpolitikens område. 3 Europaparlamentets och Rådets direktiv 2007/60/EG av den 23 oktober 2007om bedömning och hantering av översvämningsrisker.

De övriga 13 länen som är belägna i södra och sydöstra Sverige har tillsammans cirka 25 procent av dammanläggningarna i dammsäkerhetsklass B och C. I dessa län kommer dammsäkerhetstillsynen att utgöra en relativt liten arbetsuppgift motsvarande högst 0,2 årsarbetskrafter. Utredningen anser att vattenhandläggare i dessa län bör genomföra dammsäkerhetstillsynen samtidigt som de bedriver övrig vattenverksamhetstillsyn för dessa dammar. Tillsynen kan utföras på det sätt som beskrivs i avsnitt 10.2. Den uppskattade tiden för dammsäkerhetstillsyn är alldeles för liten för att en handläggare skulle kunna arbeta uteslutande med dammsäkerhetsfrågor. Vattenhandläggarna på berörda länsstyrelser bör i stället utbildas i dammsäkerhet. Det nedan beskrivna nätverket för dammsäkerhetshandläggare kan även vara stöd för tillsynsutövningen i dessa län.

Utredningen vill i sammanhanget understryka att det inte finns något hinder för att en särskild dammsäkerhetshandläggare utövar dammsäkerhetstillsyn även i de övriga 13 länen. Vissa av dessa län har ett stort antal dammanläggningar i konsekvensklass 2 enligt RIDAS som kan komma att klassificeras i förslagets dammsäkerhetsklass C. Bl.a. Örebro län har cirka 50 dammanläggningar i konsekvensklass 2. Utredningen bedömer emellertid att det inte är lika angeläget att dammsäkerhetskompetensen stärks i de län som endast har många dammanläggningar i den lägsta dammsäkerhetsklassen.

10.1.5. Nätverk för dammsäkerhetshandläggare och utökad samverkan

En förutsättning för effektivitet är att möjliggöra erfarenhetsutbyte dammsäkerhetshandläggarna emellan. En samlad tillsynsorganisation som utbyter erfarenheter medför också att tillsynen utförs på ett likformigt sätt i hela landet. En mer sammanhållen dammsäkerhetstillsyn ger en större förutsägbarhet för samtliga inblandande aktörer. Utredningen anser att en samlad tillsynsorganisation kan organiseras genom nära samverkan mellan dammsäkerhetshandläggarna på de utpekade länsstyrelserna. Samverkan bör konkretiseras i ett handläggarnätverk där också dammsäkerhetshandläggarna på Svenska kraftnät ingår.

Inom ramen för Svenska kraftnäts regeringsuppdrag om tillsynsvägledning, se avsnitt 5.2.5, håller formerna för ett nätverk att

bildas. Regelbundna handläggarträffar hålls med inriktning på tillsynen av dammarna med störst konsekvenser vid dammbrott. Utredningen menar att det är rätt väg att utveckla dammsäkerhetstillsynen. Ett handläggarnätverk möjliggör att likvärdiga tillsynsmetoder och bedömningar utarbetas vilket är förutsättningen för en effektiv och likvärdig tillsyn. Genom Svenska kraftnäts medverkan kan nationella metoder för tillsyn utvecklas samt internationella erfarenheter inarbetas i metoderna.

Nätverket kommer på så sätt att bestå av handläggare från såväl länsstyrelser som Svenska kraftnät med specialiserade kunskaper inom dammsäkerhetsområdet. Dessa dammsäkerhetshandläggare kan utöver att utöva dammsäkerhetstillsyn över dammarna i det egna länet ha till uppgift att bistå de andra länsstyrelserna med råd och stöd i frågor om dammsäkerhet. De kan även medverka vid tillsynsbesök i andra län än sitt eget. Möjligheten att delta i en annan länsstyrelses beredning av ärenden eller beslut är reglerat i 45 § förordningen (2007:825) med länsstyrelseinstruktion.

Dammsäkerhetshandläggare En länsstyrelse

Krisberedskapshandläggare

Vattenhandläggare

Handläggarnätverk för dammsäkerhet och

samverkan

Central

myndighetsfunktion

för dammsäkerhet

Råd och experthjälp

dammsäkerhet

21 länsstyrelser

Nätverket kan även vara ett forum för att utforma nationella tillsynsplaner samt initiera särskilda tillsynsinsatser och tillsynslyft.

Dammsäkerhetshandläggarna måste samverka med krisberedskapshandläggarna om krisberedskapsarbetet vad gäller samordnad beredskapsplanering för dammbrott i de reglerade älvarna samt vid beslut om dammsäkerhetsklass. Krisberedskapshandläggarna i de berörda åtta länen bör också ingå i handläggarnätverket. De särskilda dammsäkerhetshandläggarna kan även utgöra stöd vid beslut om farlig verksamhet enligt LSO.

För dammsäkerhetshandläggarna är det viktigt att ha ett nära samarbete med de vattenhandläggare som har ansvar för den ordinarie miljöbalkstillsynen i det egna länet. Dessa handläggare har ansvar för tillsynen av vattenverksamheten i enlighet med MB:s bestämmelser för alla vattenverksamheter inklusive dammarna i länen.

10.1.6. Koncentration av dammsäkerhetstillsyn

Utredningen har övervägt att föreslå en koncentration av dammsäkerhetstillsynen till några få länsstyrelser i stället för att låta tillsynen vara kvar på samtliga länsstyrelser. Såsom redogjorts för ovan har dock utredningen funnit att övervägande skäl talar för att låta tillsynen ligga kvar på samtliga länsstyrelser.

Koncentration av länsstyrelseverksamhet har skett tidigare. Bl.a. har tillsynen över stiftelser koncentrerats till sju länsstyrelser. Med koncentration avses åtgärder – i regel författningsändringar – för att samla ansvaret för en viss verksamhet till ett mindre antal länsstyrelser. Det innebär att dessa länsstyrelser fullgör verksamheten även i andra län än i det egna. Ansvaret avser såväl beredning som beslutsfattande inom det aktuella verksamhetsområdet.

Syftet med koncentration är att uppnå en högre effektivitet och en mer rationell användning av resurser, såväl ekonomiska som personella. Ytterligare ett syfte är att säkerställa en väl fungerande rättsäkerhet. Likformigheten kan bli lidande i de fall där flera olika myndigheten har samma uppgift men inom olika geografiska områden. Behovet av en enhetlig praxis var t.ex. ett av de bärande argumenten för att koncentrera tillsynen över stiftelser till sju länsstyrelser.

I prop. 2011/12:31 anges ett antal kriterier för koncentration som enligt regeringen är lämpade som utgångspunkt vid en analys

av en verksamhets lämplighet för koncentration. Bl.a. nämns att det bör finnas ett behov av likformigt utförande, att sambandet med länsstyrelsens kärnverksamhet är begränsat, att besöksfrekvensen är låg, att behovet av externa besök är begränsat, att behovet av lokalkännedom är begränsat, samt att verksamheten har en liten omfattning och hög komplexitet.

Dammsäkerhet är ett av länsstyrelsens verksamhetsområde med hög komplexitet. Det innebär att det är ett ansvarsområde som förutsätter en särskild kompetens hos tillsynsmyndigheten och förmåga att kunna förstå de egenkontrollsåtgärder dammägaren utför. Det förutsätter också att handläggarna kan området i fråga på ett sådant sätt att de har kompetensen att följa upp vissa frågor om anledning finns.

Dammsäkerhetstillsynen är ett tillsynsområde som har varit eftersatt och i vissa län obefintlig. Det skulle därför handla om att bygga upp ny kompetens inom länsstyrelsens organisation. Verksamheten kan därför inte sägas ha ett så nära samband med länsstyrelsernas övriga uppdrag på ett sådant sätt att det skulle utgöra hinder för en koncentration. Tillsyn av dammsäkerhet är dessutom en relativt sett liten arbetsuppgift som med färre antal länsstyrelser skulle kunna bedrivas av handläggare på heltid.

Koncentration av dammsäkerhetstillsyn till en eller ett fåtal länsstyrelser skulle även möjliggöra att de som arbetar med dammsäkerhetstillsyn skulle kunna ägna större delen av sin arbetstid till detta. Antalet handläggare per länsstyrelse skulle, med bibehållen personalstyrka, bli fler. För att uppnå ett sådant förhållande med fler handläggare på en myndighet förordar utredningen att dammsäkerhetstillsynen i stället utförs av en central myndighet, se avsnitt 10.4.

En koncentration av dammsäkerhetstillsynen förutsätter emellertid att man i föreskrift definierar dammsäkerhet på ett sådant sätt att det går att avgränsa från övrig vattenverksamhet. En sådan definition skulle vara nödvändig eftersom behörigheten för de berörda koncentrationslänen att fatta beslut avseende dammsäkerhet skulle grunda sig på den avgränsningen.

Hantering av ärenden som berör både dammsäkerhet och övrig vattenverksamhet vid en anläggning skulle med koncentrationsalternativet bli mer svårhanterliga. Vissa frågor som berör en anläggning kan avse såväl dammsäkerhets- som övrig vattenverksamhetstillsyn. Dessa frågor avgörs med fördel av en länsstyrelse

som har tillgång till båda kompetenserna och kan göra de avvägningar som krävs.

Utredningen menar också att samverkan mellan dammsäkerhetshandläggare och krisberedskapshandläggare inom ett län är viktig. Att lyfta bort dammsäkerhetstillsynen till en annan länsstyrelse skulle försämra möjligheterna till sådan samverkan.

Utredningen anser således att dammsäkerhetstillsynen inte ska koncentreras utan istället bör samverkan mellan länsstyrelser utökas.

10.1.7. Översyn av den regionala statliga förvaltningen

För närvarande pågår Utredningen om den statliga regionala förvaltningen, (Fi 2009:07). Utredningen i fråga har i uppdrag att ge förslag på hur den statliga regionala förvaltningens utformning kan bli tydligare, mer samordnad och ändamålsenlig. Översynen omfattar såväl länsstyrelseorganisationen som hur länsstyrelsens uppgift att, inom myndighetens ansvarsområde, samordna hur olika samhällsintressen och statliga myndigheters insatser i länet ska vidareutvecklas och stärkas. Utredaren ska även se över på vilket sätt länsstyrelsens roll som regional samordnare av statlig tillsyn kan vidareutvecklas. Utredarens förslag ska beakta pågående förändringar inom den statliga förvaltningen. För länsstyrelsens del skulle en sådan förändring kunna utgöras av en koncentration av viss verksamhet till ett fåtal länsstyrelser. Utredningen ska redovisa sitt uppdrag den 15 december 2012.

Utredningen om den statliga regionala förvaltningen har aviserat ett förslag om att antalet länsstyrelser ska bli betydligt färre än i dag och ha en större geografisk omfattning. Vidare har utredningen angett att samhällsskydd och krisberedskap samt statlig regional tillsyn kommer att ingå i de framtida länsstyrelsernas grunduppgifter. Förslag kan således komma att beröra dammsäkerhetstillsynen under förutsättning att den ligger kvar på länsstyrelsen.

Skulle utredningens förslag genomföras skulle det möjliggöra för samtliga länsstyrelser att låta handläggare arbeta med dammsäkerhetstillsyn på heltid. Under förutsättning att antalet handläggare inte minskar skulle antalet handläggare per länsstyrelse med en sådan lösning också bli fler. Det skulle innebära en mindre sårbar organisation och medföra goda förutsättningar för erfarenhetsutbyte.

10.2. Tillsynens utformning

I detta avsnitt beskriver utredningen sin syn på hur tillsyn bör utvecklas. Regeringen har i sin skrivelse 2009/10:794 redovisat sina generella bedömningar för hur en tillsynsreglering bör vara utformad. Av skrivelsen framgår bl.a. följande definitioner och bedömningar:

Tillsyn: Begreppet tillsyn bör främst användas för verksamhet

som avser självständig granskning för att kontrollera om tillsynsobjekt uppfyller krav som följer av lagar och andra bindande föreskrifter och vid behov kan leda till beslut om åtgärder som syftar till att åstadkomma rättelse av den objektsansvarige. Tillsynen bör vara synonym med det som i dag kallas operativ tillsyn.

Egenkontroll: Tillsynsorgan bör ha möjlighet att ålägga en

objektsansvarig ansvar för att utöva egenkontroll av sin verksamhet. Egenkontrollen och tillsynsobjektens dokumentering av egenkontrollprogram kan vara ett hjälpmedel i tillsynsorganen granskning. Samtidigt bör egenkontrollen kunna underlätta för objektsansvariga som följer regler även utan tillsynsbesök eller andra åtgärder.

10.2.1. Tillsyn av dammsäkerhet

Tillsyn av dammsäkerheten utövas som en del av vattenverksamhetstillsynen enligt MB vilket beskrivits i avsnitt 3.5.1 och 5.3.

I avsnitt 5.3.6 redogörs för utredningens bedömning om den hittills utförda dammsäkerhetstillsynens omfattning. Utredningen har funnit att den dammsäkerhetstillsyn som bedrivs inte är tillräcklig för att säkerställa att dammägarna i sin egenkontroll upptäcker och åtgärdar allvarliga svagheter och brister.

10.2.2. Vilka dammar kräver särskild dammsäkerhetstillsyn?

Det bör betonas att alla dammar är tillsynsobjekt inom ramen för den allmänna tillsynen över vattenverksamheter och -anläggningar. I detta ligger naturligtvis också en allmän dammsäkerhetstillsyn. Utredningen har emellertid konstaterat att den tillsyn som hittills bedrivits vad gäller dammsäkerhet är klart otillräcklig. I fråga om

4 En tydlig, rättssäker och effektiv tillsyn (Skr. 2009/10:79).

dammar där konsekvenserna av dammbrott kan beskrivas som försumbara är det med hänsyn till samhällets knappa tillsynsresurser inte möjligt att kräva mer omfattande tillsynsutövning än den som innefattas i den allmänna vattenverksamhetstillsynen. Med hänsyn till den skärpta säkerhetskultur som numera kan anses råda i samhället är det däremot utredningens uppfattning att dammanläggningar i de föreslagna dammsäkerhetsklasserna A, B och C kräver en särskild dammsäkerhetstillsyn. Antalet anläggningar i dessa klasser bedöms som tidigare nämnts uppgå till drygt 500. Konsekvenserna av ett dammbrott vid sådana anläggningar som bedöms hamna i dammsäkerhetsklass A, B och C skulle bli så stora att tillsynen över dessa förutsätter en särskild kompetens. För att tillsynen över dessa anläggningar ska bli tillräckligt effektiv och omfattande behöver tillsynen avsevärt förbättras. Omfattningen av tillsynsåtgärder måste öka och kompetensen hos de som utför tillsynen behöver förbättras i fråga om dammsäkerhet. Det innebär att såväl resurser som sakkunskap behöver tillföras länsstyrelseorganisationen i förhållandevis stor omfattning.

Utredningen menar att det för dessa dammar finns ett behov och är lämpligt att skilja ut dammsäkerhetstillsynen från övrig vattenverksamhetstillsyn. Kompetensen för dammsäkerhetstillsyn skiljer sig i vissa delar från den kompetens som krävs för övrig vattenverksamhetstillsyn. Vilken kompetens som enligt utredningen krävs för dammsäkerhet återkommer vi till i avsnitt 10.3.

10.2.3. Dammsäkerhet som eget tillsynsområde

Länsstyrelserna har ett tidredovisningssystem, Verksamhets- och ÄrendeStruktur, VÄS, som används av handläggarna för planering och tidsredovisning av olika verksamhetsområden. Tillsyn av vattenverksamhet har i nuläget enbart en kod i systemet.

Utredningen förslår att en särskild kod för tillsyn av dammsäkerhet införs. Om en sådan kod finns tillgänglig möjliggörs uppföljning och planering dammsäkerhetstillsyn för sig.

I samband med att dammanläggningarna har klassificerats i enlighet med förslaget i kapitel 8 och det nya regelverket träder i kraft bör tillsynen över dessa anläggningar avsevärt förbättras för att bli mer effektiv och omfattande. Utredningen menar att det för dessa dammanläggningar är lämpligt att utveckla dammsäkerhetstillsyn som ett eget tillsynsområde som särskiljs från övrig vatten-

verksamhetstillsyn. Tillsynen över övrig vattenverksamhet samt hantering av anmälningsärenden enligt 11 kap. 9 a § MB ska utföras som i dag på samtliga länsstyrelser.

10.2.4. Planering och uppföljning av dammsäkerhetstillsyn

I miljötillsynsförordningen anges att en operativ tillsynsmyndighet för varje verksamhetsår ska upprätta en samlad tillsynsplan som omfattar myndighetens ansvarsområde enligt MB. I 1 kap. 10 § i nyss nämnda förordning anges vidare att en statlig operativ tillsynsmyndighet i den samlade tillsynsplanen ska beskriva hur myndigheten har avvägt fördelningen av resurser inom och mellan olika ansvarsområden enligt MB och hur resurserna har anpassats efter det tillsynsbehov som finns. Enligt 12 § i samma kapitel ska en operativ tillsynsmyndighet årligen följa upp och utvärdera sin tillsynsverksamhet. Utredningen anser att dammsäkerhetstillsynen kan bedrivas mer systematiskt i enlighet med vad som anges i miljötillsynsförordningen genom en mer planerad verksamhet. Det kan ske redan med dagens reglering. För att bidra till en hög dammsäkerhet bör tillsynen bedrivas

så att den

  • prioriterar det som är viktigt ur dammsäkerhetssynpunkt,
  • fångar upp brister utifrån ett dammsäkerhetsperspektiv,
  • stimulerar dammägaren till ambitiöst dammsäkerhetsarbete och
  • ger allmänheten möjlighet till insyn.5

Utredningen anser att tillsyn över dammsäkerhet ska bedrivas genom såväl skrivbordstillsyn som tillsynsbesök. Tillsynen bör utgå från den årliga dammsäkerhetsrapporteringen men även utifrån annan rapportering. Driftstörningar som enligt egenkontrollförordningen ska rapporteras till tillsynsmyndigheten kan ge anledning att vidta tillsynsåtgärder. Tillsynen bör enligt utredningen bedrivas i fyra steg:

1. Planera tillsynsverksamheten

2. Skrivbordstillsyn av dammsäkerhetsrapportering

5 Svenska kraftnäts Handbok om tillsyn och egenkontroll.

3. Planera och genomför tillsynsbesök

4. Utvärdera, dokumentera och rapportera

Planering av tillsynen

Den övergripande planeringen handlar om att driva dammsäkerhetsarbetet i relation till andra frågor inom länsstyrelsen ansvarsområde. Det handlar också om att planera och prioritera verksamheten utifrån tillgängliga resurser.

Planering

av tillsynsverksamheten innebär också att fördela

resurserna mellan skrivbordstillsyn, tillsynsbesök och andra typer av tillsyn samt mellan olika dammanläggningar. Vid begränsade resurser för tillsyn är det även viktigt att planera tillsynen utifrån de tillsynsobjekt som är mest angelägna att kontrollera. Planeringen bör dokumenteras i en tillsynsplan.

Skrivbordstillsyn av dammsäkerhetsrapportering

En viktig del av tillsynsmyndighetens arbete är den skrivbordstillsyn som bedrivs för att granska inkommande rapporter, genomföra analyser samt återrapportera till dammägarna. Med skrivbordstillsyn menas tillsyn där handläggaren inte träffar någon verksamhetsutövare utan baserar tillsynen på dokumentation, statistik och rapportering.

Den rapportering som ska granskas och analyseras är främst den årliga dammsäkerhetsrapporteringen som föreslås i avsnitt 9.4. Tillsynsmyndigheten kontaktar dammägaren om det finns behov av kompletteringar, klargöranden eller för att få mer information om planerade åtgärder m.m. Med analyserna som underlag kan myndigheten planera vilka speciella tillsynsinsatser som ska göras. Tillsynsplanen kan justeras så att tillsynsbesök genomförs där de gör mest nytta.

Skrivbordstillsynen bör avslutas med ett skriftligt meddelande eller beslut riktat till dammägaren beroende på om ytterligare uppgifter krävs eller om åtgärder ska vidtas. Även om tillsynsmyndigheten inte har några synpunkter på innehållet i rapporteringen bör ett meddelande om detta sändas till ägaren.

Tillsynsbesök

Länsstyrelsen kan vid tillsynsbesök granska verksamhetsutövarens rutiner för egenkontroll av dammsäkerhet och rutinernas efterlevnad. Besöket kan även avse granskning av en anläggnings dammsäkerhetsdokument och planer som ska upprättas inom ramen för verksamhetsutövarens egenkontroll. Syftet med tillsynsbesöken ska vara att få insyn i en verksamhetsutövares säkerhetsledningssystem, dokumentation eller bedömning av dammsäkerheten vid en anläggning. Ett tillsynsbesök innebär att tillsynshandläggaren måste bedöma nivån på dammägarens egenkontroll och relatera den nivån till lagstiftningens krav. I bedömningen kan det också ingå att ta hänsyn till dammägarens utveckling över tid. Det är inte tillsynsmyndighetens primära uppgift att själv granska anläggningen. Det huvudsakliga ansvaret för säkerheten åligger alltid dammägaren. Tillsynsbesök kan med fördel genomföras i samband med redovisningen av helhetsbedömningen av en anläggnings säkerhet, se förslag i avsnitt 9.3.

Utvärdera, dokumentera och rapportera

Länsstyrelserna ska dokumentera genomförd tillsyn och regelbundet utvärdera den. En gång om året ska länsstyrelserna rapportera till Svenska kraftnät. Rapporteringen bör innehålla beskrivning av genomförd skrivbordstillsyn, genomförda tillsynsbesök och andra eventuella tillsynsinsatser samt tillsynsmyndighetens bedömning av dammägarnas egenkontroll av dammsäkerheten. Om länsstyrelserna planerar några särskilda tillsynsinsatser under nästkommande år bör det också beskrivas. Även händelsestyrd tillsyn ska inkluderas i rapporteringen.

10.2.5. Pågående utvecklingsarbete för dammar med särskilt stora konsekvenser

I regleringsbrev för år 2011 och 2012 har Svenska kraftnät fått i uppdrag att vidareutveckla tillsynsvägledningen i de delar som ryms inom ramen för befintliga regelverk och uppdrag, vilket redovisats i avsnitt 5.2.5. Svenska kraftnät har 2011 upprättat en plan för ett förstärkt arbete med tillsynsvägledning för dammsäkerhet. Planen ger en beskrivning av bakgrunden till dagens dammsäkerhetstillsyn,

utgångspunkter för förstärkt tillsynsvägledning för dammar med särskilt stora konsekvenser och ökade insatser för kompetensutveckling. Planen innehåller dessutom en handlingsplan i tre huvudsakliga delar:

1. Kartläggning av dammar med särskilt stora konsekvenser och tydliggörande av ansvaret för dessa

2. Förstärkt tillsynsvägledning genom metodutveckling och dokumentation av processer och rutiner för förstärkt myndighetsinsyn och dammsäkerhetstillsyn

3. Insatser för kompetensutveckling inom älv- och dammsäkerhetsområdet för personal vid länsstyrelser m.fl.

Kartläggningen av dammar med särskilt stora konsekvenser i händelse av dammbrott har redan genomförts och cirka 25 dammanläggningar har identifierats. Dammanläggningar finns i de sju länen, Norrbottens, Västerbottens, Jämtlands, Västernorrlands, Dalarnas, Värmlands och Västra Götalands län. Det är länsstyrelserna i dessa län som medverkar i utvecklingsarbetet. Detta utvecklingsarbete kan utgöra grunden för det handläggarnätverk för dammsäkerhet som utredningen i avsnitt 10.1.5 föreslår.

Vidareutvecklingen av tillsynsvägledningen för dammar med särskilt stora konsekvenser vid dammbrott genomförs under en utvecklings- och provperiod för förstärkt myndighetsinsyn och rutiner för dammsäkerhetstillsyn i samverkan mellan Svenska kraftnät, Svensk Energi, berörda dammägare och berörda länsstyrelser (2011–2013). Under utvecklings- och provperioden utvecklas former och rutiner för utökad säkerhetsrapportering från dammägare till myndigheterna, myndighetsuppföljning av säkerhetsrapportering, samt myndighetsmedverkan vid kvalificerad tillståndskontroll och revisioner. Svenska kraftnät utvecklar förslag på arbetsmetoder som provas och utvärderas i samråd med dammägare och länsstyrelser. Svenska kraftnät stödjer berörda länsstyrelser med dammsäkerhetskompetens och medverkar så långt som möjligt vid tillsynsaktiviteterna.

Under 2012 genomförs det första provåret där utökade dammsäkerhetsrapporter upprättas av dammägarna för ett antal dammanläggningar och skickas till tillsynsmyndigheten. Därefter genomförs tillsynsbesök där vatten/dammsäkerhetshandläggaren och dammägaren diskuterar rapportens innehåll, anläggningens dammsäkerhets-

status och läget avseende samordnad beredskapsplanering för dammbrott. Vid vissa tillsynsbesök har även en representant från räddningstjänsten och en krisberedskapshandläggare på länsstyrelsen medverkat.

10.2.6. Resursbehov

Tillsyn av dammar i dammsäkerhetsklass A, B och C

Den dammsäkerhetstillsyn som enligt utredningen ska utföras för dammanläggningar i dammsäkerhetsklass A–C kommer att kräva en förstärkning av resurser. För de länsstyrelser som ansvarar för tillsyn över dammanläggningar i dammsäkerhetsklass A kräver den föreslagna tillsynen personal som uteslutande eller under majoriteten av sin tid arbetar med dammsäkerhetsfrågor. Det är en tydlig ambitionshöjning jämfört med i dag då handläggarna arbetar med dammsäkerhetstillsyn som en sidoverksamhet bland många andra arbetsuppgifter.

Utredningen har gjort en uppskattning av de resurser som krävs för den operativa tillsynen av dammsäkerhet. Uträkningarna är gjorda utifrån att antalet dammanläggningar i dammsäkerhetsklass A kommer uppgå till 25, klass B 200 och klass C 300. Dessa uträkningar baseras på det ungefärliga antalet dammanläggningar i konsekvensklasserna 1A, 1B och 2 enligt RIDAS. Se mer om detta i avsnitt 2.5. Övrig vattenverksamhetstillsyn ska också utföras vid dessa anläggningar. Resurser för den tillsynen har inte utretts.

För att planera tillsynsverksamheten, granska den årliga dammsäkerhetsrapporteringen, genomföra olika analyser och tillsynsbesök, återkoppla till dammägaren samt följa upp och rapportera bedömer utredningen att tillsynen bör uppgå till:

  • tre veckor per dammanläggning i dammsäkerhetsklass A,
  • en vecka per dammanläggning i dammsäkerhetsklass B och
  • en dag per dammanläggning i dammsäkerhetsklass C.

Den angivna tidsåtgången utgör planerbar tillsyn per år. Som framgår i tabell 10.1 kommer den sammanlagda tiden för planerbar tillsyn uppgå till sju årsarbetskrafter i hela landet. Utöver den planerbara tillsynsverksamheten kommer viss händelsestyrd tillsyn behöva bedrivas. Utredningen bedömer att den händelsestyrda

tillsynen för dammanläggningar i dammsäkerhetsklass A–C kommer uppgå till två årsarbetskrafter. Det innebär att den sammanlagda personalstyrkan för dammsäkerhetstillsyn över dammanläggningar i klass A, B och C bör uppgå till nio årsarbetskrafter.

Som tidigare nämnts ska de styrande principerna som anges i avsnitt 8.2.1 utgöra grunden för tillsynens omfattning. För dammanläggningar i dammsäkerhetsklass A är det angeläget att tillsynens utförs på ett sådant sätt att brister upptäcks och åtgärdas. Det kräver en mer ingående granskning och analys av inskickade rapporter och material samt kontakt med ägaren. Utredningen har därför funnit att tre veckor för tillsyn är skäligt.

För de sju länen med dammanläggningar i dammsäkerhetsklass A utgör tiden för dammsäkerhetstillsyn mellan en halv till en årsarbetskraft per länsstyrelse. Detta medför enligt utredningen att minst en dammsäkerhetshandläggare bör finnas på länsstyrelsen i de länen för att genomföra dammsäkerhetstillsynen samt övriga arbetsuppgifter relaterade till dammsäkerhet på dammanläggningarna i dammsäkerhetsklass A, B och C. Tiden för dammsäkerhetstillsyn i dessa län samt Gävleborg uppgår totalt till cirka sex av de sju planerbara årsarbetskrafterna som beräknats ut för landet i sin helhet.

För länen i södra och sydöstra Sverige innebär dammsäkerhetstillsynen upp till 0,2 årsarbetskrafter per län. Örebro län med relativt många dammanläggningar i dammsäkerhetsklass C är det län av de södra länen med störst tid för dammsäkerhetstillsyn, 0,3 årsarbetskrafter. Tiden för dammsäkerhetstillsyn i dessa län uppgår totalt till ungefär en av de sju årsarbetskrafterna som beräknats ut för landet i sin helhet.

I redovisningen av regeringsuppdraget Fi2008/30936 beskrivs den Seveso-tillsyn som länsstyrelserna bedriver. Det finns enligt utredningen likheter med den Sevesotillsyn som bedrivs och den tillsyn som föreslås avseende dammsäkerhet i betänkandet. Tillsynen styrs enligt redovisningen av särskilda regler samt är välorganiserad och planerad från statliga myndigheter som också svarar för gemensam statistik och uppföljning av området. Det finns cirka 400 tillsynsobjekt i landet varav cirka 200 i den högre kravnivån och cirka 200 i den lägre kravnivån. Tillsynen som bedrivs uppgår till sammanlagt

6 Länsstyrelsernas Tillsyn – dagsläge, möjliga förbättringar, framtidsutsikter, Fi2008/3093.

sju årsarbetskrafter. Tillsynstid per objekt varierar mellan en och fem dagar, men de flesta län använder cirka två till fyra dagars tillsynstid per objekt per år.

Den föreslagna tillsynstiden på tre veckor, en vecka eller en dag per dammanläggning i respektive dammsäkerhetsklass A, B och C förefaller således rimlig.

Dammsäkerhetstillsyn av gruvdammar

Gruvdammar är vattenanläggningar och bör enligt utredningen klassificeras enligt dammsäkerhetsklassificeringssystemet, se kapitel 8. Dessa dammanläggningar omfattas av förordningen om utvinningsavfall och tillsyn utövas av länsstyrelsen även med stöd av denna förordning. Det är därför viktigt att tillsynen samordnas.

Dammsäkerhetstillsyn av övriga dammar

För dammar som inte enligt särskilt beslut tillhör dammsäkerhetsklass A, B eller C, föreslås tillsynen bedrivas på samma sätt som i dag dvs. en handläggare utför tillsynen av all vattenverksamhet, inklusive dammsäkerhet, vid dammanläggningen. För dessa dammar anser utredningen att det inte behövs någon särskild dammsäkerhetskompetens för att utföra tillsynen vid dammen. Däremot bör handläggarna ha en generell kunskap om dammsäkerhet. Svenska kraftnät och HaV bör hålla gemensamma utbildningar för vattenhandläggare vid länsstyrelserna.

10.3. Kompetensprofil för dammsäkerhetshandläggare

Utredningen har föreslagit att tillsynen över dammsäkerhet även i fortsättningen ska bedrivas av länsstyrelsen. De län där det finns dammanläggningar i dammsäkerhetsklass A bör enligt utredningen ha en särskild dammsäkerhetshandläggare. För att bedriva en effektiv och rättssäker dammsäkerhetstillsyn bör en sådan särskild handläggare ha kompetens om:

  • Dammteknik och dammsäkerhetsarbete
  • Tillsynsmetodik
  • Juridik

En dammsäkerhetshandläggare måste i första hand ha kompetens inom området dammteknik och dammsäkerhetsarbete. Därutöver behöver handläggaren en sådan kunskapsnivå att han eller hon kan avgöra när andra kompetenser behöver rådfrågas.

Dammteknik och dammsäkerhetsarbete

Den kanske viktigaste komponenten i dammsäkerhetshandläggares kompetens är ingenjörskunskaper om dammbyggnad och dammsäkerhet. En civilingenjörsexamen i väg och vattenbyggnad eller samhällsbyggnad är en lämplig utbildning för en dammsäkerhethandläggare. Utöver en lämplig utbildning behöver en dammsäkerhetshandläggare även viss arbetslivserfarenhet av dammsäkerhetsarbete.

Ur förtroendesynpunkt är det också viktigt att tillsynshandläggaren har grundläggande kunskap och ingenjörskompetens inom dammbyggnad, modernt dammsäkerhetsarbete och den utveckling som sker nationellt och internationellt. En handläggare som inte är kunnig inom dammsäkerhetsområdet kan ha svårare att skapa förtroende och få genomslag för de förändringar han eller hon föreslår.

Kunskap om dammägarnas verksamhet, organisation och kultur är en viktig del av dammsäkerhetshandläggarens kompetens. Handläggaren måste kunna bedöma vad som är lämpliga åtgärder att vidta. Det förutsätter en förmåga att kunna värdera vad som kan förändras och lägga tyngdpunkten på de åtgärder som skulle kunna göra mest nytta.

Tillsynsmetodik

Med tillsynsmetodik avses förmågan att tillämpa en procedur för tillsynen. Det innefattar bl.a. praktisk administration såsom att utforma tillsynsplaner och tillsynsprotokoll på ett korrekt sätt. Utformning av rutiner för tillsynsproceduren för att säkra kontinuiteten omfattas också. Ur rättssäkerhetsperspektiv är den administrativa kompetensen viktig. En rättssäker procedur skapar förtroende och bäddar därmed också för en högre effektivitet.

Juridik

Alla handläggare behöver en juridisk kompetens för att kunna tolka hur lagar, förordningar och föreskrifter bör tillämpas generellt och i det enskilda fallet. Utöver en övergripande förvaltningsrättslig kompetens behöver handläggaren särskild kunskap om det regelverk som reglerar dammsäkerhet i sak.

10.4. En central dammsäkerhetsmyndighet med tillsynsansvar

Utredningens bedömning: Ett alternativ till ovanstående

myndighetsorganisation är enligt utredningen att bilda en central tillsynsmyndighet för dammsäkerhet. Myndigheten i fråga skulle ha ansvar för dammsäkerhetstillsyn över samtliga anläggningar i dammsäkerhetsklass A–C. Utöver tillsynsansvaret skulle myndigheten även svara för de uppgifter som utredningen föreslagit att den tillsynsvägledande och främjande myndigheten skulle ha. En dammsäkerhetsmyndighet skulle således ha ansvar för alla dammsäkerhetsuppgifter. Fördelen med denna form av organisation är att kompetens och resurser samlas vilket skulle medföra en tydlig, rättssäker och effektiv tillsyn. Det skulle innebära behov av en personalstyrka på cirka 10–12 årsarbetskrafter.

Utredningen har övervägt att i stället för att låta ansvaret för dammsäkerhetstillsynen ligga kvar på samtliga länsstyrelser skapa en central dammsäkerhetsmyndighet. En sådan dammsäkerhetsmyndighets ansvar skulle vara att bedriva dammsäkerhetstillsynen

över de drygt 500 dammanläggningar som hör till dammsäkerhetsklass A–C. Utöver tillsynsansvaret skulle den centrala dammsäkerhetsmyndigheten även ha tillsynsvägledningsansvar för länsstyrelsens operativa dammsäkerhetstillsyn över de övriga dammarna. Rollen som tillsynsvägledande myndighet skulle fortfarande finnas men själva tillsynsvägledningen kunde begränsas i och med att myndigheten själv utför dammsäkerhetstillsynen.

Det skulle kunna övervägas att enbart flytta över tillsynen av dammanläggningarna i dammsäkerhetsklass A eller i dammsäkerhetsklass A och B till den centrala myndigheten. Länsstyrelsen skulle då ha fortsatt ansvar för dammsäkerhetstillsynen över de dammarna i dammsäkerhetsklass B och C samt övriga dammar. Organisationsmodell förutsätter oavsett lösning en samverkan med länsstyrelserna avseende tillsyn. Tillsynsansvaret för vattenverksamheten i övrigt vid anläggningarna skulle även i fortsättningen ligga kvar på länsstyrelsen.

Kompetens och resurser

Alternativet med en central dammsäkerhetsmyndighet skulle omfatta 10–12 årsarbetskrafter. Det skulle behövas en successiv uppbyggnad av personal med dammsäkerhetskompetens, tillsynskompetens, krisberedskapskompetens och juridisk kompetens. Placeringen av myndigheten bör bestämmas delvis utifrån möjligheten att rekrytera personal till myndigheten.

Finansiering

En central dammsäkerhetsmyndighet skulle kunna finansieras med en kombination av avgifter från verksamhetsutövarna och anslag från staten, på samma sätt som Strålsäkerhetsmyndigheten finansieras.

Alla uppgifter på en myndighet?

Lämpligheten av att ha tillsyns- och främjandeuppgift på samma myndighet kan emellertid ifrågasättas7. Likaså kan ifrågasättas att en tillsynsmyndighet också är normgivande. Att främjande och normering sköts av en och samma myndighet förutsatt att den inte samtidigt har ett ansvar för tillsyn eller utvärdering finns det dock enligt Förvaltningskommittén inga skäl som talar emot.

Strålsäkerhetsmyndigheten har i dag ansvar för tillsyn, tillsynsvägledning och normgivning inom ramen för strålsäkerheten i landet. Ansvaret för strålsäkerheten ligger helt på den som bedriver verksamhet med strålning, på samma sätt som att ansvaret för dammsäkerheten ligger helt hos dammägaren. Strålsäkerhetsmyndighetens uppgift är att övervaka att den ansvarige bedriver verksamheten på ett säkert sätt. Utöver normgivning och tillsyn samordnar myndigheten den nationella strålskyddsberedskapen och bidrar till kunskapsuppbyggnad genom att finansiera forskning. Strålsäkerhetsmyndigheten är dessutom tillsynsvägledande myndighet avseende exempelvis röntgenstrålning m.m. Trots de olika rollerna säger sig myndigheten inte uppleva några konflikter.

Internationell utblick

Vid en internationell jämförelse kan konstateras att många länder har en specialiserad nationell myndighet som utövar tillsyn över i vart fall stora dammar eller dammar med stora konsekvenser vid dammbrott. Många länder som har särskild dammsäkerhetsreglering har dessutom en särskild central myndighetsorganisation som har till uppgift att se till att regleringen följs. Antingen utgör myndighetsfunktionen en del av en annan myndighet eller en egen. Myndighetsfunktionen ligger under olika departement i olika länder, beroende på vilken verksamhet som bedrivs, men det finns ofta en koppling till verksamheten, dvs. dammens användningsområde. För Sveriges del där mer än 95 procent av dammarna som skulle medföra stora konsekvenser i händelse av ett dammbrott är vattenkraftdammar är det naturligt att en sådan myndighet skulle ligga under det departement som har ansvar för energifrågorna, dvs. Näringsdepartementet.

7 Förvaltningskommittén, Styra och ställa – förslag till en effektivare statsförvaltning, SOU 2008:118.

Egen myndighet eller del av myndighet?

En central dammsäkerhetsmyndighet skulle bli en mycket liten myndighet. Man kan därför överväga att slå ihop ett antal myndighetsfunktioner från andra myndigheter till en ny myndighet. Det ligger då nära tillhands att se till de tillsynsuppgifter som utförs inom elområdet.

I Sårbarhets- och säkerhetsutredningens betänkande Säkerhet i en ny tid, SOU 2001:41, föreslogs att Energimyndighetens nätavdelning och beredskapsfunktionen inom Svenska kraftnät skulle läggas samman med Elsäkerhetsverket till en ny myndighet.8 Den nya myndigheten skulle ha ett samlat ansvar för tillsynsfrågor inom elområdet. Myndigheten skulle också fungera som en central förvaltningsmyndighet för dammsäkerhetsfrågor.

Av betänkandet framgår att den föreslagna tillsynsmyndigheten skulle ansvara för samtliga tillsynsuppgifter inom elområdet samt de tillsynsuppgifter som skulle bli följden av de skärpningar av ellagen som utredningen föreslog. Utredningen menade att sammanläggningen borde medföra att vissa synergieffekter uppstod vid samutnyttjandet av teknisk och annan kompetens. En samordning av tillsynsfunktionerna inom elområdet skulle medföra att bättre förutsättningar skapas för en effektiv administration av verksamheten. Den största fördelen enligt Sårbarhets- och säkerhetsutredningen var att förutsättningar skapades för en samordnad och kraftfull tillsynsverksamhet inom elområdet. Sårbarhets- och Säkerhetsutredningen rekommenderade dessutom att en organisationskommitté skulle tillsättas för att förbereda den nya myndighetens arbetsuppgifter.

Ovanstående lösning är enligt utredningen lämplig om man vill uppnå en kompetent och effektiv tillsynsmyndighet på elområdet. Alternativet måste dock ytterligare utredas.

Svenska kraftnäts myndighetsuppgifter inom säkerhetsskydd, elberedskap och dammsäkerhet skulle kunna flyttas till en ny myndighet. Samtidigt skulle även tillsynsansvaret för dammarna i dammsäkerhetsklass A–C kunna överföras från länsstyrelserna till den nya myndigheten.

8SOU 2001:41, s. 338.

10.5. Jämförelse mellan de olika alternativen

Vilket myndighetsorganisationsalternativ gagnar dammsäkerheten?

En expertmyndighet med tillsynsansvar skulle vara den bästa myndighetslösningen för dammsäkerheten. Myndigheten skulle kunna utveckla metoder för tillsynen och utföra tillsynen parallellt. Myndigheten skulle kunna utvecklas till en stark myndighet genom att all myndighetskompetens kan samlas istället för att vara utspridd på olika myndigheter och verk.

Vilket alternativ för myndighetsorganisation är mest tydligt och rättssäkert?

Länsstyrelsealternativet skulle på ett nationellt plan vara mest rättssäkert eftersom det skulle vara en tydlig uppdelning med främjande och normerande på den centrala myndighetsfunktionen och tillsyn på länsstyrelsen.

Vad gäller rättssäkerheten gentemot dammägare i olika delar av landet så är en central expertmyndighet med tillsynsansvar att föredra.

Vilket myndighetsorganisationsalternativ är mest effektivt?

För större tillsynsområden som omfattar flera hundratals personer är det viktigt att upprätta myndighetsstrukturer där någon instans är normerande och uppföljande medan en annan instans är utförande och rapporterande. Dammsäkerhet är ett relativt begränsat tillsynsområde som inte kräver mer än cirka nio årsarbetskrafter för tillsyn i hela landet. För dammsäkerheten är det viktigt att hålla samman de få handläggare som arbetar med området. För att uppnå en mer sammanhållen organisation skulle därför en expertmyndighet vara att föredra.

Det skulle dessutom underlätta för verksamhetsutövarna att ha en myndighetskontakt med dammsäkerhetskompetens, istället för att ha olika kontakter i olika län som ofta saknar specifik dammsäkerhetskompetens.

Vilket myndighetsorganisationsalternativ är enklast att införa?

At låta tillsynsansvaret ligga kvar på länsstyrelsen är en snabb och smidig lösning. För att dammsäkerhetstillsynen ska förbättras förutsätter det att länsstyrelsen kan rekrytera personal med dammsäkerhetskompetens som dessutom ges möjlighet att arbeta uteslutande med den dammsäkerhetstillsyn som beskrivs i betänkandet. På sikt tror emellertid utredningen att en ny myndighet inom elberedskaps- och dammsäkerhetsområdet med tillsynsansvar skulle gagna dammsäkerheten mer. En sådan ändring är mer omfattande och tar tid.

Ett skäl till att flytta över tillsynsansvaret från länsstyrelsen till en central myndighet skulle kunna vara om regionindelningen till färre länsstyrelser inte genomförs, se avsnitt 10.1.7. Om staten vill försäkra sig om att dammsäkerhetstillsynen utförs i tillräcklig omfattning av en tillsynsmyndighet med erforderlig kompetens finns möjligheten att då skapa en ny myndighet.

11. Tillsynsvägledning och främjande av dammsäkerhet

11.1. En myndighet för tillsynsvägledning för och främjande av dammsäkerhet

Utredningen har i uppdrag att utreda och utvärdera om tillsynsvägledningen och övriga uppgifter inom Svenska kraftnäts samlade uppdrag att främja dammsäkerheten i landet bedrivs genom lämplig organisation eller bör inordnas i någon annan myndighets organisation. Utredningen ska även, om lämpligt, föreslå överföring av tillsynsvägledning avseende dammsäkerhet till en annan myndighet.

Upprätthållande av en god dammsäkerhet berörs av flera olika regelverk. Dammar, slussar och skyddsvallar är enligt MB vattenanläggningar vars tillståndsprövning och tillsyn regleras i bl.a. balken. Skulle någon av dessa anläggningar haverera krävs enligt bl.a. LSO att samhället genom kommuner och länsstyrelser har en beredskap och en räddningstjänst som kan utföra effektiva räddningsinsatser. Vidare är kraftverksdammar av central betydelse för landets elförsörjning varför det kan krävas åtgärder enligt elberedskapslagen. Dammsäkerhet är därmed ett område som berör olika regelverk och ansvariga myndigheter vilket medför att placeringen av en central myndighetsfunktion för dammsäkerhet inte är självklar såvida statsmakterna avstår från det i föregående kapitel redovisade alternativet att tillskapa en central dammsäkerhetsmyndighet med tillsynsansvar.

Dammsäkerhet berör främst myndigheter som Svenska kraftnät, HaV och MSB. HaV har tillsynsvägledningsansvar för länsstyrelsernas tillsyn av vattenverksamhet vilket till en del innefattar dammsäkerhet. MSB har ansvar för frågor om skydd mot olyckor, krisberedskap och civilt försvar. Dessa ansvarsområden har ett nära samband med beredskapsplanering för dammbrott. Svenska kraftnät, som har haft den centrala myndighetsfunktionen för damm-

säkerhet sedan 1998, har även andra närliggande myndighetsuppgifter, såsom tillsynsmyndighet för elberedskap och säkerhetsskydd för elförsörjningen. Enligt sin instruktion har Svenska kraftnät även i uppgift att verka för att riskerna för en allvarlig störning på samhället genom omfattande störningar inom elförsörjningen, naturgasförsörjningen och dammbrott eller höga flöden minskar.

Utredningen menar att uppgiften att vara tillsynsvägledande och främjande myndighet för dammsäkerhet ska ligga på någon av dessa ovanstående myndigheter. Vid en jämförelse myndigheterna emellan har utredningen utgått från att den viktigaste aspekten ur dammsäkerhetssynpunkt är att arbetsuppgifterna med tillsynsvägledning samt främjande av såväl kunskapsutveckling och kompetensförsörjning som beredskapsplanering för dammbrott, utförs enhetligt och samlat. En samlad personalgruppering på en myndighet möjliggör en fortgående positiv dammsäkerhetsutveckling i landet. En splittring av de ingående uppgifterna på olika myndigheter skulle missgynna dammsäkerhetsutvecklingen. Dammsäkerhet behöver ses som ett särskilt kompetensområde som bör hållas ihop. Ett sammanhållet dammsäkerhetsarbete är en förutsättning för att bygga upp en myndighetsfunktion som driver utvecklingen inom området. En samlad central myndighetsfunktion har även möjligheten att rekrytera kompetenta medarbetare.

11.2. Myndighetsfunktion på Svenska kraftnät

Utredningens bedömning och förslag: Uppgiften att främja

dammsäkerheten inkluderat den tillsynsvägledande rollen avseende dammsäkerhet ska ligga kvar på Svenska kraftnät. Utredningen har inte kunnat finna några övervägande skäl till att uppgifterna ska överföras till annan myndighet.

En organisatoriskt sammanhållen enhet med ansvar för beredskap och säkerhet inom elområdet är gynnsam. Svenska kraftnät har som organisation möjlighet att ansvara för alla arbetsuppgifter som den centrala myndighetsfunktionen för dammsäkerhet bör driva, vilket utredningen anser vara en förutsättning för god utveckling inom området. Möjligheterna att rekrytera personer med dammsäkerhetskompetens till Svenska kraftnät bedöms som goda.

Svenska kraftnät ska som central myndighetsfunktion för dammsäkerhet fortsätta utföra de tillsynsvägledande och främj-

ande arbetsuppgifterna som Svenska kraftnät utför i dag i enlighet med verkets instruktion. Instruktionen för Svenska kraftnät ska justeras och kompletteras med ett antal arbetsuppgifter. Med stöd av befintligt regelverk ska den centrala myndighetsfunktionen för dammsäkerhet på Svenska kraftnät:

  • Samverka med länsstyrelser för att åstadkomma ett effektivt tillsynsarbete
  • Utöka uppföljning av genomförd tillsyn
  • Utöka kompetensutveckling för länsstyrelserna
  • Sprida erfarenheter av inträffade händelser

Svenska kraftnät ska bemyndigas att meddela ytterligare föreskrifter om dammägarnas egenkontroll och dammsäkerhetsrapportering. Svenska kraftnät bör även ges i uppdrag att utreda formerna för och utveckla ett system för dammsäkerhetsrapportering.

Det ska tydliggöras i 3 kap. 3 § miljötillsynsförordningen att Svenska kraftnäts ansvar för tillsynsvägledning avseende dammsäkerhet avser hela MB.

De utökade arbetsuppgifterna medför att den totala arbetsbördan för den centrala myndighetsfunktionen för dammsäkerhet på Svenska kraftnät bör uppgå till sex årsarbetskrafter. Dammsäkerhetshandläggare på Svenska kraftnät behöver ha kompetens inom framförallt dammbyggnad och dammsäkerhetsarbete, men även inom tillsynsmetodik och juridik.

11.2.1. Nuvarande roll och verksamhet

Svenska kraftnät är ett statligt affärsverk som sorterar under Näringsdepartementet. Ett affärsverk är ett statligt organ som producerar varor eller utför tjänster utifrån affärsmässiga principer. Staten har således ett avkastningskrav på Svenska kraftnät. Affärsverket är en förvaltningsmyndighet.

Övergripande ansvar och uppdrag

Enligt instruktionen för Svenska kraftnät har affärsverket till uppgift att på ett affärsmässigt sätt förvalta, driva och utveckla ett kostnadseffektivt, driftsäkert och miljöanpassat kraftöverföringssystem, sälja överföringskapacitet samt i övrigt bedriva verksamheter som är anknutna till kraftöverföringssystemet.

Svenska kraftnät förvaltar och driver stamnätet, vilket utgörs av kraftledningar för 220 kV och 400 kV med tillhörande anläggningar samt utlandsförbindelser. Svenska kraftnät har ett systemansvar, som innebär att övervaka och ansvara för att det kortsiktigt är balans mellan tillförd och uttagen el i det svenska elsystemet. Till detta ansvar hör också att se till att elsystemets anläggningar samverkar på ett driftsäkert sätt. Sedan år 2005 har Svenska kraftnät även ett motsvarande systemansvar för naturgas. För att övervaka och styra stamnätet har Svenska kraftnät byggt ett landsomfattande telenät.

Svenska kraftnät är ansvarig myndighet för landets elberedskap och ska som elberedskapsmyndighet planera, leda och samordna elförsörjningens resurser för att tillgodose samhällets behov av el i kriser och krig. I egenskap av elberedskapsmyndighet erhåller Svenska kraftnät elberedskapsanslag. Anslaget har hittills finansierat Svenska kraftnäts arbete med dammsäkerhet. Se mer om elberedskapsmyndighetens uppgifter i avsnitt 13.4.

Svenska kraftnät är kontoföringsmyndighet med uppgift att utfärda och kontoföra elcertifikaten. Övriga myndighetsuppgifter om elcertifikat ansvarar Energimyndigheten för.

Svenska kraftnät ska medverka till och stödja teknisk forskning, utveckling och demonstration inom områdena elöverföring och eldistribution. Inriktningen syftar till att långsiktigt förbättra nät- och systemansvarsverksamheten med avseende på driftsäkerhet, effektivitet och miljöanpassning. Kunskaps- och kompetensutveckling i samverkan med högskolorna är också ett prioriterat område. Forskning och utveckling stöds även inom området dammsäkerhet och risk- och sårbarhetsfrågor för kraftsystemet. Svenska kraftnät genomför forskning och utveckling, ofta i samarbete med branschföretagen via det samägda bolaget Elforsk AB.

Tillsyn och tillsynsvägledning

Svenska kraftnät är tillsynsvägledande myndighet ”i frågor om dammsäkerhet enligt 11 kap. MB”, såsom det uttrycks i 3 kap. 3 § miljötillsynsförordningen. Uttryckssättet kan tyckas missvisande. 11 kap. MB reglerar inte direkt ”frågor om dammsäkerhet”. Tanken kan förmodas ha varit att dessa frågor ligger invävda i kapitlets regler om vattenverksamhet. Tillsynsvägledningen innebär oavsett detta att Svenska kraftnät ska utvärdera, följa upp och samordna länsstyrelsernas operativa tillsyn samt ge dem stöd och råd. Tillsynsvägledningen är en del av den uppgift att främja dammsäkerheten i landet som enligt förordning (2007:1119) med instruktion för Affärsverket svenska kraftnät åvilar verket. Uppgiften att främja omfattar enligt 5 § i instruktionen att i frågor om dammsäkerhet

  • följa klimatförändringarnas påverkan samt följa och medverka i utvecklingen i landet,
  • verka för att möjligheterna att minska skador till följd av höga flöden utvecklas och tas till vara,
  • regelbundet rapportera till regeringen om utvecklingen och vid behov föreslå åtgärder,
  • uppmärksamma behovet av forskning,
  • svara för tillsynsvägledning enligt miljötillsynsförordningen samt
  • vid behov samråda med berörda myndigheter och organisationer

Svenska kraftnät är ansvarig sektorsmyndighet för elförsörjningen och har ansvar för tillsyn enligt säkerhetsskyddslagen och säkerhetsskyddsförordningen. Ansvaret innebär att verket ska kontrollera säkerhetsskyddet hos bolag, föreningar och stiftelser för elförsörjningsverksamhet. Svenska kraftnät har bemyndigande att meddela föreskrifter såvitt avser verkställigheten av nämnda regleringar vilket gjorts i SvKFS 2005:1.

Utöver ovanstående tillsynsuppgifter utövar Svenska kraftnät tillsyn i egenskap av elberedskapsmyndighet. Det innebär ett ansvar för att följa upp att de beslutade elberedskapsåtgärderna faktiskt vidtas.

Organisation

Svenska kraftnät är organiserat i nio avdelningar. Antalet anställda är cirka 370 personer. De flesta arbetar på huvudkontoret i Sundbyberg, men verket har kontor även i Halmstad, Sundsvall och Sollefteå.

Dammsäkerhetsfrågor hanteras på enheten för beredskap och säkerhet. Enheten ansvarar för Svenska kraftnäts myndighetsfunktioner inom elberedskap, dammsäkerhet och säkerhetsskydd. Enheten hanterar dessutom arbetet med risk- och sårbarhetsanalyser, övningsverksamhet, samverkan med och rapportering till andra myndigheter inom beredskaps- och säkerhetsområdet, informations- och IT-säkerhet samt övriga krisförberedande åtgärder. Enheten består i dag av 17 personer.

Finansiering

Tillsynsvägledningen och främjandeuppgiften när det gäller dammsäkerhet finansieras i dag av elberedskapsmedel, se mer om detta i kapitel. 14.2.2 och 14.2.3.

11.2.2. Överväganden och förslag

Organisation och kompetens

Som utredningen påpekat inledningsvis i detta kapitel är det vanskligt och inte självklart att bestämma var ansvaret för dammsäkerhetsfrågan ska ligga. Denna problematik kan i sig ge anledning till oro över frågans framtida handhavande. Svenska kraftnät har fullföljt den tillsynsvägledande och främjande uppgiften avseende dammsäkerhet väl, men det finns enligt utredningen möjlighet att utveckla arbetet ytterligare, särskilt avseende tillsynsvägledning. Finansieringen med elberedskapsmedel har varit ett funktionellt sätt att stödja forskning och utveckling i samverkan med branschen. Däremot anser utredningen att Svenska kraftnät inte lagt tillräckligt med personella resurser på tillsynsvägledningen.

Utredningen har noga övervägt om Svenska kraftnät är mer eller mindre lämpat än någon annan myndighet att fortsättningsvis ansvara för denna utveckling. Utgångspunkten har varit att utröna vad som bäst gagnar dammsäkerheten. Med denna utgångpunkt har

Svenska kraftnäts möjligheter och roll i samhället ställts i förhållande till vad som framkommit om andra tänkbara myndigheters samhällsuppdrag och förutsättningar. Förhållandet att dammsäkerhetsarbetet fungerat väl inom Svenska kraftnät beror visserligen till stor del på att de som arbetat med frågorna varit kompetenta och initierade, men Svenska kraftnät har såsom organisation gett arbetet med dammsäkerhet förutsättningar att utvecklas och fungera. Dammsäkerhetshandläggarna inom verket har haft möjlighet att fokusera på uppgiften.

Objektivt sett ligger dammsäkerhetsfrågan knappast längre ifrån Svenska kraftnäts huvuduppgifter än vad som gäller beträffande uppgifter som andra tänkbara myndigheter har huvudansvar för. Detta konstaterande förutsätter självfallet att man bortser från affärsmässiga inslag.

Ansvaret för dammsäkerhet ligger enligt utredningen nära Svenska Kraftnäts ansvar för elberedskap. Att det vidtas åtgärder för att undvika dammbrott i en kraftverksdamm är lika mycket en dammsäkerhetsfråga som en elberedskapsåtgärd. Verksamheterna kan därför med fördel samordnas. De föreslagna ändringarna i elberedskapslagen1 innebär ytterligare möjligheter till utökat samarbete. Samordningen kan t.ex. avse framtagande av vägledningsdokument, föreskrifter eller allmänna råd.

Det är därför lämpligt att dessa ansvarsområden hålls ihop på samma sätt som de görs redan i dag på Svenska kraftnät. En sammanhållen enhet som ansvarar för säkerhet och beredskap inom elområdet är gynnsam. I sammanhanget bör även återigen nämnas att 95 procent av landets dammar med stora konsekvenser i händelse av dammhaveri utgör en del av elproduktionen. Ett haveri i någon av dessa dammar kan leda till konsekvenser för elförsörjningen i landet vilket i det kortsiktiga perspektivet åligger Svenska kraftnät att åtgärda.

Svenska kraftnät är delägare i Elforsk AB var syfte bl.a. är att finansiera forskning och utvecklingsprojekt. Genom denna roll har Svenska kraftnät en möjlighet att påverka inriktningen på forskning och utveckling. Vilken forskning och vilka projekt som bedrivs har stor betydelse för dammsäkerhetsutvecklingen.

Svenska kraftnäts arbete med att främja dammsäkerheten i landet utgör ett litet ansvarsområde inom verkets organisation i

1 Regeringens proposition 2011/12:89, Ändringar i elberedskapslagen.

förhållande till verkets kärnverksamhet. Främjande och tillsynsvägledning av dammsäkerhet kommer oavsett val av ansvarig myndighet att utgöra en liten del av myndighetens verksamhet. Ansvaret för dammsäkerhet kräver därför en organisation som möjliggör en fokusering på frågan. Utredningen bedömer att Svenska kraftnäts organisation tillåter ett sådant fokus.

Svenska kraftnät har som organisation möjlighet att ansvara för alla arbetsuppgifter som den centrala myndighetsfunktionen för dammsäkerhet bör driva, vilket utredningen anser vara en förutsättning för god utveckling inom området. Utredningen uppskattar att utökningen av befintliga och de tillkommande arbetsuppgifterna gör att verksamheten bör omfatta sex årsarbetskrafter, jämfört med dagens tre årsarbetskrafter.

Svenska kraftnät har kontor i Stockholm, Halmstad och Sundsvall och utredningen bedömer möjligheterna att rekrytera personer med dammsäkerhetskompetens till myndigheten som goda.

Utredningen bedömer att den utökning av instruktionen för den centrala myndighetsfunktionen för dammsäkerhet som utredningen föreslår i avsnitt 11.4 kan utföras av Svenska kraftnät. Även de uppgifter som tillkommer med den nya regleringen såsom meddelande av föreskrifter avseende verksamhetsutövares egenkontroll och rapportering bedöms kunna utföras av Svenska kraftnät under förutsättning att antalet dammsäkerhetshandläggare utökas.

Vid en sammanvägd bedömning anser utredningen att främjandet av dammsäkerheten i landet från statens sida bäst sker genom att uppgifterna som detta innefattar ligger kvar för en samlad hantering hos Svenska kraftnät.

Finansiering

Finansieringen med elberedskapsmedel har varit av stor betydelse för hur tillsynsvägledningen och främjandeuppgiften har kommit att utvecklas och skulle kunna fortsätta att bedrivas i Svenska kraftnäts regi. Genom elberedskapsmedlen finansieras uppgifterna av innehavarna av nätkoncession. Ramanslaget för elberedskap uppgick år 2012 till 255 miljoner kr varav cirka 10–12 miljoner kr har finansierat dammsäkerhetsverksamheten.

Utredningen har i avsnitt 14.2.4 föreslagit att tillsynsvägledningen avseende dammsäkerhet ska finansieras med ett eget anslag. Tillsynsvägledningen för dammsäkerhet grundar sig på MB

och inte på elberedskapslagen. Vägledningen omfattar dessutom alla dammar i landet, inte bara dammar för elproduktion. Främjande av dammsäkerhet kan i fortsättningen, liksom i dag, finansieras av elberedskapsanslaget.

11.3. Andra centrala myndigheter som övervägts

11.3.1. Myndigheten för Samhällsskydd och Beredskap

Myndigheten för samhällsskydd och beredskap (MSB) bildades den 1 januari 2009 i samband med att tre tidigare myndigheter, Statens räddningsverk, Krisberedskapsmyndigheten och Styrelsen för psykologiskt försvar, lades ned. Myndigheten är en förvaltningsmyndighet som sorterar under Försvarsdepartementet.

Övergripande ansvar och uppdrag

MSB har ansvar för frågor om skydd mot olyckor, krisberedskap och civilt försvar, i den utsträckning inte någon annan myndighet har ansvaret. Ansvaret avser åtgärder före, under och efter en olycka eller kris. Enligt 1 § förordningen (2008:1002) med instruktion för Myndigheten för samhällsskydd och beredskap ska myndigheten:

1. utveckla och stödja samhällets beredskap mot olyckor och kriser

och vara pådrivande i arbetet med förebyggande och sårbarhetsreducerande åtgärder,

2. arbeta med samordning mellan berörda aktörer i samhället för

att förebygga och hantera olyckor och kriser,

3. bidra till att minska konsekvenser av olyckor och kriser,

4. följa upp och utvärdera samhällets krisberedskapsarbete, och

5. se till att utbildning och övningar kommer till stånd inom myn-

dighetens ansvarsområde.

MSB ska i samverkan med myndigheter, kommuner, landsting, organisationer och företag, identifiera och analysera sådana sårbarheter, hot och risker i samhället som kan anses vara särskilt allvarliga. Myndigheten ska vidare, tillsammans med de ansvariga

myndigheterna, genomföra en övergripande planering av åtgärder som bör vidtas. Därutöver ska MSB värdera, sammanställa och rapportera resultatet av arbetet till regeringen.

I samband med allvarliga olyckor och kriser ska MSB ha förmåga att bistå med stödresurser. Insatsrollen innebär att MSB ska kunna tillhandahålla olika typer av personella och materiella resurser, ibland i form av enskilda experter och ibland i form av mer komplext sammansatta moduler.

Myndigheten ska även stödja samordningen av berörda myndigheter. Samordningsrollen innebär att MSB ska kunna tillhandahålla metoder och nätverk som kan nyttjas av andra berörda myndigheter i syfte att bidra till ett koordinerat beslutsfattande och samordnad information till allmänheten. MSB har inte något eget eller direkt operativt ansvar i nationella insatser. Myndigheten ska se till att berörda aktörer vid en kris får tillfälle att samordna resursanvändning, information och krishanteringsåtgärder, se 7 § MSB:s instruktion.

MSB:s uppdrag är att främja övningsverksamheten genom att se till att övningar kommer till stånd inom myndighetens ansvarsområde och genom att genomföra egna övningar inom ansvarsområdet. Övningsverksamheten omfattar regional, nationell och EU/internationell nivå. Den kommunala nivån får stöd genom länsstyrelserna.

MSB är en av de myndigheterna som ska få en kopia av de ansökningshandlingar som ges in till miljödomstolen och har rätt att föra talan i ett sådant mål för att tillvarata miljöintressen och andra allmänna intressen, se 22 kap. 4 och 6 §§ MB.

Operativ tillsyn och tillsynsvägledning

MSB utövar den centrala tillsynen över efterlevnaden av LSO i landet. Enligt förarbetena till nämnda lag har MSB även en tillsynsvägledande roll. MSB granskar länsstyrelsernas planläggning och beredskap i händelse av en kärnenergiolycka eller vid övertagande av ansvaret för kommunal räddningstjänst. MSB ska utöva tillsynen över frågor som rör samordningen mellan den statliga räddningstjänstens olika grenar. Statlig räddningstjänst omfattar fjällräddningstjänst, flygräddningstjänst, sjöräddningstjänst, efterforskning av försvunna personer i andra fall, miljöräddningstjänst

till sjöss och räddningstjänst vid utsläpp av radioaktiva ämnen från en kärnteknisk anläggning.

MSB har även ett tillsynsvägledningsansvar gentemot länsstyrelsen och deras tillsyn över kommunernas skyldigheter enligt LSO. Tillsynsvägledningen utgörs främst av metodstöd, resursstöd, kompetensutveckling och nationella sammanställningar. MSB följer upp och sammanställer årligen kommunernas tillsyn enligt LSO.

Myndigheten har även ett tillsynsvägledande ansvar i frågor om miljöfarlig verksamhet enligt 9 kap. MB som regleras i den s.k. Sevesolagstiftningen. Tillsynsvägledning består av uppföljning, utvärdering och samordning av den operativa tillsynen, samt stöd och råd till operativa tillsynsmyndigheter. I egenskap av tillsynsvägledande myndighet genomför MSB bl.a. tillsynsbesök på länsstyrelserna, anordnar utbildningar och seminarier för tillsynshandläggare och håller en tillsynsdatabas. Databasen innehåller bland annat allmänna uppgifter om verksamheten, kriterium som gör att verksamheten omfattas av Sevesolagen, om det är en högre eller lägre kravnivå på verksamheten, uppgifter om handlingsprogram, planer för räddningsinsatser, säkerhetsrapporter samt olyckor och tillbud. MSB sammanställer årligen en rapport som bygger bland annat på information från databasen.

MSB har det centrala ansvaret för tillsynsvägledning när det gäller bestämmelser om förebyggande och hantering av allvarliga olyckor i utvinningsavfallsförordningen.

Tillsynsenheten vid MSB svarar för den operativa tillsynen enligt lagen (2010:1011) om brandfarliga och explosiva varor såvitt avser hanteringen av explosiva varor hos verksamhetsutövare där MSB och tidigare Räddningsverket eller Sprängämnesinspektionen prövat frågor om tillstånd för tillverkning av explosiva varor. Tillsynsuppgiften omfattar även hantering och import av både brandfarliga och explosiva varor vid Försvarsmakten, Försvarets materielverk, Totalförsvarets forskningsinstitut och Fortifikationsverket.

MSB har även en tillsynsvägledande roll inom området brandfarliga och explosiva varor. Det avser uppföljning och utvärdering av den operativa tillsynen samt stöd och råd till de lokala myndigheter som genomför operativ tillsyn. Kommunerna utövar tillsynen och rapporterar årligen till MSB som sammanställer de inrapporterade uppgifterna.

MSB utövar även operativ tillsyn över bestämmelser om säkerhetsrådgivare, transportskydd och transportabla tryckbärande anordningar enligt lagen (2006:263) om transport av farligt gods.

Organisation

Myndigheten är placerad i Karlstad, Stockholm, Sandö och Revinge. Antalet anställda uppgick till cirka 850 personer år 2010.

MSB har processorienterad eller skedesindelad organisation med fyra avdelningar för förebyggande, förberedande, hanterande respektive lärande verksamhet. Myndigheten har också en avdelning för verksamhetsstöd och en strategisk ledningsfunktion.

Avdelningen för risk- och sårbarhetsreducerande arbete arbetar med förebyggande verksamhet. Inom avdelning finns sex enheter varav en är enheten för farliga ämnen där bl.a. frågor om farlig verksamhet hanteras. Avdelningen har i uppgift att verka för att antalet olyckor och kriser samt effekterna av dessa minimeras genom att berörda aktörer vidtar förebyggande samt risk- och sårbarhetsreducerande åtgärder.

Avdelningen för utbildning, övning och beredskap arbetar med förberedande verksamhet. Uppgiften är att stödja aktörer som har ett ansvar vid olyckor och kriser, så att de har beredskap att kunna begränsa konsekvenserna av sådana händelser när de inträffar. Under avdelningen ligger också de två verksamhetsställena Revinge och Sandö där den huvudsakliga delen av utbildningsverksamheten är placerad.

Avdelningen för samordning och insats har ett operativt uppdrag och ska hantera nationella och internationella olycks- och krissituationer när de uppstår. Uppgiften består i att genomföra insatser och stödja samordningen av nationella myndigheters åtgärder och insatser i olyckor och kriser.

Huvuduppgiften för avdelningen för utvärdering och lärande är att inhämta och förmedla kunskaper och erfarenheter från inträffade olyckor och kriser. Inom avdelningen finns fem enheter varav tillsynsenheten är en.

Avdelningen för verksamhetsstöd består av sex enheter där bl.a. administrativa expertområden är placerade såsom juridik, ekonomi, personal, kommunikation och IT.

MSB har definierat sin verksamhet i fem huvudprocesser vars namn överensstämmer med avdelningarnas, förebygga, förbereda, hantera,

lära samt leda och stödja. Inom huvudprocesserna finns delprocesser. En sakfråga kan hanteras inom flera delprocesser samtidigt.

Finansiering

MSB:s verksamhet finansieras genom ramanslag och avgiftsintäkter. Ramanslaget för år 2011 uppgick till 1 000 miljoner kr. Avgiftsintäkterna avser huvudsakligen MSB:s RAKEL-verksamhet och myndighetens internationella insatsverksamhet. En mindre del av avgiftsintäkterna avser också uppdragsutbildningar, tjänsteexport m.m.

Överväganden

I Svenska kraftnäts översynsrapport2 föreslås att den centrala myndighetsfunktionen för dammsäkerhet ska överföras till MSB. Som skäl för att MSB ska ta över ansvaret för den centrala tillsynsvägledningen över dammsäkerhet anges bl.a. att myndigheten redan ansvarar för tillsynsvägledning avseende LSO och viss miljöfarlig verksamhet enligt MB. Därutöver anförs att ett överflyttande av ansvaret även skulle innebära att de centrala myndighetsuppgifterna för dels förebyggande av dammbrott dels beredskapsplanering för dammbrott samlas på en myndighet. Den samordnade beredskapsplaneringen för dammbrott skulle därför underlättas.

Utredningen delar Svenska kraftnäts bedömning att en överföring av ansvar för dammsäkerhetsfrågorna till MSB skulle kunna medföra att den samordnade beredskapsplaneringen skulle underlättas. MSB har en omfattande erfarenhet av samordning av beredskap nationellt. Verksamhet av detta slag skulle därför med fördel kunna samordnas med en nationell utveckling av beredskapsplanering för dammbrott. MSB har även erfarenhet av att vara tillsynsvägledande myndighet för verksamheter som liksom dammanläggningar tillståndsprövas och regleras i MB. För såväl Sevesoanläggningar som gruvdammar utövar MSB tillsynsvägledning. Myndigheten har utformat rapporteringssystem för Sevesoanläggningar och genomför omfattande utbildningsinsatser. Dessa erfarenheter skulle kunna utnyttjas även för dammanläggningar.

2 Översyn av de statliga insatserna för dammsäkerhet, Rapport till regeringen, Svenska kraftnät, (2010).

MSB har också i uppgift att vara remissmyndighet och agera som part i ansökningsmål vid mark- och miljödomstolarna samt dess överinstanser. Myndigheten har som part i ansökningsmål hitills prioriterat ärenden som berör verksamheter där farliga ämnen hanteras.

Tillsynsvägledning och främjande av dammsäkerhet kräver emellertid såsom redan nämnts en särskild kompetens. Med dammsäkerhet avses inte bara beredskapsfrågor utan framförallt de dammtekniska och verksamhetsinriktade frågorna. Kompetens inom det senare finns inte inom MSB:s organisation i dag. En placering av dammsäkerhetsuppgifterna på MSB skulle därför kräva en nyrekrytering av personal. Utredningen menar även att det finns risk för att dammsäkerhetsfrågorna inte får tillräckligt utrymme vid en placering på MSB. Myndighetens uppdrag är brett med fokus på beredskap. De mer dammsäkerhetsspecifika förebyggande frågorna såsom identifiering och hantering av brister i konstruktionen, flödesdimensioneringsberäkningar m.m. riskerar att försvinna i MSB:s breda uppdrag. Främjande av kunskapsutveckling och kompetensförsörjning inom dammsäkerhetsområdet skulle kunna bedrivas, men det skulle behöva konkurrera med andra verksamheter om stöd.

Dessutom innebär MSB:s organisation att de nyanställda personer som skulle arbeta med dammsäkerhet troligtvis skulle spridas ut på flera avdelningar. Dammsäkerhetsfrågan berör såväl förebyggande, förberedande, hanterande som lärande. Det skulle dessutom behövas juridiskt stöd från avdelningen för verksamhetsstöd. Splittringen över flera avdelningar kan motverka syftet med en effektiv och kompetent tillsynsvägledande myndighet vilket bör tas i beaktande.

Sammanfattningsvis anser utredningen att en placering av tillsynsvägledning och främjande av dammsäkerhet på MSB inte skulle gynna dammsäkerheten.

11.3.2. Havs- och Vattenmyndigheten

Den 1 juli 2011 bildades HaV. Myndigheten är enligt sin instruktion, förordningen (2011:619) med instruktion för Havs- och vattenmyndigheten, förvaltningsmyndighet på miljöområdet för frågor om bevarande, restaurering och hållbart nyttjande av sjöar, vattendrag och hav. HaV sorterar under Miljödepartementet.

Övergripande ansvar och uppdrag

HaV har tagit över delar av Fiskeriverkets och delar av Naturvårdsverkets tidigare ansvar och arbetsuppgifter enligt MB. HaV ansvarar för miljökvalitetsmålen Ingen övergödning, Levande sjöar och vattendrag, Hav i balans samt Levande kust och skärgård. Myndigheten ansvarar därutöver för innehållet i miljöövervakningen i hav och sötvatten, bland annat genom att ta fram indikatorer och vara beställare av datavärdskap och rapportering av miljöövervakningsdata.

Enligt sin instruktion ska myndigheten bl.a. delta i miljöprövningar som gäller frågor som är principiellt viktiga eller har stor betydelse för havs- och vattenmiljön eller fisket. Det kan gälla tillståndsprövningar av miljöfarlig verksamhet till havs och frågor om vattenverksamhet.

Enligt 22 kap. 4 och 6 §§ MB ska HaV få ett exemplar av ansökningshandlingar och när det behövs, föra talan i mål för att tillvarata miljöintressen och andra allmänna intressen. HaV har även tagit över Fiskeriverkets tidigare uppgift att yttra sig över en vattenanläggnings eller verksamhets inverkan på det allmänna fiskeintresset samt föreslå bestämmelser som behövs till skydd för fisket. Föreskrifter och kontroll av yrkesfisket har också lämnats över från Fiskeriverket till HaV.

Ansvaret för forskningen som tidigare låg på Fiskeriverket har flyttats till SLU. Tanken var att separera reglering och kontroll från uppgiften att främja. HaV beställer däremot en stor del av den forskning som utförs. Myndigheten bistår även Naturvårdsverket med den myndighetens forskningsanslag.

I regleringsbrevet för budgetåret 2012 gavs HaV i uppdrag att i samråd med berörda myndigheter samla berörda intressenter i en dialog med syfte att få en ökad samsyn kring vattenkraften och de mål som är fastställda om förnybara energikällor samt miljömål för vatten och vattenförvaltning. Uppdraget ska redovisas till Regeringskansliet (Miljödepartementet) senast den 31 oktober 2012.

Operativ tillsyn och tillsynsvägledning

HaV är numera tillsynsvägledande myndighet i frågor om vattenverksamhet enligt 11 kap. miljöbalken, med undantag för markavvattning och dammsäkerhet. Myndigheten är även tillsynsväg-

ledande myndighet för frågor om enskilda avlopp enligt 9 kap. MB, fiske och vattenbruk, miljökvalitetsnormer enligt 5 kap. MB inom sitt ansvarsområde, vattenskyddsområden enligt 7 kap. MB och skydd av grundvatten.

HaV har det operativa tillsynsansvaret för frågor om användning och utsättning av genetiskt modifierade vattenlevande organismer enligt 13 kap. MB. Myndigheten har ett tillsynsansvar i fråga om fiskerikontroll enligt fiskelagstiftningen. Tillsynsuppgiften sker i samverkan med Kustbevakningen. HaV är även tillsynsvägledande myndighet för de båda tillsynsområdena. Tillsynen respektive tillsynsvägledningen utförs av olika avdelningar inom organisationen.

Organisation

HaV har cirka 230 anställda. Huvudkontor ligger i Göteborg men myndigheten har också fyra kontor för fiskerikontroll i Simrishamn, Västra Frölunda, Kungshamn och Karlskrona. Verksamheten är uppdelad i fyra avdelningar, Kunskap, Planering, Åtgärd och Tillsyn. Under avdelningen för tillsyn ligger enheten för tillsynsutveckling. Där hanteras tillsynsvägledning för vattenverksamheter, vattenskyddsområden och enskilda avlopp. På tillsynsavdelningen ligger även den juridiska enheten som ansvarar för utfärdande av föreskrifter. Det är däremot åtgärdsavdelningen som bevakar myndighetens intressen i domstol.

Finansiering

Myndigheten finansieras genom ramanslag uppgående till drygt 180 miljoner kr, för budgetåret 2012. Därutöver erhåller HaV anslag för Åtgärder för havs- och vattenmiljö. Anslaget uppgår till drygt 730 miljoner kr och får användas för insatser för att förbättra, bevara och skydda havs- och vattenmiljöer. Bl.a. får högst 5 miljoner kr betalas ut till länsstyrelsen i Norrbottens län för tillsyn av vattenverksamhet med fokus på kraftverk, dammar och vattenreglering.

Överväganden

HaV är tillsynsvägledande myndighet för alla vattenverksamheter förutom markavvattning och dammsäkerhet. Myndigheten har därför redan ett upparbetade kontaktytor med länsstyrelserna. Tillsynsvägledningen av dammsäkerhet skulle på ett naturligt sätt kunna samordnas med övrig tillsynsvägledning inom vattenverksamhet särskilt för dammar/vattenkraftverk. Det skulle öka möjligheterna att samordna tillsynen inom MB:s område gentemot verksamhetsutövaren.

Genom en överföring av ansvaret för dammsäkerhet till HaV skulle man även undvika problematiken med avgränsningen för vad som är dammsäkerhet respektive övrig vattenverksamhet. Som redan nämnts finns i dag ingen definition av vad som är dammsäkerhet. Vare sig HaV eller Svenska kraftnät att angett att avsaknaden av en definition av dammsäkerhet skulle utgöra ett problem vid tillsynsvägledningen.

En sammanhållen tillsynsvägledning kring verksamhetsutövarnas egenkontroll skulle kunna vara positivt. Utredningen menar dock att dammsäkerheten inte gagnas av en långt driven sammanhållen tillsynsvägledning. Med hänsyn till att området vattenverksamhet är stort riskerar dammsäkerhetsfrågorna att få ett för litet utrymme. Tillsynsvägledningen med avseende på dammsäkerheten lyftes bort från Naturvårdsverket av nämnda anledningen.

HaV skulle dessutom behöva rekrytera personer med dammsäkerhetskompetens eftersom detta skulle vara ett nytt kompetensområde inom myndigheten. Att bygga upp dammsäkerhetskompetensen inom myndigheten bedöms som relativt svårt med anledning av myndighetens lokalisering i förhållande till merparten av dammarna och dammägarnas huvudkontor. Myndighetens uppdrag i övrigt ligger inte heller i linje med en sådan uppbyggnad.

HaV har en begränsad erfarenhet av olycks-, beredskaps- och säkerhetsfrågor förutom vad avser kunskap och erfarenhet att analysera konsekvenser på miljön utifrån bl.a. miljöns känslighet. Uppgifter avseende beredskap för dammbrott skulle kunna skiljas ut och ansvaret för det läggas på t.ex. MSB. Utredningen menar emellertid att en uppdelning av ansvaret för dammsäkerhetsfrågorna skulle vara en för dammsäkerheten olycklig utveckling.

Vad gäller främjandeuppgiften för dammsäkerhet har HaV redan i dag i uppgift att följa klimatförändringarnas påverkan inom

myndighetens verksamhetsområde. Något ansvar att driva utvecklingen avseende forskning har myndigheten inte. Som nämnts var tanken vid bildandet av myndigheten att ansvaret för forskning skulle skiljas från myndigheten.

Vid en sammantagen bedömning anser utredningen inte att den centrala myndighetsfunktionen för dammsäkerhet bör placeras på HaV. Myndighetens uppdrag innefattar endast några av de uppgifterna som den centrala myndighetsfunktionen för dammsäkerhet bör ansvara för. Utredningen anser inte att det centrala ansvarsområdet för dammsäkerheten skulle främjas om det utförs av olika centrala myndigheter.

11.4. Tillsynsvägledning och främjande av dammsäkerhet

I detta avsnitt beskriver utredningen sin syn på hur tillsynsvägledningen och främjande av dammsäkerhet bör utvecklas. Regeringen har i sin skrivelse 2009/10:793 redovisat sina generella bedömningar för hur en tillsynsreglering bör vara utformad. Av skrivelsen framgår bl.a. följande definition av tillsynsvägledning.

Tillsynsvägledning: En statlig myndighets stöd, uppföljning,

samordning m.m. av andra tillsynsorgan bör kallas tillsynsvägledning. För varje tillsynsområde där tillsynen utförs av mer än ett organ bör regeringen bemyndigas att utse en statlig myndighet att ansvara för samordningen av tillsynen. En sådan samordnande myndighet bör även bemyndigas att utfärda föreskrifter kring tillsynen. Föreskrifter bör kunna avse frågor om krav på inventeringar och tillsynsplaner, rapportering, tillsynsfrekvenser, förebyggande åtgärder, urvalskriterier för och utförande av inspektioner, provtagning, samråd och dokumentation. Tillsynsvägledning förutsätter även att den som ansvarar för samordningen ges återkoppling på hur tillsynsvägledningen fungerar och om tillståndet inom tillsynsområdet.

3 En tydlig, rättssäker och effektiv tillsyn (Skr. 2009/10:79).

11.4.1. Ny lydelse avseende dammsäkerhet i instruktionen för Svenska kraftnät

Svenska kraftnät har en övergripande uppgift att främja dammsäkerheten i landet. Att främja betyder att ge stöd åt, arbeta för någots bästa, gynna och utveckla. Myndighetsfunktionen för dammsäkerhet är pådrivande, stödjande och samlande inom dammsäkerhetsområdet. Svenska kraftnät främjar dammsäkerheten genom följande arbetsuppgifter:

  • Utveckling av tillsyn och egenkontroll
  • Främjande av kunskapsutveckling och kompetensförsörjning
  • Främjande av beredskapsutveckling
  • Samråd med berörda myndigheter och organisationer
  • Rapportering till regeringen

Dessa arbetsuppgifter bör bedrivas samlat för att möjliggöra främjandeuppgiften. I avsnitt 5.2 beskrivs vad som görs inom de olika arbetsuppgifterna i dag. Utredningen föreslår att dessa arbetsuppgifter bedrivs även i fortsättningen. Vissa av dess uppgifter behöver dock utvecklas och några nya arbetsuppgifter föreslås tillkomma.

I instruktionen anges i dag en uppräkning av uppgifter. Uppräkningen i den ordning uppgifterna anges kan uppfattas som att det finns en inbördes ordning i hur angelägna utförandet av uppgifterna är. Utredningen anser därför att punkterna bör ges en annan ordning i instruktionen samt att några punkter ska ändras. Nedan anges ändringarna i korthet varefter en beskrivning av respektive ändring görs.

Utredningen föreslår därför att lydelsen i 5 § i förordningen (2007:1119) med instruktion för Affärsverket Svenska kraftnät justeras enligt följande.

Uppgiften omfattar att i frågor om dammsäkerhet:

1. svara för tillsynsvägledning enligt miljötillsynsförordningen

(2011:13) och samverka med länsstyrelserna för att åstadkomma ett effektivt tillsynsarbete,

2. identifiera behov, stödja och medverka i kunskapsutveckling

och kompetensförsörjning

3. följa klimatförändringarnas påverkan samt följa och medverka i

utvecklingen i landet,

4. verka för att riskerna för en allvarlig störning på samhället genom

dammhaveri eller höga flöden i reglerade vattendrag minskar,

5. vid behov samråda med berörda myndigheter och organisationer

och

6. regelbundet rapportera till regeringen om utvecklingen och vid

behov föreslå åtgärder.

Utredningen föreslår följande lydelse avseende dammsäkerhetsrådet i 14 § i Svenska kraftnäts instruktion:

  • Vid Svenska kraftnät ska det finnas ett råd som ska biträda affärsverket i arbetet med dammsäkerhetsfrågor (Dammsäkerhetsrådet). Rådet är ett informations- och samrådsorgan för frågor relaterade till dammsäkerhet.

11.4.2. Utveckling av tillsyn och egenkontroll

Svenska kraftnät ska enlig 3 kap. 3 § miljötillsynsförordningen ge tillsynsvägledning i frågor om dammsäkerhet enligt 11 kap. MB. För att förtydliga att tillsynsvägledningen avseende dammsäkerhet även kan avse andra delar av balken föreslår utredningen att preciseringen om 11 kap. tas bort från nämnda bestämmelse.

Enligt punkten 1 i den justerade instruktionen ovan ska Svenska kraftnät svara för tillsynsvägledning och samverka med länsstyrelserna för att åstadkomma ett effektivt tillsynsarbete. Nedan beskrivs inom vilka områden utredningen anser att det arbetet bör utvecklas.

Samverkan med länsstyrelser för att åstadkomma ett effektivt tillsynsarbete

En utökad samverkan mellan tillsynsvägledande myndighet och tillsynsmyndighet gynnar enligt utredningen tillsynen. Tillsynsvägledande myndighet ska enligt 3 kap. 1 § miljötillsynsförordningen aktivt verka för samordning och samverkan i frågor om tillsynsvägledning. För att tillsynen ska bli likvärdig och samordnad över landet krävs att den planeras och samordnas. Den centrala myndighetsfunktionen för dammsäkerhet på Svenska kraftnät kan

hjälpa till med den övergripande planeringen samt ge råd om hur tillsynen ska bedrivas. Den centrala myndighetsfunktionen kan medverka vid tillsynsbesök, särskilt när besöken omfattar revisioner och granskningar av företags säkerhetsledningssystem och rutiner för egenkontroll. Den utveckling som görs inom Svenska kraftnäts pågående regeringsuppdrag kan vara vägledande i hur tillsynsarbetet kan bedrivas. Utredningen anser det är särskilt viktigt med samverkan för dammar som i händelse av dammbrott skulle medföra stora konsekvenser.

Dammsäkerhetshandläggarna på Svenska kraftnät ska ingå i det handläggarnätverk för dammsäkerhet som föreslås i avsnitt 10.1.5. Handläggarna på Svenska kraftnät bör enligt utredningen ha en sammanhållande roll och ansvara för att dammsäkerhetstillsynen utvecklas successivt. I handläggarnätverket kan de olika länsstyrelsernas planerade tillsynsinsatser diskuteras och en nationell tillsynsplan utarbetas. Vidare kan olika utvecklingsområden identifieras och utvecklingsprojekt drivas gemensamt i nätverket.

Den centrala myndighetsfunktionen för dammsäkerhet bör medverka vid ett antal tillsynsbesök under året, både som stöd för tillsynsmyndigheten men också för att bilda sig en uppfattning om hur tillsynen bedrivs.

Uppföljning av utförd tillsyn

För att säkerställa att tillsynen bedrivs likriktat, i tillräcklig omfattning samt följer regelverk och föreskrifterna krävs en uppföljning av den utförda tillsynen. Utredningen föreslår att Svenska kraftnät genomför den uppföljningen årligen. Därför föreslår utredningen att länsstyrelserna ska upprätta årliga rapporter om genomförd dammsäkerhetstillsyn. I rapporterna ska länsstyrelserna dessutom beskriva olika problem som uppstått t.ex. med specifika dammanläggningar eller med förutsättningar för att bedriva tillsynen. Genom rapporteringen kan också länsstyrelserna återkoppla om hur myndigheten anser att tillsynsvägledningen fungerar och eventuellt kan utvecklas.

Kompetensutveckling av handläggare på länsstyrelsen

Av 8 § myndighetsförordningen (2007:515) följer att en operativ tillsynsmyndighet ska bedriva tillsynsarbetet effektivt och att myndigheten ska utveckla personalens kompetens i tillsynsfrågor. Utredningen anser att det är av stor vikt att länsstyrelsen ger sin personal möjligheten att utveckla sin kompetens inom dammsäkerhetstillsyn.

Utredningen menar att Svenska kraftnät bör genomföra regelbundna utbildningar för de handläggare som arbetar med tillsyn av dammsäkerheten. Detta gäller både de dammsäkerhetshandläggare som föreslås arbeta med dammsäkerhet på heltid samt de vattenhandläggare som har dammsäkerhetstillsynen som en del av sitt ansvarsområde.

Erfarenhetsspridning av inträffade händelser

Den centrala myndighetsfunktionen för dammsäkerhet på Svenska kraftnät föreslås ha en uppgift att sammanställa inrapporterade driftstörningar och allvarliga händelser ur dammsäkerhetssynpunkt. Syftet med detta är att sprida erfarenheter om händelser till berörda verksamhetsutövare och länsstyrelser för att på så sätt förhindra att liknande händelser sker igen. Motsvarande erfarenhetsspridning finns för många liknande branscher, exempelvis kärnkraftbranschen.

Den föreslagna dammsäkerhetsdatabasen bör på sikt också kunna utvecklas till att vara ett felrapporteringssystem där dammägare kan rapportera in driftstörningar, allvarliga händelser och incidenter löpande. Svagheter och brister vid anläggningarna som framkommit i samband med dammägarens egenkontroll ska rapporteras i samband med den årliga dammsäkerhetsrapporteringen.

11.4.3. Övriga arbetsuppgifter

Främjande av kunskapsutveckling och kompetensförsörjning (punkt 2)

Utredningen anser att uppdraget i instruktionen bör ändras till att identifiera behovet av, samt stödja och medverka i, kompetensutveckling och kompetensförsörjning för att tydligare visa vad som görs.

Svenska kraftnät främjar kunskapsutveckling och kompetensförsörjning genom att ge ekonomiskt stöd till olika högskoleverksamheter samt till forsknings- och utvecklingsprojekt i samverkan med kraftindustrin (via Elforsk), gruvindustrin (via SveMin) och berörda myndigheter (exempelvis SMHI). Dessutom medverkar Svenska kraftnät som adjungerade ledamöter i Elforsks styrgrupp för FoU Dammsäkerhet och medverkar i styrgrupper och arbetsgrupper för utvalda utvecklingsprojekt.

Klimatförändringars påverkan (punkt 3)

Svenska kraftnät ska följa klimatförändringarnas påverkan samt följa och medverka i utvecklingen i landet. Detta görs dels genom att vara huvudman för riktlinjerna för bestämning av dimensionerande flöden för dammanläggningar tillsammans med Svenska Energi och SveMin, dels genom särskilda uppdrag såsom det regeringsuppdrag som avrapporterades 2011 där Svenska kraftnät tillsammans med Svenska Energi, SveMin och SMHI analyserade och värderade klimatfrågans betydelse för dammsäkerheten, se avsnitt 5.2.5.

Främjande av beredskapsutveckling (punkt 4)

Utredningen anser att uppdraget i instruktionen bör förtydligas för att visa att det handlar om att minska skador till följd av dammhaveri och inte bara höga flöden, i enlighet med punkt 4 ovan. I dag har Svenska kraftnät ansvar att minska skador p.g.a. höga flöden. Dammhaveri bör även inkluderas.

Den utveckling med samordnad beredskapsplanering för dammbrott som pågår i de stora reglerade älvarna hade inte varit möjlig utan finansiering och medverkan från Svenska kraftnät. Även i

framtiden bör den centrala myndighetsfunktionen ha en aktiv roll i utvecklingen av beredskapsplaneringen för dammbrott, vilket även bör tydliggöras i instruktionen. Ansvaret ska enligt utredningen framgå av instruktionen.

Dessutom bör det komma till uttryck att det är reglerade vattendrag som avses. Oreglerade vattendrag har inga dammar och höga flöden i oreglerade vattendrag kan således inte ingå Svenska kraftnäts uppdrag.

Samverkan med centrala myndigheter (punkt 5)

Den centrala myndighetsfunktionen måste samråda med andra berörda myndigheter och organisationer i frågor som berör dammsäkerheten. Samråd och samverkan med andra centrala myndigheter såsom HaV, MSB, SMHI och Naturvårdsverket måste utvecklas ytterligare.

Rapportering till regeringen (punkt 6)

Svenska kraftnät upprättar årligen en sammanställning över inkomna årsrapporteringar till länsstyrelserna och rapporterar årligen om dammsäkerhetsutvecklingen till regeringen. Den föreslagna årliga rapportering om genomförd tillsyn från länsstyrelserna till Svenska kraftnät samt annan dammsäkerhetsverksamhet som genomförts av Svenska kraftnät och nätverket för dammsäkerhetshandläggare bör ligga till grund för rapporteringen till regeringen.

Dammsäkerhetsrådet

Vid Svenska kraftnät ska det enligt 14 § instruktionen för Svenska kraftnät finnas ett råd som ska biträda affärsverket i arbetet med dammsäkerhetsfrågor (Dammsäkerhetsrådet), mer om rådet i avsnitt 5.2. Utredningen anser att rådet har en viktig roll för informationsutbyte mellan berörda aktörer och att rådet bör finnas kvar som stöd till den centrala myndighetsfunktionen för dammsäkerhet på Svenska kraftnät. Rådets roll som informations- och samrådsorgan för frågor relaterade till dammsäkerhet bör därför förtydligas i instruktionen.

11.4.4. System för dammsäkerhetsrapportering

I Sverige finns flertalet dammregister och -databaser. SMHI, länsstyrelserna, Svenska kraftnät, Svenska Energi samt SveMin har alla databaser eller register över dammar. Syftet med dessa register och databaser är dock varierande och registren innehåller olika dammar och uppgifter om dammarna. Inget av registren är dock komplett avseende dammsäkerhet och tillsyn. Därför föreslår utredningen att Svenska kraftnät ges i uppdrag att utreda formerna för en dammsäkerhetsdatabas med erforderliga uppgifter om dammarna som behövs för en god dammsäkerhetstillsyn. Svenska kraftnät bör även påbörja uppbyggnaden av en databas så att uppgifter om dammarna kan matas in i databasen i samband med dammsäkerhetsklassificeringen. Dammsäkerhetsdatabasen bör i förlängningen innehålla alla dammar i landet där dammens dammsäkerhetsklass har fastställts.

Dammsäkerhetsdatabasen bör upprättas så att den har en koppling till SMHI:s dammregister som är en del av Svenskt Vattenarkiv (SVAR) och till Vatteninformationssystem Sverige (VISS) som upprättats för vattenförvaltning av vattenmyndigheterna och länsstyrelserna. Även kopplingen till Svensk Energis och SveMins dammregister bör utredas.

Databasen bör utvecklas så att dammägare ska kunna göra rapportering direkt in i databasen och också kunna se de uppgifter som finns om dammarna i databasen. Ägarna ska dock inte själva kunna göra ändringar i databasen. Databasen ska vara ett underlag för skrivbordstillsynen och tillsynsbesök och andra tillsynsinsatser. Tillsynsmyndigheten ska ha möjlighet att se uppgifter om dammar i sina områden samt rapportera in genomförda tillsynsinsatser.

Dammsäkerhetsdatabasen förutsätts underlätta för både dammägare och tillsynsmyndighet genom att förenkla inrapporteringsprocessen för årsrapporter. En dammägare med dammar i flera län behöver inte skicka uppgifter till alla länsstyrelser utan bara granska befintliga uppgifter i databasen och rapportera in ändringar. På samma sätt behöver inte länsstyrelserna årligen kontakta alla dammägare i sitt län om att de ska inkomma med årsrapporteringen utan bara gå in i systemet och granska de inrapporterade uppgifterna. Systemet underlättar även för länsstyrelserna att planera och följa upp tillsynsinsatser. Dammsäkerhetsdatabasen underlättar dessutom Svenska kraftnäts uppföljning av inrapporterade årsrapporter och genomförd tillsyn.

En dammsäkerhetsdatabas innehållande uppgifter om alla dammar som kan medföra konsekvenser i händelse av dammbrott kopplat till ett smidigt rapporteringssystem för verksamhetsutövarnas myndighetsrapportering är enligt utredningen en förutsättning för en effektiv tillsyn av dammsäkerheten. Det vore därför önskvärt om ett sådant rapporteringssystem var i funktion då klassificeringen påbörjades.

11.4.5. Remissinstans och partsställning vid tillståndsprövningar i domstol

Utredningen har övervägt att låta även Svenska kraftnät få rollen som remissinstans och part vid tillståndsprövningar i domstol för dammsäkerhetshöjande åtgärder. Utredningen har funnit att det inte är lämpligt att föra in ytterligare en myndighet med den funktionen. I stället bör Kammarkollegiet och länsstyrelsen i större utsträckning än i dag utnyttja Svenska kraftnäts expertkunskaper inom dammsäkerhet vid tillståndsprövningar. Detta möjliggör för Svenska kraftnät att vid tillståndsprövningar tydliggöra särskilda säkerhetsaspekter som verksamhetsutövare bör ta hänsyn till innan, under och efter ett projekts genomförande. Det innebär också att Svenska kraftnät har möjlighet att visa på vikten av att genomföra projekt ur säkerhetssynpunkt.

11.4.6. Meddela föreskrifter avseende dammsäkerhet

Utredningen föreslår att Svenska kraftnät i samband med införandet av regelverket för dammsäkerhet bemyndigas att meddela föreskrifter och upprätta allmänna råd. Myndigheten kan genom föreskrifter, vägledningar och allmänna råd fylla ut regelverket. Det är en förutsättning för ett fungerande och ändamålsenligt dammsäkerhetsarbete att myndigheten ges föreskriftsrätt avseende dammsäkerhet. Svenska kraftnät ska enligt utredningen meddela föreskrifter om innehållet i samt omfattningen och dokumentationen av

  • konsekvensutredningen,
  • säkerhetsledningssystemet,
  • helhetsbedömningen, samt
  • myndighetsrapporteringen.

För att underlätta beslut om klassificering anser utredningen dessutom att Svenska kraftnät ska upprätta vägledning som stöd för bedömning av de konsekvenser som ska ligga till grund för klassificeringen och beslut om dammsäkerhetsklass.

11.4.7. Kompetens- och resursbehov

På samma sätt som för den operativa tillsynen av dammsäkerhet krävs det hög kompetens inom dammsäkerhetsområdet hos den centrala myndighetsfunktionen för dammsäkerhet på Svenska kraftnät. Utredningen menar att samma kompetens krävs på Svenska kraftnät som för länsstyrelsen, se avsnitt 10.3.

En central myndighetsfunktion för dammsäkerhet som samlat arbetar med ovanstående arbetsuppgifter har enligt utredningen förutsättningarna för att upprätthålla en personalgrupp med hög dammsäkerhetskompetens. I samband med att arbetsuppgifterna avseende utveckling av tillsyn och egenkontroll kompletteras krävs även en utökning av resurser. I nuläget omfattar tillsynsvägledning och främjande av dammsäkerhet tre årsarbetskrafter på Svenska kraftnät. För att kunna genomföra de föreslagna arbetsuppgifterna bör den centrala myndighetsfunktionen för dammsäkerhet på Svenska kraftnät utökas till att omfatta sammanlagt sex årsarbetskrafter. I samband med att Svenska kraftnät ges föreskriftsrätt behövs särskilt en utökning av juridisk kompetens inom området.

11.5. Samverkan mellan statliga myndigheter

Den centrala myndighetsfunktionen för dammsäkerhet på Svenska kraftnät måste i hög grad samverka med andra statliga myndigheter. I kommande avsnitt beskrivs samverkan med de statliga myndigheter som myndighetsfunktionen bör ha mest samverkan med. Behov av samverkan kan komma att uppstå även med andra myndigheter. I sammanhanget bör dock betonas att samverkan är ett ömsesidigt ansvar.

11.5.1. Samverkan inom Svenska kraftnät

Även om den centrala myndighetsfunktionen har sin placering på Svenska kraftnät vill utredningen påpeka att en samverkan avseende dammar med särskilt stor påverkan i händelse av dammbrott bör finnas mellan den centrala myndighetsfunktionen för dammsäkerhet och säkerhetsskyddsfunktionen. Säkerhetsskyddsfunktionens ansvarsområde har ett nära samband med dammsäkerhet.

Dessutom kan myndighetsfunktionen för dammsäkerhet sägas vara nära besläktad med elberedskapsmyndigheten genom att myndighetsfunktionens verksamhet redan i dag finansieras av elberedskapsmedel. I och med de planerade förändringarna i elberedskapslagen fr.o.m. den 1 juli 2012 ställs nya krav på bl.a. elproducenter att upprätta risk- och sårbarhetsanalyser avseende säkerheten i den egna verksamheten, och lämna de uppgifter till

Dammägare

Svenska Kraftnät

Elberedskap

Svenska Kraftnät

Dammsäkerhet

MSB

Krisberedskap

Länsstyrelse

Dammsäkerhet

Länsstyrelse

Krisberedskap

Kommun

Krisberedskap

Svenska Kraftnät

Säkerhetsskydd

Säkerhetsskydds-

lagen

Elberedskaps-

lagen

Miljöbalken

Lagen om Skydd

mot Olyckor

Länsstyrelse

Vattenverksamhet

HaV

Vattenverksamhet

elberedskapsmyndigheten som myndigheten behöver för att kunna upprätta den nationella risk- och sårbarhetsanalysen inom elsektorn. Speciellt avseende dammar där ett dammbrott skulle kunna medföra stor påfrestning på samhället bör den centrala myndighetsfunktionen för dammsäkerhet medverka när elberedskapsmyndigheten utarbetar föreskrifter. Medverkan skulle då gälla föreskrifter om de risk- och sårbarhetsanalyser som ägare av dessa dammar ska upprätta och föreskrifter om vilka uppgifter som ägarna ska lämna in till elberedskapsmyndigheten. Dessutom bör myndighetsfunktionen för dammsäkerhet medverka i upprättandet av den nationella risk- och sårbarhetsanalysen inom elsektorn som elberedskapsmyndigheten ska upprätta enligt lagen. Samma typ av medverkan bör förekomma i beslut om beredskapsåtgärder med syftet att förebygga och hantera skador på anläggningarna.

11.5.2. Samverkan med MSB

Den centrala myndighetsfunktionen för dammsäkerhet och MSB bör samverka i arbetet med beredskapsplanering för dammbrott samt i ansträngningarna att minska risker i samband med dammbrott och höga flöden i reglerade vattendrag.

Hur dammägare kan komplettera kommunens beredskap samt hur kommunernas tillsyn enligt LSO på dammanläggningar ska bedrivas är områden där MSB har ett ansvar men där det är lämpligt att samråd sker med den centrala myndighetsfunktionen för dammsäkerhet på Svenska kraftnät.

Översvämningsdirektivet genomförs i Sverige i förordningen (2009:956) om översvämningsrisker. MSB är ansvarig myndighet och genomför arbetet i nära samarbete med länsstyrelserna. MSB bör även samverka med den centrala myndighetsfunktionen för dammsäkerhet i frågor som rör dammbrott och höga flöden i reglerade vattendrag.

11.5.3. Samverkan med HaV

Den centrala myndighetsfunktionen för dammsäkerhet och HaV bör samverka avseende tillsynsvägledning till länsstyrelserna. Det gäller främst tillsynsvägledningen för tillsyn av de dammar som inte tilldelats någon dammsäkerhetsklass, dvs. övriga dammar, där

tillsynen av dammsäkerhet och vattenverksamhet bedrivs tillsammans. Tillsynsvägledningen kan exempelvis ske i form av gemensamma informationsblad till dammägare, exempel riktade till länsstyrelserna, handläggarträffar för vattenhandläggare på länsstyrelserna m.m.

För tillsynen av dammarna i dammsäkerhetsklass A–C bör tillsynsvägledningen vara mer specialiserad och inriktad på dammsäkerhetsfrågor. Där är behovet av samverkan inte lika stort.

11.5.4. Samverkan med länsstyrelserna

Den centrala myndighetsfunktionen för dammsäkerhet och länsstyrelserna ska samverka inom berörda verksamheter, dvs. tillsyn av dammsäkerhet och krisberedskap.

Vad gäller tillsyn av dammsäkerhet för de drygt 500 dammanläggningar i dammsäkerhetsklass A–C bör den centrala myndighetsfunktionen för dammsäkerhet och de länsstyrelser som har ansvar för dammsäkerhetstillsynen ha ett nära samarbete. Den centrala myndighetsfunktionen kan ge råd avseende analyser av inrapporterade årsrapporter och planering av tillsynsaktiviteter genom samverkan i nätverket för dammsäkerhetshandläggare, se avsnitt 10.1.5.

Vad gäller tillsyn av dammsäkerhet för dammar som inte tilldelats någon dammsäkerhetsklass, dvs. övriga dammar, bör den centrala myndighetsfunktionen för dammsäkerhet samverka med alla länsstyrelser. Här har även HaV en viktig roll att samordna tillsynsvägledningen. Den centrala myndighetsfunktionen för dammsäkerhet bör medverka vid handläggarträffar och ge råd och stöd till länsstyrelserna i frågor som berör dammsäkerhet.

Vad gäller krisberedskap så bör den centrala myndighetsfunktionen samverka med de krisberedskapshandläggare som samordnar beredskapsplanering för dammbrott i länen. Denna samverkan har skett naturligt genom de redan igångsatta projekten för samordnad beredskapsplanering för dammbrott. Den centrala myndighetsfunktionen bör delta vid älvgruppsmöten för att säkerställa en kontinuerlig dialog mellan myndigheterna.

11.5.5. Samverkan med SMHI

Den centrala myndighetsfunktionen för dammsäkerhet och SMHI bör samverka i olika hydrologiska och klimatrelaterade frågeställningar som berör dammsäkerheten. Den centrala myndighetsfunktionen ska inte upprätta egen kompetens inom området utan ska i myndighetssamverkan utnyttja SMHI:s kompetens.

I samband med att dammsäkerhetsdatabasen upprättas bör den centrala myndighetsfunktionen samråda med SMHI så att dammsäkerhetsdatabasen knyts till det dammregister som SMHI han ansvar för.

11.5.6. Samverkan med Naturvårdsverket

Den centrala myndighetsfunktionen för dammsäkerhet och Naturvårdsverket bör samverka särskilt i fråga om tillsynsvägledningen för gruvdammar. Naturvårdsverket har tillsynsvägledningsansvar för gruvdammar som är riskanläggningar enligt utvinningsavfallsförordningen medan den centrala myndighetsfunktionen har ett tillsynsvägledningsansvar för dammsäkerhet som berör samma dammanläggningar.

12. Beredskap för dammbrott

12.1. Lagen om skydd mot olyckor

Lagen (2003:778) om olyckor (LSO) infördes den 1 januari 2004 samtidigt som räddningstjänstlagen (1986:1102) upphörde att gälla. Avsikten med lagen är att klargöra ansvaret för samhällets räddningstjänst och att tillhandahålla ett ramverk för räddningstjänstens organisation.

12.1.1. Räddningstjänst och räddningsinsats

Bestämmelserna i LSO syftar till att i hela landet bereda människors liv och hälsa samt egendom och miljö ett med hänsyn till de lokala förhållandena tillfredsställande och likvärdigt skydd mot olyckor, 1 kap. 1 § LSO. Räddningstjänsten ska enligt 1 kap. 3 § LSO planeras och organiseras så att räddningsinsatserna kan påbörjas inom godtagbar tid och genomföras på ett effektivt sätt. Med räddningstjänst avses de räddningsinsatser staten eller kommunerna ska svara för vid olyckshändelser och överhängande fara för olyckshändelser för att hindra eller begränsa skador på människor eller egendom eller i miljön, se 1 kap. 2 § LSO. Ansvaret för räddningsinsatser kan således åvila både staten och kommunerna. Kommunerna och de statliga myndigheter som ansvarar för verksamhet ska enligt 1 kap. 6 § LSO samordna verksamheten samt samarbeta med varandra och med andra som berörs.

Med olyckshändelser avses enligt förarbetena till LSO plötsligt inträffade händelser som har medfört eller som kan befaras medföra skada. Hit räknas händelser som beror på företeelser i naturen eller som beror på människors handlande eller underlåtenhet att handla. Exempel på händelser är brand, explosion, skred, ras, översvämningar, oväder och utflöden av skadliga ämnen. Kravet att det ska vara fråga om en plötsligt inträffad händelse

innebär att långsamma och ständigt pågående skeenden som sättningar i byggnader och jorderosioner inte räknas som olyckshändelser. Sådana skeenden kan emellertid orsaka något som inträffar plötsligt och som medför skada, t.ex. att erosionen leder till ett jordskred.1

Om olyckan inte redan inträffat krävs enligt definitionen på räddningstjänst att det måste föreligga en överhängande fara för att den inträffar för att det ska vara fråga om en räddningstjänstsituation. Det innebär att effekten av en olycka inte behöver inväntas för att en räddningsinsats ska påbörjas.

Skyldighet för staten eller kommunen att göra en räddningsinsats föreligger endast om det med hänsyn till behovet av ett snabbt ingripande, det hotade intressets vikt och kostnaderna för insatsen samt omständigheterna i övrigt är påkallat att det allmänna griper in. Syftet är att det allmänna ska hålla en organisation som kan vidta åtgärder när den enskilde inte själv eller med anlitande av någon annan kan klara av en olyckssituation.

12.1.2. Enskildas skyldigheter

LSO är uppdelad på ansvar för enskilda, kommunen och staten. Den enskilde, fysisk eller juridisk person, har ett primärt ansvar för att skydda sitt liv och sin egendom och att inte orsaka olyckor. I första hand ankommer det på den enskilde att själv vidta och bekosta åtgärder i syfte att förhindra olyckor och begränsa skador till följd därav. Först om en olycka inträffar eller överhängande fara råder för att en olycka ska inträffa och den enskilde inte själv eller med anlitande av någon annan kan klara av situationen, är det som redan nämnts samhällets skyldighet att ingripa.

Den som upptäcker eller på annat sätt får kännedom om en brand eller en olycka som innebär fara för någons hälsa eller för miljön ska, om det är möjligt, varna dem som är i fara och vid behov tillkalla hjälp, se 2 kap. 1 § LSO. Detta gäller också den som får kännedom om att det föreligger en överhängande fara för en brand eller en sådan olycka. Bestämmelserna är självfallet tillämpliga för t.ex. personal vid en dammanläggning.

LSO reglerar endast skyldighet att vidta förebyggande åtgärder avseende brand, se 2 kap. 2 § LSO. Utöver dessa bestämmelser om brand saknas bestämmelser om förebyggande åtgärder i LSO.

1Prop. 2002/03:119, s. 68.

Vid en anläggning där verksamheten innebär fara för att en olycka ska orsaka allvarliga skador på människor eller miljön, är anläggningens ägare eller den som utövar verksamheten på anläggningen skyldig att i skälig omfattning hålla eller bekosta beredskap med personal och egendom och i övrigt vidta nödvändiga åtgärder för att hindra eller begränsa sådana skador, 2 kap. 4 § LSO. Denna bestämmelse behandlas utförligare i avsnitt 12.2.

12.1.3. Kommunens skyldigheter

Intentionerna med LSO är att kommunerna ska ta initiativ till ett brett säkerhetsarbete. Som redan nämnts har kommunerna ett ansvar att planera och organisera räddningstjänsten så att räddningsinsatserna kan påbörjas inom godtagbar tid och genomföras på ett effektivt sätt. Varje kommun har därmed möjlighet att anpassa verksamheten till de risker som finns i just den kommunen.

Kommunen ska enligt 3 kap. 7 § LSO ansvara för räddningstjänsten inom kommunen då det inte är fråga om statlig räddningstjänst. Vad som omfattas av statlig räddningstjänst framgår av 4 kap. LSO. Det är fråga om bl.a. fjällräddning, sjöräddning och räddningstjänst vid utsläpp av radioaktiva ämnen från en kärnteknisk anläggning. Olyckor med dammar eller översvämningar omfattas inte av statlig räddningstjänst utan utgör ett kommunalt ansvar. Om en räddningsinsats i kommunal tjänst har medfört betydande kostnader har kommunen rätt till ersättning från staten. Kostnaderna ersätts till den del de överstiger en självrisk, se 7 kap. 3 § LSO. Vid omfattande räddningsinsatser kan emellertid staten genom länsstyrelsen ta över ansvaret för en räddningsinsats, se mer nedan. Även om länsstyrelsen tar över ansvaret för räddningsinsatsen är det fortfarande kommunal räddningstjänst. Det innebär att lagens krav om behörighet, rätten till ersättning m.m. gäller.

Räddningsledaren vid den kommunala räddningstjänsten, är antingen räddningschefen själv eller den som han eller hon har utsett. En räddningsledare har enligt LSO stora befogenheter. Han eller hon kan enligt bestämmelser i 6 kap. LSO besluta om tjänsteplikt eller ingrepp i annans grundlagsskyddade rätt, t.ex. avspärra eller utrymma områden, bereda sig och medverkande personal tillträdande till annans fastighet om ingreppet är försvarligt med hänsyn till farans beskaffenhet, den skada som vållas genom ingreppet och omständigheterna i övrigt. I detta sammanhang kan

påpekas att om det är överhängande fara för skador på människor, egendom eller i miljön och därmed bestämmelserna för räddningstjänst gäller kan en räddningsledare, under vissa omständigheter, ingripa i driften av en dammanläggning genom att besluta om förhandstappning eller om att stoppa tappning så att dämningsgränsen överskrids. Se mer om detta i avsnitt 3.6.4 och 3.7.1 om möjligheten att frångå angiven dämnings- eller sänkningsgräns i dom.

Kommunerna har ett ansvar för att förebyggande åtgärder vidtas för att skydda mot brand eller skador till följd av brand. För skydd mot andra olyckor har kommunerna endast ansvar att främja samverkan mellan olika aktörer för att ett olycks- och skadeförebyggande arbete utförs, se 3 kap. 1 § LSO. Det innebär att kommunerna inte har något självständigt ansvar för andra förebyggande åtgärder än sådana mot brand. Kommunerna ska endast verka för att brister i säkerheten vid olika anläggningar och verksamheter rättas till. Det är följaktligen upp till varje kommun att bestämma ambitionerna i ett sådant förebyggande arbete.

Handlingsprogram

För att uppfylla de nationella målen såsom de anges i 1 kap. 1 § LSO ska kommunen ha ett handlingsprogram. I handlingsprogrammet ska anges hur den förebyggande verksamheten är ordnad och hur den planeras. Organisationen och de resurser som kommunen har eller planerar för verksamheten ska beskrivas. För att kunna utforma ett handlingsprogram måste kommunen skapa sig en bild av de risker för olyckor som finns inom kommunen. Riskbilden ska sedan utgöra grunden för den förebyggande verksamhetens inriktning och genomförande. Kommunernas tillsyn enligt LSO verkar förebyggande och ryms inom den förebyggande verksamheten som kommunen ska ansvara för. Hur tillsynsverksamheten är ordnad ska därför också redovisas i handlingsprogrammen. Kommunen ska även ha ett handlingsprogram för räddningstjänsten. I programmet ska kommunen beskriva vilken förmåga kommunen har och avser att skaffa sig för att göra räddningsinsatser. Förmågan ska redovisas för både förhållanden i fred och under höjd beredskap. För att kommunerna ska kunna redovisa de risker som finns inom kommunens gränser krävs att det görs en riskinventering och en riskanalys med åtföljande risk-

bedömning. Handlingsprogrammen ska utformas i samråd med berörda myndigheter varvid bl.a. länsstyrelsen ska ges tillfälle att yttra sig. Kommunfullmäktige eller den beslutande församlingen i ett kommunalförbund ska anta handlingsprogrammen varje ny mandatperiod.

Handlingsprogrammen ska således spegla den politiska viljan från kommunens sida att förebygga olyckor och bedriva en effektiv räddningstjänst. Därutöver ska handlingsprogrammen också vara ett underlag för kommunens planering, t.ex. detalj- och översiktsplaner samt vara en informationskanal till allmänheten om hur arbetet med skydd mot olyckor är planerat och ordnat.

Av 3 kap. 6 och 8 §§ LSO framgår att om synnerliga skäl finns får regeringen besluta om ändring av handlingsprogrammen. En sådan ändring får ske på framställan av MSB. Det är länsstyrelsen som har att uppmärksamma MSB på att allvarliga brister föreligger.

Plan för räddningsinsatser

Utöver redan nämnda skyldighet att planera och organisera räddningstjänsten stadgas det särskilt om planer för räddningsinsatser i 3 kap. 6 § förordningen (2003:789) om skydd mot olyckor (FSO). Av bestämmelsen följer att kommunen ska upprätta en särskild plan för räddningsinsatser för anläggningar som omfattas av kravet på säkerhetsrapport enligt Sevesolagstiftningen. Krav på en sådan plan gäller även för riskanläggningar enligt utvinningsavfallsförordningen som inte omfattas av nyss nämnda bestämmelse i Sevesolagstiftningen. Planen ska ha den omfattning som säkerheten för omgivningen kräver.

MSB har i föreskrifter, SRVFS 2005:2, bestämt ett antal minimikrav för vad en sådan plan ska innehålla. Planen ska innehålla uppgifter om hur räddningsinsatser i händelse av en allvarlig kemikalieolycka vid berörd verksamhet ska genomföras. Uppgifterna ska även avse hur de resurser som behövs för sådana insatser ska samordnas. Av planen ska även framgå hur allmänheten ska varnas och informeras vid en allvarlig kemikalieolycka samt en beskrivning av de åtgärder som allmänheten ska vidta i händelse av en sådan olycka. Enligt föreskrifterna ska en sådan plans funktion och ändamålsenlighet säkerställas genom övning minst vart tredje år.

Informationsskyldighet

Kommunen har en generell informationsskyldighet enligt LSO. Av 1 kap. 7 § LSO följer att kommunen ska se till att allmänheten informeras om vilken förmåga att göra räddningsinsatser som finns samt lämna upplysning om hur varning och information sker till allmänheten vid allvarliga olyckor. Detta kan t.ex. fullgöras genom att handlingsprogrammen för räddningstjänst tillkännages. Någon skyldighet att informera allmänheten om risker med en verksamhet föreligger inte enligt bestämmelsens ordalydelse.

Enligt 14 § i Sevesolagen ska kommunen se till att personer som löper risk att påverkas av en allvarlig kemikalieolycka informeras. Kravet gäller endast de anläggningar som enligt Sevesolagen omfattas av den högre kravnivån. Informationen ska avse vilka säkerhetsåtgärder som ska vidtas och hur man ska agera vid en olycka. Informationsansvaret gäller även i förhållande till personer i andra kommuner eller utomlands. Det är verksamhetsutövaren som svarar för kostnaderna för den information som ska ges.

Även enligt 40 § i utvinningsavfallsförordningen ska kommunen se till att personer som löper risk att påverkas av en allvarlig olycka vid en riskanläggning informeras om säkerheten vid anläggningen.

12.1.4. Länsstyrelsens skyldigheter

Länsstyrelsen ska genom rådgivning och information stödja kommunerna i deras verksamhet enligt LSO, se 1 kap. 5 § LSO. Det avses ske vid sidan om den tillsyn länsstyrelsen ska utöva över kommunernas skyldigheter.

Om det fordras omfattande räddningsinsatser i kommunal räddningstjänst får länsstyrelsen ta över ansvaret för räddningstjänsten i de kommuner som berörs av insatserna. Av bestämmelsens ordalydelse följer att det inte är en skyldighet för länsstyrelsen att ta över ansvaret. För detta ansvar behöver även länsstyrelsen upprätta en plan. Den fastställda planen ska ha ett aktuellt innehåll och beakta lokala förhållanden och troliga olycksscenarier. Planen ska vara övad, allmänheten ha möjlighet att få information om innehållet i planerna samt att presumtiva räddningsledare är utsedda. Innan planen fastställs ska den ha varit på remiss hos kommunerna i länet och berörda myndigheter. Även länsstyrelsen har en skyldighet att informera allmänheten om innehållet i planen.

Om flera län berörs av en räddningsinsats får länsstyrelsen komma överens om vilken länsstyrelse som får ta över ansvaret för räddningstjänsten i kommunerna, se 4 kap. 33 § FSO.

12.1.5. Myndigheten för samhällsskydd och beredskap

MSB är central tillsynsmyndighet över LSO och har som sådan ett tillsynsvägledningsansvar gentemot länsstyrelsen och deras tillsyn över kommunernas skyldigheter. Tillsynsvägledningen utgörs främst av metodstöd, resursstöd och kompetensutveckling. Därutöver gör MSB tillsammans med länsstyrelserna en årlig uppföljning av kommunernas verksamhet.

12.1.6. Tillsyn enligt LSO

Enligt 5 kap. 1 § LSO utövar kommunerna tillsyn över efterlevnaden av lagen inom kommunen. Länsstyrelsen har motsvarande ansvar inom länet. MSB utövar den centrala tillsynen i landet.

Kommunens tillsyn

Den kommunala tillsynen ska riktas mot enskilda subjekt och utövas som en kontroll av att LSO och föreskrifter meddelade med stöd av lagen uppfylls. Det är således de skyldigheter som stadgas i 2 kap. LSO som omfattas av kommunens tillsyn. För dammanläggningar och dess ägare ska kommunens tillsyn avse skyldigheterna i 2 kap. 4 § LSO i fall anläggningen enligt beslut omfattas av dessa bestämmelser.

Av 5 kap. 2 § första stycket följer att tillsynsmyndigheten har rätt att få de upplysningar och handlingar som behövs för tillsynen. Enligt andra stycket får tillsynsmyndigheten meddela de förelägganden och förbud som behövs i enskilda fall för att LSO eller föreskrifter meddelade med stöd av LSO ska efterlevas. Ett föreläggande eller förbud kan förenas med vite. Om någon inte vidtar en åtgärd som denne är skyldig att vidta enligt tillsynsmyndighetens föreläggande, får myndigheten vidta åtgärden på dennes bekostnad.

Kommunen har endast rätt att ta ut avgift för sin tillsyn enligt 2 kap. 2 § LSO. Bestämmelsen avser skyldighet för en ägare eller

nyttjanderättshavare till byggnader eller andra anläggningar att hålla med utrustning och vidta vissa åtgärder med anledning av brand. Kommunen har således ingen rätt att ta ut avgift för tillsyn över farlig verksamhet.

Enligt förarbeten till LSO bör tillsynen över farlig verksamhet samordnas med annan tillsyn som utövas mot ägare eller utövare av verksamhet vid sådana anläggningar. Bl.a. avses länsstyrelsens och kommunens tillsynsansvar enligt Sevesolagstiftningen och MB.2

Länsstyrelsernas tillsyn

Länsstyrelsernas tillsyn enligt LSO är i huvudsak inriktad mot kommunernas verksamhet. Genom tillsynen ska länsstyrelsen bedöma om kommunerna lever upp till de mål som framgår av LSO och de som satts upp i de kommunala handlingsprogrammen. Länsstyrelsen ska även granska att kommunerna följer upp och utvärderar den egna verksamheten. Syftet med tillsynen är att få en likvärdig utveckling och likvärdiga förhållanden i hela landet. Det är resultatet av den kommunala verksamheten som ska bedömas, inte metoderna för att uppnå resultatet.

Länsstyrelsen har däremot inte någon möjlighet att genom föreläggande kräva att en kommun ska utföra stadgade skyldigheter enligt LSO. Enligt förarbetena utgick man från att kommunerna vill och kan organisera en effektiv räddningstjänst och ett effektivt förebyggande arbete. För det fall länsstyrelsen vid sin tillsyn i en kommun upptäcker att kommunen underlåtit att vidta åtgärder mot en enskild som inte fullgjort sina skyldigheter har länsstyrelsen möjlighet att ingripa genom förelägganden eller förbud. Befogenheterna ska endast användas i undantagsfall. Som huvudregel ska en sådan fråga lösas genom en dialog mellan den statliga tillsynsmyndigheten och den berörda kommunen.3

MSB:s tillsyn

MSB granskar länsstyrelsernas planläggning och beredskap i händelse av en kärnenergiolycka eller för övertagande av ansvaret för kommunal räddningstjänst. Tillsynen sker genom granskning av de

2Prop. 2002/03:119, s. 73. 3Prop. 2002/03:119, s. 73 f.

program och planer som länsstyrelsen ska ta fram för området samt genom tillsynsbesök hos länsstyrelserna. Årligen genomförs också en uppföljning av utvalda delar av länsstyrelsernas arbete inom detta område.

12.2. Särskilt om farlig verksamhet enligt LSO

Vid en anläggning där verksamheten innebär fara för att en olycka ska orsaka allvarliga skador på människor eller miljön, är ägaren eller den som utövar verksamheten skyldig att i skälig omfattning hålla eller bekosta beredskap med personal och egendom och i övrigt vidta nödvändiga åtgärder för att hindra eller begränsa sådana skador, 2 kap. 4 § LSO. Bestämmelsen överfördes med vissa justeringar från 43 § räddningstjänstlagen. Exempel på anläggningar som omfattas av bestämmelsen är anläggningar där farliga ämnen produceras eller hanteras, t.ex. industrianläggningar och hamnar med oljehantering.

Dammar med en sådan uppdämd vattenvolym eller som innehåller föroreningar i en sådan mängd att allvarliga skador på människor eller miljön kan uppstå vid dammbrott bör enligt MSB:s allmänna råd SRFVS 2004:8 omfattas av skyldigheterna vid farlig verksamhet. I Sverige finns i dag drygt 100 dammanläggningar som efter beslut utgör farlig verksamhet.

Vad som avses med olycka i SRFVS 2004:8 överensstämmer i stort med definitionen av olyckshändelse som redovisats i avsnitt 12.1.1. Som olyckor räknas också händelser som beror på människors handlande eller underlåtenhet att handla. Detta gäller oberoende om handlingen eller underlåtenheten är uppsåtlig eller inte. Med allvarliga skador på människor menas dödsfall eller svåra skador som kräver långvarig vård. Vid bedömningen bör man beakta fara för allvarliga skador på människor såväl inom som utanför anläggningen.

Enligt 2 kap. 3 § FSO är det länsstyrelsen som efter samråd med kommunen beslutar om vilka anläggningar som omfattas av ägarens eller verksamhetsutövarens skyldigheter enligt 2 kap. 4 § LSO. Ett sådant beslut kan överklagas i förvaltningsrättslig ordning.

12.2.1. Beredskap och andra åtgärder

Som redan nämnts är ägaren eller den som utövar verksamheten skyldig att i skälig omfattning hålla eller bekosta beredskap med personal och egendom och i övrigt vidta nödvändiga åtgärder för att hindra eller begränsa sådana allvarliga skador som bestämmelsen i 2 kap. 4 § LSO avser. Bestämmelsen syftar till att begränsa skador i och utanför anläggningen vid en olycka som redan inträffat. Det är förberedande och vid räddningsinsatsen stödjande åtgärder som avses.

De räddningsinsatser som kan behövas vid en olycka i en dammanläggning skiljer sig på väsentligt sätt från de räddningsinsatser kommunen normalt kan behöva genomföra. Beredskapen som en dammägare ska hålla eller bekosta bör därför motsvara den förhöjda risken som den farliga verksamheten medför. Vid bedömningen om vad som är skäligt ska en avvägning göras mellan kostnaden för att genomföra åtgärderna och den nytta de medför. Onödigt dyra åtgärder ska givetvis undvikas om ett lika gott skydd kan uppnås på ett för ägaren eller verksamhetsutövaren ekonomiskt mer fördelaktigt sätt. Vid skälighetsbedömningen ska man emellertid inte beakta den enskilde verksamhetsutövarens ekonomiska förmåga.

Hur verksamhetsutövarens beredskap utformas kan se olika ut. Det är verksamhetsutövarens ansvar att utforma beredskapen men det bör ske i dialog med kommunen. Verksamhetsutövaren kan själv hålla med egen personal och utrustning i viss omfattning som komplement till kommunens räddningstjänst. Istället för egen beredskap kan verksamhetsutövaren även stå kostnaden för den utökade beredskap som anläggningen i fråga aktualiserar. Man kan även kombinera egen beredskap med ekonomiskt bidrag till kommunen. Enligt de redan angivna allmänna råden från MSB kan exempel på beredskapsåtgärder vara:

Beredskap med personal:

1. egen eller anlitad personal organiserade i t.ex. räddningsstyrka,

servicestyrka eller styrka med annan uppgift,

2. personal för vägledning eller biträde till kommunens organi-

sation för räddningstjänst,

3. maximerad insatstid för viss personal,

4. förstärkt kompetens i verksamheten, t.ex. experter.

Beredskap med egendom:

1. utrustning för släckning av brand,

2. utrustning för uppsamling av kemikalier eller släckvatten,

3. utrustning för begränsning av utflöde,

4. pumpar, länsor, skimmer, tätnings- eller läktringsutrustning,

5. sorptionsmedel, neutralisationsmedel, utrustning för nedtvätt-

ning av gaser, återkondenseringsutrustning, släckmedel m.m.

Särskilda anläggningstekniska åtgärder:

1. fasta släckningsanordningar,

2. varningsanordningar,

3. insats- och utrymningsvägar,

4. reservsystem för särskilt viktiga funktioner,

5. ventilationssystem,

6. luftdepåer och säkerhetsrum,

7. övervakningssystem för överfyllnad, mätning och analys av

läckage m.m.

Om inte kommunen och verksamhetsutövaren kommer överens om vilka åtgärder som ska vidtas kan kommunen förelägga verksamhetsutövaren att vidta vissa åtgärder med stöd av 5 kap. 2 § andra stycket LSO.

12.2.2. Riskanalys

Den som utövar verksamheten vid en sådan anläggning som omfattas av bestämmelserna i 2 kap. 4 § LSO är skyldig att analysera riskerna för sådana olyckor som bestämmelsen avser.

En riskanalys bör enligt förarbetena till LSO innehålla en beskrivning av möjliga scenarier för sådana olyckor som skulle kunna medföra allvarliga skador på människor eller miljön. Vidare bör sannolikheten för att olyckor av det slaget skulle kunna ske eller omständigheter under vilka det kan inträffa redogöras för. En sammanställning bör också göras av sådana händelser som skulle kunna bidra till uppkomsten av scenarierna. Även händelser som kan inträffa utanför verksamheten bör beaktas. Vidare bör riskanalysen innehålla en bedömning av hur omfattande och svåra konsekvenserna skulle kunna bli för människor eller miljön av de olyckor som beskrivits.

Analysen ska i första hand kunna tjäna som underlag för bedömningen av vilken beredskap för effektiva räddningsinsatser som behöver upprätthållas vid anläggningen för att komplettera den kommunala insatsberedskapen. Det kan handla om personal med särskild kompetens och kännedom om verksamheten samt om specialutrustning av olika slag, beroende på verksamhetens art. Riskanalysen ska hållas aktuell och på begäran kunna redovisas till kommunen.

Enligt de allmänna råden SRVFS 2004:8 bör riskanalysen innehålla följande delar:

1. beskrivning av analysens syfte, mål och avgränsningar,

2. beskrivning av anläggningen, den verksamhet (inklusive orga-

nisation) som bedrivs där samt anläggningens omgivning,

3. identifiering av de olyckor som kan orsakas av verksamheten,

4. beskrivning av händelser som kan leda till olyckor,

5. beräkning eller annan beskrivning av sannolikheten (eller fre-

kvensen) för identifierade olyckor,

6. beräkning eller annan beskrivning av konsekvensen av identifi-

erade olyckor,

7. beräkning eller annan beskrivning av risken för identifierade

olyckor,

8. slutsatser,

9. referenser.

Av de allmänna råden framgår även att den som utövar verksamheten bör ha rutiner för hur riskanalysen ska genomföras och

hållas aktuell. Rutinerna bör bland annat klargöra ansvaret för genomförande och uppdatering samt vilken kompetens som behövs i riskanalysarbetet. Den som utövar verksamheten bör förnya och uppdatera riskanalysen vart femte år, eller tidigare om det finns särskilda skäl. Särskilda skäl för att förnya och uppdatera riskanalysen kan exempelvis vara förändringar i anläggningen, verksamheten, processen, organisationen, bemanningen eller rutiner. Även förändringar i anläggningens omgivning kan vara sådana särskilda skäl.

12.2.3. Varning och underrättelser vid olycka

Den som upptäcker eller på annat sätt får kännedom om en brand eller om en olycka om innebär fara för någons liv eller allvarlig risk för någons hälsa eller för miljön ska, om det är möjligt, varna dem som är i fara och vid behov tillkalla hjälp, 2 kap. 1 § LSO. Detsamma gäller den som får kännedom om att det föreligger en överhängande fara för en brand eller en sådan olycka.

Om en olycka som kan orsaka allvarliga skador på människor eller miljön inträffar vid en anläggning som klassats som farlig enligt 2 kap. 4 § LSO ska den kommunen där anläggningen är belägen omgående informeras. MSB ska likaså underrättas. Informationen ska även ges i de fall en överhängande fara för en sådan olycka föreligger. Det kan t.ex. avse driftstörningar som skulle kunna leda till en allvarlig olycka. Informationsskyldigheten infördes i lagen i samband med att Sevesodirektivet implementerades i svensk lagstiftning. Vad informationen ska innehålla anges i 2 kap. 4 § FSO. MSB har ansvar att omgående informera regeringen och andra berörda myndigheter om sådana olyckor eller för det fall en överhängande fara för en allvarlig olycka föreligger.

Ägaren eller verksamhetsutövaren till en farlig verksamhet enligt LSO får enligt 2 kap. 5 § FSO använda de varningsanordningar som installerats för varning av befolkningen under höjd beredskap och vid olyckor i fred. Det förutsätter dock att kommunen gett sitt medgivande. Enligt de allmänna råden SRVFS 2004:8 kan då ägaren eller verksamhetsutövaren komplettera utrustningen så att signalen viktigt meddelande går att utlösa direkt från anläggningen.

12.3. Krisberedskap

Enligt regeringens skrivelse 2009/10:1244 avses med kris en händelse som drabbar många människor och stora delar av samhället och som hotar grundläggande värden och funktioner. Kris är ett tillstånd som inte kan hanteras med normala resurser och organisation. En kris är oväntad, utanför det vanliga och vardagliga. Att lösa krisen kräver samordnade åtgärder från flera aktörer.

Med samhällets krisberedskap avses samhällets samlade förmåga att hantera allvarliga händelser och kriser. I arbetet med att vidmakthålla och utveckla samhällets krisberedskap vidtar olika aktörer i samhället åtgärder i syfte att kunna upprätthålla de viktigaste samhällsfunktionerna, möta de nödvändigaste behoven och lindra konsekvenserna för samhället och dess medborgare när allvarliga händelser och allvarliga störningar inträffar som hotar samhällets funktionalitet. En god krisberedskap i samhället innebär att de aktörer som har ansvar för att hantera allvarliga händelser och kriser har goda förutsättningar för detta.

Förordning (2006:942) om krisberedskap och höjd beredskap reglerar olika myndigheters ansvar för krisberedskap. Enligt förordningen avses med krisberedskap bl.a. förmågan att genom den organisation och de strukturer som skapas före, under och efter en kris förebygga, motstå och hantera krissituationer. Det ska ske genom utbildning, övning och andra åtgärder. I en bilaga till förordningen anges de myndigheter som har ett särskilt ansvar för att planera och vidta förberedelser för att hantera en kris.

12.3.1. Ansvarsprincipen, likhetsprincipen och närhetsprincipen

Arbetet med samhällets krisberedskap utgår från ansvarsprincipen, vilken innebär att den som har ansvar för en verksamhet under normala förhållanden har motsvarande ansvar under kris- och krigssituationer. Ansvarsprincipen innebär också ett ansvar för varje aktör att samverka med andra. Krisberedskapsförmågan byggs därmed upp hos många olika aktörer i samhället. En kris påverkar ofta flera samhällssektorer och därmed verksamheter, vilket gör att förberedelser måste ske både inom en sektor och över sektors-

4 Skr. 2009/10:124 Samhällets krisberedskap - stärkt samverkan för ökad säkerhet.

gränser. Detta ställer krav på samverkan och samordning mellan olika aktörer.

Med likhetsprincipen menas att verksamheten ska fungera på liknande sätt och på samma plats vid en kris som vid normala förhållanden. Det får självklart ske så långt det är möjligt.

En kris ska hanteras där den inträffar och av dem som är närmast berörda och ansvariga vilket följer av närhetsprincipen. Den drabbade kommunen och det aktuella landstinget ska i första hand ansvara för insatsen. Om de lokala resurserna inte räcker till blir det aktuellt med regionala och statliga insatser.

12.3.2. Geografiskt områdesansvar

Områdesansvaret finns på kommunal nivå (lokalt), på länsstyrelse- och landstingsnivå (regionalt) samt på central myndighetsnivå och regeringsnivå (nationellt). Med områdesansvar avses ett geografiskt område med ett organ som ansvarar för att inrikta, prioritera och samordna tvärsektoriella åtgärder som behövs vid en given situation. Vid en kris ska de som har ett geografiskt områdesansvar verka för att samordningen fungerar mellan alla som är inblandande i krisberedskapen t.ex. myndigheter, företag, frivilligorganisationer, trossamfund och föreningar. De områdesansvariga ska också samordna informationen till allmänheten vid en kris. Däremot övertar de inte ansvaret från någon annan utan myndigheter och organisationer behåller sitt ansvar inom sitt verksamhetsområde.

12.3.3. Länsstyrelsens ansvar för krisberedskap

Länsstyrelsen är geografiskt områdesansvarig myndighet enligt förordningen (2006:942) om krisberedskap och höjd beredskap. Genom sin verksamhet ska länsstyrelsen minska sårbarheten i samhället, bevaka att risk- och beredskapshänsyn tas i samhällsplaneringen samt utveckla en god förmåga att hantera sin uppgift under fredstida krissituationer och höjd beredskap. Vid en allvarlig kris ska länsstyrelsen omgående kunna upprätta en ledningsfunktion för bl.a. samordning och information. Det gäller om krisen berör länet eller medför behov av samverkan med kommuner eller andra aktörer, se 53 § förordningen (2007:825) med länsstyrelseinstruktion. Länsstyrelsen ska även ha en tjänsteman i

beredskap med uppgift att initiera och samordna det inledande arbetet för att upptäcka, verifiera, larma och informera vid allvarliga kriser som berör länet.

Avseende krisberedskap ska länsstyrelsen vara sammanhållande inom sitt län. Såväl före, under och efter en kris ska länsstyrelsen verka för samordning och gemensam inriktning av de åtgärder som behöver vidtas. Enligt 54 § länsstyrelseinstruktionen ska länsstyrelsen särskilt:

1. ansvara för att en samlad regional lägesbild sammanställs vid

krissituationer,

2. stödja de aktörer som är ansvariga för krisberedskapen i länet

avseende planering, risk- och sårbarhetsanalyser samt utbildning och övning,

3. ha ett regionalt råd för skydd mot olyckor och krisberedskap, i

vilket representanter för länsstyrelsen och berörda aktörer i krishanteringssystemet bör ingå, för att skapa nödvändig samordning,

4. upprätta regionala risk- och sårbarhetsanalyser som ska kunna

användas som underlag för egna och andra berörda aktörers krisberedskapsåtgärder,

5. följa upp kommunernas tillämpning av lagen (2006:544) om

kommuners och landstings åtgärder inför och vid extraordinära händelser i fredstid och höjd beredskap,

6. årligen till MSB rapportera vilka beredskapsförberedelser som

kommuner och landsting vidtagit och samtidigt redovisa en bedömning av effekten av de vidtagna förberedelserna, samt

7. verka för att den verksamhet som berörda aktörer bedriver inom

länet avseende krisberedskap bidrar till att en grundläggande förmåga till civilt försvar uppnås.

12.3.4. Anslag 2:4 krisberedskap

Huvuddelen av de insatser som genomförs för att stärka samhällets krisberedskap finansieras och genomförs i den ordinarie verksamheten hos berörda aktörer enligt ansvarsprincipen. För att finansiera särskilda satsningar inom prioriterade områden har regeringen inrättat ett särskilt anslag – krisberedskapsanslaget. Ändamålet är

att finansiera åtgärder som stärker samhällets samlade beredskap och förmåga att hantera allvarliga kriser och deras konsekvenser. Anslaget ska även i viss utsträckning finansiera åtgärder som syftar till att skapa eller vidmakthålla en grundläggande försvarsförmåga och förmågan för att ta emot stöd från andra länder vid allvarliga kriser.

Enligt regeringen ska anslaget huvudsakligen användas för åtgärder som stärker samhällets samlade krisberedskap men där finansieringsansvaret för verksamheten inte kan knytas till en myndighet utifrån ansvarsprincipen. Den verksamhet som finansieras över anslaget ska vidare ha påvisbara effekter på samhällets samlade krisberedskap eller på den samlade förmågan att hantera kriser och dess konsekvenser.

De myndigheter som anges i bilagan till förordningen (2006:942) om krisberedskap och höjd beredskap, eller som pekats ut att delta i arbetet i samverkansområdena efter särskilt beslut av regeringen eller MSB, t.ex. Svenska kraftnät och samtliga länsstyrelser kan söka medel från anslaget. MSB beslutar om fördelning av anslaget.

12.3.5. Rakel – RAdioKommunikation för Effektiv Ledning

Riksdagen beslutade år 2003 om utbyggnad och införande av Rakel. Det är Sveriges nationella kommunikationssystem för samverkan och ledning. Systemet har byggts ut i hela Sverige för att stärka samhällets krishanteringsförmåga och för att underlätta den dagliga kommunikationen hos organisationer som arbetar med allmän ordning, säkerhet eller hälsa. Systemet används av centrala statliga myndigheter, länsstyrelser, kommuner och landsting samt av privata aktörer med samhällsviktig verksamhet, t.ex. elbolag.

Staten äger Rakelsystemets infrastruktur. MSB ansvarar för utbyggnad, drift, förvaltning och utveckling av Rakel. MSB ska även marknadsföra Rakel, sälja abonnemang och ansluta kunder.

12.3.6. Lagen om kommuners och landstings åtgärder inför och vid extraordinära händelser i fredstid och höjd beredskap

5

Lagen (2006:544) om kommuners och landstings åtgärder inför och vid extraordinära händelser vid fredstid och höjd beredskap syftar till att kommuner och landsting ska minska sårbarheten i sin verksamhet och ha en god förmåga att hantera krissituationer i fred. Kommuner och landsting ska därigenom också uppnå en grundläggande förmåga till civilt försvar. Kommun- och landstingsledningarna har genom lagen förutsättningar för att vid kriser göra