SOU 2006:50

En ny lag om värdepappersmarknaden

Till statsrådet Sven-Erik Österberg

Regeringen beslutade den 23 juni 2004 att tillkalla en särskild utredare med uppdrag att se över frågor som rör lagstiftningen för värdepappersinstitut, börser och auktoriserade marknadsplatser (Dir 2004:90). Till särskild utredare förordnades f.d. generaldirektören Hans Jacobson.

Sedan Hans Jacobson den 3 oktober 2005 avlidit förordnades justitierådet Johan Munck den 21 oktober 2005 att vara särskild utredare. Övriga medverkande i utredningens arbete anges på nästa sida.

Utredningen har antagit namnet Värdepappersmarknadsutredningen.

Utredningen får härmed överlämna sitt huvudbetänkande En ny lag om värdepappersmarknaden (SOU 2006:50). Särskilt yttrande har avgetts av Ülle-Reet Jakobson.

Utredningsuppdraget fortsätter med sikte på ett slutbetänkande i juli 2006.

Stockholm i april 2006

Johan Munck

/ Johan Lycke

Johan Molin Mattias Steen

Förteckning över vilka som har deltagit i utredningens arbete.

Särskilda utredare F.d. generaldirektören Hans Jacobson, t.o.m. den 3 oktober 2005 Justitierådet Johan Munck, fr.o.m. den 21 oktober 2005

Sakkunniga Chefsjuristen Mats Beckman, Stockholmsbörsen AB Verkställande direktören Kerstin Hermansson, Svenska Fondhand-

lareföreningen Finansinspektör Ülle-Reet Jakobson, Finansinspektionen Skattejuristen Anna Jansson, Sveriges Aktiesparares Riksförbund,

fr.o.m. den 19 januari 2006 Group Risk Manager Svante Johansson, Carnegie Investment

Bank AB Kanslirådet Henrik Lennefeldt, Finansdepartementet,

fr.o.m. den 1 juli 2005 Kanslirådet Amina Lundqvist, Justitiedepartementet Dåvarande chefsjuristen Lars Millberg, f.d. Sveriges Aktiesparares

Riksförbund, t.o.m. den 18 januari 2006 Ekonomie doktor Jonas Niemeyer, Sveriges riksbank Hovrättsassessorn Anna Nystedt, Finansdepartementet,

t.o.m. den 30 juni 2006 Departementssekreteraren Catarina Öström, Jordbruksdeparte-

mentet

Sekreterare Bankjuristen Johan Lycke Ekonomie doktor Johan Molin Kammarrättsassessorn Mattias Steen

Assistent Monica Berglund

Författningsförslag

1 Förslag till lag om värdepappersmarknaden

Första avdelningen. Inledande bestämmelser

1 kap. Allmänna bestämmelser

Andra avdelningen. Värdepappersrörelse

2 kap. Tillståndspliktig värdepappersrörelse m.m. 3 kap. Tillstånd för svenska företag 4 kap. Utländska företags verksamhet i Sverige 5 kap. Svenska företags verksamhet utomlands 6 kap. Särskilda bestämmelser om anknutna ombud 7 kap. Förvärv och innehav av egendom

8 kap. Skydd för investerare och andra rörelseregler 9 kap. Information om kurser och omsättningsuppgifter 10 kap. Rapporteringsskyldighet m.m. 11 kap. Särskilda bestämmelser för en MTF

Tredje avdelningen. Börsverksamhet

12 kap. Tillstånd för att driva en reglerad marknad 13 kap. Börsens verksamhet 14 kap. Deltagare i handeln på en reglerad marknad 15 kap. Upptagande av finansiella instrument till handel 16 kap. Information från utgivare 17 kap. Gemensamma bestämmelser om hur

information från utgivare skall offentliggöras 18 kap. Övriga krav på utgivare

Fjärde avdelningen. Clearingverksamhet

19 kap. Tillstånd för clearingverksamhet 20 kap. Clearingorganisationens verksamhet 21 kap. Deltagare i clearingverksamhet

Femte avdelningen. Avslutande bestämmelser

22 kap. Avbrytande av handel m.m. 23 kap. Tillsyn 24 kap. Särskilt om prövningen av ägares lämplighet 25 kap. Ingripanden 26 kap. Överklagande och ansvarsbestämmelse Ikraftträdande och övergångsbestämmelser

2 Förslag till lag om ändring i föräldrabalken

3 Förslag till lag om ändring i kreditupplysningslagen (1973:1173)

4 Förslag till lag om ändring i sekretesslagen (1980:100)

5 Förslag till lag om ändring i försäkringsrörelselagen (1982:713)

6 Förslag till lag om ändring i konkurslagen (1987:672)

7 Förslag till lag om ändring i lagen (1990:661) om avkastningsskatt på pensionsmedel

8 Förslag till lag om ändring i lagen (1991:980) om handel med finansiella instrument

9 Förslag till lag om ändring i lagen (1992:160) om utländska filialer m.m.

10 Förslag till lag om ändring i konkurrenslagen (1993:20)

11 Förslag till lag om ändring i lagen (1993:768) om åtgärder mot penningtvätt

12 Förslag till lag om ändring i lagen (1993:931) om individuellt pensionssparande

13 Förslag till lag om ändring i pantbankslagen (1995:1000)

14 Förslag till lag om ändring i årsredovisningslagen (1995:1554)

15 Förslag till lag om ändring i lagen (1995:1559) om årsredovisning i kreditinstitut och värdepappersbolag

16 Förslag till lag om ändring i lagen (1995:1560) om årsredovisning i försäkringsföretag

17 Förslag till lag om ändring i lagen (1995:1571) om insättningsgaranti

18 Förslag till lag om ändring i lagen (1997:323) om statlig förmögenhetsskatt

19 Förslag till lag om ändring i lagen (1998:710) om vissa bestämmelser om Premiepensionsmyndigheten

20 Förslag till lag om ändring i lagen (1998:1479) om kontoföring av finansiella instrument

21 Förslag till lag om ändring i lagen (1998:1757) om förvaltning av vissa fonder inom socialförsäkringsområdet

22 Förslag till lag om ändring i lagen (1999:158) om investerarskydd

23 Förslag till lag om ändring i bokföringslagen (1999:1078)

24 Förslag till lag om ändring i inkomstskattelagen (1999:1229)

25 Förslag till lag om ändring i lagen (1999:1309) om system för avveckling av förpliktelser på finansmarknaden

26 Förslag till lag om ändring i lagen (2000:35) om byte av redovisningsvaluta i finansiella företag

27 Förslag till lag om ändring i lagen (2000:192) om allmänna pensionsfonder (AP-fonder)

28 Förslag till lag om ändring i lagen (2000:193) om sjätte AP-fonden

29 Förslag till lag om ändring i lagen (2000:562) om internationell rättslig hjälp i brottmål

30 Förslag till lag om ändring i lagen (2000:1087) om anmälningsskyldighet för vissa innehav av finansiella instrument

31 Förslag till lag om ändring i lagen (2001:1227) om självdeklaration och kontrolluppgifter

32 Förslag till lag om ändring i lagen (2003:862) om finansiell rådgivning till konsumenter

33 Förslag till lag om ändring i lagen (2003:1223) om utgivning av säkerställda obligationer

34 Förslag till lag om ändring i lagen (2004:46) om investeringsfonder

35 Förslag till lag om ändring i lagen (2004:297) om bank- och finansieringsrörelse

36 Förslag till lag om ändring i lagen (2005:377) om straff för marknadsmissbruk vid handel med finansiella instrument

37 Förslag till lag om ändring i lagen (2005:405) om försäkringsförmedling

38 Förslag till lag om ändring i aktiebolagslagen (2005:51)

39 Förslag till lag om ändring i lagen (2005:1047) om internationella förhållanden rörande försäkringsföretags och kreditinstituts insolvens

40 Förslag till lag om ändring i lagen (2006:00) om kapitaltäckning och stora exponeringar

41 Förslag till lag om ändring i lagen (2006:00) om offentliga uppköpserbjudanden på aktiemarknaden

19. Författningskommentar

19.1 Förslaget till lag om värdepappersmarknaden

19.2 Andra författningsförslag 19.1.1 Inledning 19.1.2 Förslag till ändring i sekretesslagen (1980:100) 19.1.3 Förslag till lag om ändring i försäkringsrörelse-

lagen (1982:713)

19.1.4 Förslag till lag om ändring i konkurslagen (1987:672) 19.1.5 Förslag till ändring av lagen (1990:661) om avkastning på pensionsmedel 19.1.6 Förslag till lag om ändring i lagen (1991:980) om handel med finansiella instrument 19.1.7 Förslag till lag om ändring i konkurrenslagen (1993:20) 19.1.8 Förslag till lag om ändring i lagen (1993:931) om individuellt pensionssparande 19.1.9 Förslag till lag om ändring i pantbankslagen (1995:1000) 19.1.10 Förslag till lag om ändring i årsredovisningslagen (1995:1554) 19.1.11 Förslag till lag om ändring i lagen (1995:1559) om årsredovisning i kreditinstitut och värdepappersbolag

19.1.12 Förslag till lag om ändring i lagen (1995:1560) om årsredovisning i försäkringsföretag 19.1.13 Förslag till lag om ändring i lagen (1995:1571) om insättningsgaranti 19.1.14 Förslag till lag om ändring i lagen (1997:323) om statlig förmögenhetsskatt 19.1.15 Förslag till lag om ändring i lagen (1998:710) om vissa bestämmelser om Premiepensionsmyndigheten 19.1.16 Förslag till lag om ändring i lagen (1998:1479) om kontoföring av finansiella instrument 19.1.17 Förslag till lag om ändring i lagen (1998:1757) om förvaltning av vissa fonder inom socialförsäkringsområdet 19.1.18 Förslag till lag om ändring i lagen (1999:158) om investerarskydd 19.1.19 Förslag till lag om ändring i inkomstskattelagen (1999:1229) 19.1.20 Förslag till lag om ändring i lagen (2000:35) om byte av redovisningsvaluta i finansiella företag 19.1.21 Förslag till lag om ändring i lagen (2000:192) om allmänna pensionsfonder (AF-fonden) 19.1.22 Förslag till lag om ändring i lagen (2000:193) om sjätte AP-fonden 19.1.23 Förslag till lag om ändring i lagen (2000:1087) om anmälningsskyldighet för vissa innehav av finansiella instrument 19.1.24 Förslag till lag om ändring i lagen (2001:1227) om självdeklaration och kontrolluppgifter 19.1.25 Förslag till lag om ändring i lagen (2003:862) om finansiell rådgivning till konsumenter 19.1.26 Förslag till lag om ändring i lagen (2004:46) om investeringsfonder 19.1.27 Förslag till lag om ändring i lagen (2004:297) om bank- och finansieringsrörelse 19.1.28 Förslag till lag om ändring i lagen (2005:377) om straff för marknadsmissbruk vid handel med finansiella instrument 19.1.29 Förslag till lag om ändring i lagen (2005:405) om försäkringsförmedling

19.1.30 Förslag till lag om ändring i aktiebolagslagen (2005:551) 19.1.31 Förslag till lag om ändring i lagen (2005:1047) om internationella förhållanden rörande försäkringsföretags och kreditinstituts insolvens 19.1.32 Förslag till lag om ändring i lagen (2006:00) om offentliga uppköpserbjudanden på aktiemarknaden

Europaparlamentets och rådets direktiv 2004/39/EG om marknader för finansiella instrument (MiFID)

Rättelse till direktiv 2004/39/EG

Förslag till genomförandedirektiv

Förslag till genomförandeförordning

Förkortningar

ARN Allmänna reklamationsnämnden CAD Rådets direktiv 93/6/EEG av den 15 mars 1993 om kapitalkrav för värdepappersföretag och kreditinstitut CESR The Committee of European Securities Regulators Dir. Kommittédirektiv Ds Departementsserien ECB Europeiska centralbanken EEG Europeiska ekonomiska gemenskapen, numera EG EES Europeiska ekonomiska samarbetsområdet EG Europeiska gemenskapen EGT Europeiska gemenskapens officiella tidning EIB Europeiska investeringsbanken EU Europeiska unionen EUT Europeiska unionens officiella tidning FESCO Federation of the European Securities Commissions FFFS Finansinspektionens författningssamling Genomförande- direktiv

Kommissionens förslag till genomförandedirektiv, Working document ECS/8/2006 rev-1 av den 21 mars 2006

Genomförande- förordning

Kommissionens förslag till genomförandeförordning, Working document ECS/9/2006 rev-1 av den 21 mars 2006

Handelslagen Lagen (1991:980) om handel med finansiella instrument IMF Internationella valutafonden IOSCO International Organization of Securities Commissions ISD Rådets direktiv 93/22/EEG av den 10 maj 1993 om investeringstjänster inom värdepappersområdet KOM KOM-dokument, dokument från kommissionen (COM på engelska) MiFID Europaparlamentets och rådets direktiv 2004/39/EG av den 21 april 2004 om marknader för finansiella instrument och om ändring av rådets direktiv 85/611/EEG och 93/6/EEG och Europaparlamentets och rådets direktiv 2000/12/EG samt upphävande av rådets direktiv 93/22/EEG MTF Multilateralt handelssystem (Multilateral

trading facility)

NBK Näringslivets Börskommitté NJA Nytt juridiskt arkiv, avdelning I NOU Norges offentlige utredninger NYSE New York Stock Exchange OTC-handel Handel som sker direkt mellan två aktörer, jfr handel på en reglerad marknad eller annan marknadsplats (Over the Counter) Prop. Proposition RH Rättsfall från Hovrätterna SIX Scandinavian Information Exchange SFS Svensk författningssamling SOU Statens offentliga utredningar SOX Stockholms Obligationsbörs SOX TRS Transaktionsrapporteringssystem VWAP Volume Weighted Average Price

Sammanfattning

Europaparlamentet och rådet antog i april 2004 ett direktiv om marknader för finansiella instrument (MiFID). MiFID ersätter investeringstjänstedirektivet (ISD) från 1993. I MiFID åläggs medlemsstaterna att införliva gemensamma regler avseende för värdepappersföretag och reglerade marknader – dvs. den verksamhet som i Sverige bedrivs av börser och auktoriserade marknadsplatser. MiFID, som är ett synnerligen omfattande och komplicerat direktiv, har utarbetats inom ramen för den s.k. Lamfalussyprocessen (se närmare om vad det innebär i kap. 6). Som ett led i den processen ska kommissionen anta två rättsakter med kompletterande bestämmelser: ett direktiv och en förordning. Dessa två rättsakter är fortfarande endast förslag när detta betänkande lämnas. Genomförandedirektivet ska införlivas i svensk rätt medan genomförandeförordningen är direkt tillämplig.

Utredningens huvuduppgift har varit att analysera vilka ändringar som krävs i den nuvarande svenska regleringen för att genomföra MiFID. Vidare har det i uppdraget ingått bl.a. att se över Finansinspektionens sanktionsmöjligheter, vilket ansvar Finansinspektionen bör ha för fastställandet av noteringskraven på reglerade marknader samt hanteringen av intressekonflikter hos värdepappersinstitut och börser.

Efter en inledning där förutsättningarna för utredningsarbetet och arbetets bedrivande beskrivs (kap. 1), redogör utredningen i korthet för gällande bestämmelser på värdepappersmarknadsområdet (kap. 2), varefter MiFID i korthet presenteras (kap. 3). Därefter följer ett kapitel om den finansiella handeln i Sverige (kap. 4) och ett om principiella utgångspunkter för finansiell reglering (kap. 5).

Förslagsdelen av betänkandet omfattar kap. 6–18. I det följande redovisar utredningen de viktigaste förslagen i de olika kapitlen i betänkandet.

Vissa principer för en ny reglering (kap. 6)

Utredningen tar i detta kapitel upp vissa principfrågor. Utredningen konstaterar att MiFID i många delar innebär en s.k. fullharmonisering – dvs. medlemsstaterna får inte införa vare sig strängare eller mindre långtgående regler än dem som följer av direktivet och genomförandeåtgärderna. Detta gäller de områden som omfattas av genomförandeförordningen men också, enligt huvudregeln, de områden som omfattas av genomförandedirektivet. I genomförandedirektivet finns ett uttryckligt förbud mot nationella regler som lägger på ytterligare bestämmelser utöver det gemensamma regelverket (s.k. goldplating). Några sådana regler får medlemsstaterna enligt artikel 4 i genomförandedirektivet inte införa annat än i vissa undantagsfall.

Utredningen föreslår i detta kapitel att MiFID genomförs genom att en ny lag ersätter både lagen om värdepappersrörelse och börs- och clearinglagen. Utredningen förslår också att genomförandedirektivet i huvudsak införlivas genom föreskrifter. Även de delar av genomförandeförordningen, där medlemsstaterna har fått rätt att införa kompletterande regler, föreslås bli genomförda genom föreskrifter. Terminologin i den nya lagen bör följa terminologin i MiFID för att underlätta tillämpningen av genomförandeförordningen och utformningen av de föreskrifter som införlivar genomförandedirektivet. En terminologisk enhetlighet underlättar också ambitionen att uppnå en liknande reglering inom EES.

I kapitlet föreslås också att Finansinspektionen ska vara behörig myndighet enligt artikel 48.1 i MiFID, dvs. den myndighet som har ansvar för att de bestämmelser som antas med stöd av direktivet efterlevs.

Tillämpningsområde (kap. 7)

MiFID innehåller en rad nya definitioner och begrepp. Exempel på detta erbjuder finansiella instrument, investeringstjänster, sidotjänster och reglerade marknader. Definitionerna av vad som är finansiella instrument, vilka investeringstjänster som är tillståndspliktiga och vad en reglerad marknad är avgör direktivets tillämpningsområde. Utredningen föreslår i dessa delar att de svenska

definitionerna anpassas både i sak och vad gäller terminologin till MiFID:s definitioner.

Beträffande begreppet finansiella instrument innebär utredningens förslag att en ny definition av detta begrepp införs och att definitioner av överlåtbara värdepapper, fondandelar, penningmarknadsinstrument och vissa derivatinstrument tas in i den svenska lagen.

Det tillståndspliktiga området för värdepappersföretagen i MiFID, investeringstjänsterna, stämmer i sin helhet väl överens med vad som är tillståndpliktig värdepappersrörelse enligt lagen om värdepappersrörelse. På samma sätt förhåller sig MiFID:s sidotjänster till den svenska lagens sidoverksamheter. Var och en av de enskilda verksamheter som beskrivs i den svenska lagen stämmer dock inte helt och hållet överens med närmast motsvarande tjänster som de definieras i MiFID. Utredningen förslår därför att beskrivningen av de tillståndpliktiga tjänsterna justeras i förhållande till nu gällande svenska lagbestämmelser, så att varje tjänst både i sak och terminologiskt stämmer överens med en tjänst enligt MiFID.

I detta kapitel behandlas också de nya investeringstjänsterna investeringsrådgivning och MTF. Tjänsterna är nya investeringstjänster i förhållande till ISD men har i Sverige och andra medlemsstater kunnat bedrivas med stöd av tillstånd till andra investerings- och sidotjänster. Begreppet MTF står för ett multilateralt handelssystem (”Multilateral trading facility”) som drivs av ett värdepappersinstitut eller en börs och som sammanför ett flertal köp- och säljintressen i finansiella instrument från tredje man – inom systemet och i enlighet med icke skönsmässiga regler – men som inte är underkastat en lika ingående reglering som en reglerad marknad.

Begreppet reglerad marknad i sin tur motsvarar närmast börsverksamhet. Begreppet får betydelse både för tillämpningen av MiFID och för tillämpningen av en rad andra direktiv. Det är när ett instrument är upptaget till handel på en reglerad marknad som t.ex. kraven på prospekt enligt prospektdirektivet, utgivarens skyldigheter att lämna information enligt öppenhetsdirektivet och kraven på offentliga erbjudanden enligt direktivet om uppköpserbjudanden blir tillämpliga. Utredningen föreslår i detta kapitel att marknadsplatser som i dag är börser och auktoriserade marknadsplatser enligt lagen definieras som reglerade marknader. Utredningen föreslår också att en åtskillnad görs så att begreppet ”regle-

rad marknad” avser själva marknadsplatsen och att den som driver marknadsplatsen kallas börs. En börs ska med utredningens förslag kunna driva flera reglerade marknader. En börs ska också kunna driva en reglerad marknad på så sätt att själva handelssystemet finns i en annan juridisk person än börsen. Samtliga skyldigheter enligt MiFID åvilar dock den som driver marknaden, dvs. börsen.

I kapitlet behandlas också den för svensk rätt nya klassificeringen av kunder i professionella och icke-professionella kunder samt jämbördiga motparter. Kundskyddsreglerna i MiFID gäller både professionella och icke-professionella kunder. Kraven på värdepappersföretagen är dock högre ställda och mer detaljerade när företaget tillhandahåller tjänster till icke-professionella kunder. Reglerna om informationsutbyte, bästa orderutförande osv. gäller dock inte alls i förhållande till jämbördiga motparter. Utredningen föreslår i denna del att definitioner, motsvarande MiFID:s, av de olika kundkategorierna tas in i lagen.

Slutligen behandlas i samma kapitel vissa undantag från MiFID:s bestämmelser.

Tillstånd för svenska företag (kap. 8)

I detta kapitel konstaterar utredningen att den svenska lagstiftningen i stort sett motsvarar MiFID när det gäller kraven på ledning, ägare och kapital. I dessa delar föreslår utredningen endast några smärre justeringar, t.ex. beträffande kapitalkraven i förhållande till de nya tjänsterna investeringsrådgivning och MTF, att det lägsta antalet styrelseledamöter ska vara tre i stället för fem och att värdepappersinstitut som också är kreditinstitut inte ska omfattas av kravet på att ha ansvarsförsäkring.

Bland MiFID:s bestämmelser om kraven på värdepappersföretagens organisation finns regler om att företagen ska dokumentera tjänster och transaktioner så att den behöriga myndigheten ska kunna kontrollera att företagen fullgjort sina skyldigheter enligt direktivet. I detta avseende finns detaljerade dokumentationskrav i genomförandeåtgärderna endast beträffande vissa tjänster. Samtidigt anges i genomförandedirektivet att den behöriga myndigheten ska upprätta en lista på den dokumentation ett värdepappersföretag ska föra. Utredningen har tolkat detta så att medlemsstaterna nationellt kan precisera dokumentationskraven beträffande de tjänster, t.ex. investeringsrådgivning och portfölj-

förvaltning, där detaljbestämmelser saknas i genomförandeåtgärderna. Utredningen förslår därför att regeringen eller den myndighet regeringen bestämmer får rätt att utfärda föreskrifter avseende kraven på dokumentation.

När det gäller organisationskraven för den som driver en reglerad marknad ställer MiFID bl.a. krav på att denne ska identifiera och hantera intressekonflikter. Intressekonflikter kan uppstå mellan en börs affärsintressen å den ena sidan och börsens övervakande funktioner å den andra sidan. Det har diskuterats om övervakningen borde skötas av någon annan än börsen – t.ex. Finansinspektionen. Enligt MiFID åligger det dock medlemsstaterna att se till att den som driver en reglerad marknad har en effektiv övervakning av såväl handeln i sig som emittenter och deltagare. Den som driver en marknadsplats har också oavsett den offentliga regleringen ett eget intresse av att en effektiv marknadsövervakning. Det är också börsen som rent praktiskt har störst möjlighet att på ett effektivt sätt övervaka handeln på en reglerad marknad som börsen själv kontrollerar och driver. Att lägga det primära ansvaret för marknadsövervakningen på Finansinspektionen skulle således innebära en dubblering och mindre effektiv hantering av denna uppgift. Utredningen föreslår därför att marknadsövervakningen och övervakningen av emittenter och deltagare, i enlighet med MiFID, ska skötas av den som driver en reglerad marknad, dvs. börsen.

För att de intressekonflikter som kan uppstå med en sådan lösning ska kunna hanteras föreslår utredningen att en börs ska inrätta en från affärsverksamheten självständig funktion som ska sköta övervakningen. Denna oberoende funktion ska ha tillräckliga resurser och befogenheter för sina uppgifter. Finansinspektionen tillsyn i detta avseende går således ut på att kontrollera att marknadsövervakningen sköts effektivt och tillräckligt oberoende.

I kapitlet behandlas också den för svensk rätt nya företeelsen anknutna ombud. Ett anknutet ombud kan enligt MiFID på ett värdepappersföretags ansvar utföra vissa utpekade investeringstjänster utan tillstånd. Förutsättningarna för detta är att ombudet endast agerar för ett värdepappersföretag, att företaget ansvarar för ombudets åtgärder och att ombudet registreras i ett offentligt register. Utredningen föreslår att möjligheten att anlita anknutna ombud införs i Sverige och att registrering, liksom för anknutna försäkringsförmedlare, görs hos Bolagsverket.

Gränsöverskridande verksamhet (kap. 9)

MiFID:s regler om det s.k. Europapasset, värdepappersföretagens rätt att med stöd av sitt hemlandstillstånd tillhandahålla tjänster och etablera filialer i andra medlemsstater motsvarar i huvudsak de som finns i ISD. Några ändringar i sak föreslås därför i princip inte.

Någon direkt motsvarighet till Europapasset finns inte för reglerade marknader. I MiFID finns dock några bestämmelser om möjligheten att vidta åtgärder i andra medlemsstater för att underlätta deltagande i handeln därifrån. Utredningen föreslår, i enlighet med MiFID, att svenska börser ska anmäla till Finansinspektionen om de vidtar sådana åtgärder i andra medlemsstater samt att inspektionen ska vidarebefordra informationen till den behöriga myndigheten i den berörda medlemsstaten.

Genomlysning (kap. 10)

MiFID:s bestämmelser om kurs- och avslutsinformation (genomlysning) avser både värdepappersföretagens handel, handeln på en MTF och handeln på en reglerad marknad. Ett av syftena med direktivet i dessa delar är att skapa konkurrensneutralitet. Denna ambition har dock kommit till tydligt uttryck endast beträffande information om handeln avseende aktier upptagna till handel på en reglerad marknad. Tanken är att information om kurser och transaktioner ska offentliggöras oavsett var sådana aktier handlas – på en reglerad marknad, på en MTF eller direkt i ett värdepappersföretags regi, t.ex. mot det egna lagret eller genom sammanförande av två kunders order.

Kraven på information om bud och kurser på en reglerad marknad finns redan i Sverige och den ändring i sak som utredningen föreslår på detta område är att kravet på handelsinformation beträffande andra instrument än aktier utformas mindre detaljerat i lagen jämfört med i dag. Utredningen föreslår också att kraven på information om handeln på en MTF utformas på motsvarande sätt.

För värdepappersföretagens transaktioner utanför en reglerad marknad eller MTF finns inget uttryckligt krav på information om bud – annat än beträffande likvida aktier i vissa fall, se nedan. Däremot ska ett värdepappersföretag offentliggöra limitorder som inte kan utföras omedelbart om inte kunden har instruerat annat. Ett sådant offentliggörande kan ske genom att ordern läggs in i

handelssystemet på en reglerad marknad. Värdepappersföretagen ska också i efterhand offentliggöra information om avslutskurs, volym m.m. beträffande transaktioner i aktier upptagna till handel på en reglerad marknad. Utredningen förslår att nya bestämmelser motsvarande dessa krav tas in i den svenska lagen.

I genomlysningskapitlet behandlas också de omdiskuterade reglerna om värdepappersinstitutens skyldighet att offentliggöra fasta bud – och utföra icke-professionella kunders order mot dessa bud. Dessa regler gäller endast sådana aktier upptagna till handel på en reglerad marknad som anses likvida enligt beräkningsmodellerna i genomförandeförordningen. Kraven på att offentliggöra bud och göra avslut mot buden gäller de värdepappersinstitut som på ett organiserat, frekvent och systematiskt sätt utför kunders order genom att göra avslut mot det egna lagret utanför en reglerad marknad eller MTF, s.k. systematiska internhandlare. Utredningen förslår att dessa regler införs i den svenska lagen.

Transaktionsrapportering (kap. 11)

Redan i ISD fanns ett krav på att värdepappersföretagen skulle rapportera samtliga avslut – oavsett om de gjorts på en reglerad marknad eller utanför – till den behöriga myndigheten. I åtminstone Sverige, Norge och Danmark har den bestämmelsen införlivats genom en rapporteringsskyldighet till den marknadsplats där värdepapperet i fråga är noterat. Eftersom marknadsplatsen normalt står under tillsyn av den behöriga myndigheten har myndigheten i vart fall medelbar tillgång till informationen.

I MiFID finns ett liknande krav på rapportering av transaktioner avseende aktier upptagna till handel på en reglerad marknad till den behöriga myndigheten. I MiFID är kravet dock kombinerat med dels krav på snabbt informationsutbyte mellan de behöriga myndigheterna, dels ett krav på att värdepappersföretagen ska kunna rapportera sina transaktioner på fyra olika sätt: själva, genom en reglerad marknad, genom en tredje part eller genom ett ordermatchnings- eller rapportsystem. Ett nationellt krav på att rapportera till en reglerad marknad skulle således strida mot MiFID. Utredningen föreslår därför att skyldigheten att rapportera transaktioner utformas som i MiFID med fyra möjliga rapporteringsvägar.

MiFID:s regler om transaktionsrapporteringen är minimikrav inom vissa gränser. Medlemsstaterna kan kräva rapportering av transaktioner även beträffande andra instrument än aktier upptagna till handel på en reglerad marknad. Medlemsstaterna kan också kräva att rapporterna ska innehålla mer information, t.ex. om slutkundsidentitet, än den minimiinformation som krävs enligt genomförandeförordningen. Utredningen föreslår i denna del att lagen ställer krav på rapportering motsvarande minimikraven enligt MiFID. Frågan om rapporterna ska innehålla mer information, t.ex. om slutkundsidentitet – något som Finansinspektionen har önskemål om – har varit starkt kontroversiell inom utredningen. En sådan ökad rapportskyldighet har fördelar från övervakningssynpunkt men är synnerligen dyrbar för instituten; den kan beräknas kosta flera hundratals miljoner kr. Det faktaunderlag som för närvarande föreligger är inte tillfyllest för att ställning ska kunna tas i denna fråga. Utredningen föreslår att Finansinspektionen i en dialog med instituten fortsätter utredningen på denna punkt. Regeringen eller den myndighet regeringen bestämmer bör bemyndigas att utfärda föreskrifter dels om rapporteringen ska avse även andra instrument, t.ex. finansiella instrument som är upptagna till handel på en MTF och derivatinstrument för vilket den underliggande tillgången utgörs av ett instrument som är upptagen till handel på en reglerad marknad eller MTF, och dels om vilken ytterligare information om varje transaktion rapporterna ska innehålla. Det förutsätts att Finansinspektionen, innan ett sådant bemyndigande meddelas, presenterar resultatet av den fortsatta utredningen för regeringen.

Skydd för investerare (kap. 12)

MiFID innehåller en rad regler som syftar till att skydda investerarna. I detta kapitel behandlas, förutom den allmänna skyldigheten att iaktta kundernas intressen, bl.a. bestämmelserna om informationsutbyte mellan företag och kunder, krav på lämplighetsbedömningar, hanteringen av intressekonflikter och bestämmelser om hur kunders värdepappersorder ska hanteras för att uppnå bästa möjliga resultat.

Flera av MiFID:s bestämmelser om skydd för investerare, t.ex. reglerna om att iaktta kundernas intresse, skyldigheten att lämna viss information och kraven på bästa orderutförande, liknar i stor

utsträckning de bestämmelser i kommissionslagen som reglerar det obligationsrättsliga förhållandet mellan kommittenten och kommissionären. Utredningen behandlar i detta kapitel hur MiFID:s regler förhåller sig till kommissionslagen med utgångspunkt i de ändringar i lagen som föreslagits av Fondkommissionsutredningen i betänkandet Fondkommission – och en ny kommissionslag (SOU 2005:120). Utredningens bedömning är att några andra ändringar än de som föreslagits av Fondkommissionsutredningen inte behövs med anledning av MiFID.

MiFID:s krav på att iaktta kundernas intressen och lämna information om tjänster, företaget och de risker som är förknippade med vissa tjänster och investeringsalternativ har i och för sig motsvarigheter i den svenska regleringen. Utredningen konstaterar dock att regleringen i MiFID är mer detaljerad än dagens svenska regler. Detta gäller även andra kundskyddsregler och utredningen föreslår därför att dagens ”sundhetsparagraf” i 1 kap. 7 § lagen om värdepappersrörelse ersätts med ett ”sundhetskapitel” utformat i enlighet med MiFID:s regler både i sak och terminologiskt. Kapitlet inleds med en allmän bestämmelse om att värdepappersinstituten ska iaktta sina kunders intressen och därefter följer bestämmelser om vilken information instituten ska lämna och inhämta, rapporteringen till kunder om utförda tjänster osv. Bestämmelserna i lagen föreslås gälla oavsett om kunden ifråga är professionell eller inte. Mer detaljerade krav ska följa av de föreskrifter som anknyter till de olika bestämmelserna i lagen. Dessa detaljföreskrifter – som ska utformas i enlighet med genomförandedirektivet – ställer i sin tur högre och mer detaljerade krav på företaget om kunden är icke-professionell än om kunden är professionell.

Bland kundskyddsreglerna finns krav på att värdepappersinstituten ska bedöma om en viss tjänst eller ett visst instrument är lämpligt eller inte för en kund. Vad som åligger ett värdepappersinstitut beror på vilken investeringstjänst företaget utför.

Om det är fråga om investeringsrådgivning eller portföljförvaltning ska institutet sålunda inhämta uppgifter om kundens ekonomiska situation, erfarenhet och kunskap osv. och utifrån denna information föreslå tjänster och instrument som är lämpliga för kunden. Om institutet utför andra tjänster, t.ex. utför order, är kravet på lämplighetsbedömningen mindre långtgående. Institutet ska då bedöma om tjänsten eller instrumentet passar kunden i för-

hållande till kundens kunskaper och erfarenheter. Om tjänsten eller instrumentet inte passar ska företaget avråda kunden.

Båda typerna av bedömningar ligger nära vad som krävs enligt rådgivningslagen. Den lagen är dock begränsad till konsumenter och i lagen och de föreskrifter som utfärdats med stöd av lagen ställs vissa krav som avviker från MiFID och genomförandeåtgärderna. Utredningen föreslår därför att rådgivningslagens näringsrättsliga bestämmelser (4 och 5 §§ i rådgivningslagen) inte ska gälla värdepappersinstitut. Dessa bestämmelser föreslås ersatta av bestämmelser i lagen om värdepappersmarknaden. Detta får också till följd att dagens föreskrifter på området, för värdepappersinstitutens del, måste ersättas med föreskrifter, som är förenliga med genomförandeåtgärderna och utfärdas med stöd av lagen om värdepappersmarknaden.

När det gäller de lämplighetsbedömningar som ska göras vid andra tjänster än investeringsrådgivning och portföljförvaltning finns ett undantag från denna skyldighet om tjänsten enbart består av ren orderexekvering på kundens initiativ och företaget gör klart för kunden att någon bedömning inte kommer att göras av om tjänsten/instrumentet passar kunden. En ytterligare förutsättning är att ordern avser icke komplicerade instrument, t.ex. aktier upptagna till handel på en reglerad marknad. Utredningen föreslår att en undantagsregel för ren orderexekvering införs i den svenska lagen.

Utredningen föreslår vidare att kraven i MiFID på skriftlig dokumentation om vad kunden och värdepappersinstitutet kommit överens om när det gäller parternas rättigheter och skyldigheter utformas som i MiFID. Beträffande rapporteringen till kunder förslår utredningen att dagens krav på avräkningsnotor och depåsammanställningar ersätts med ett allmänt formulerat krav på rapportering. Detaljreglerna om vilken rapportering som ska ske och innehållet ska med utredningens förslag följa av tillämpningsföreskrifter, utformade i enlighet med genomförandedirektivet.

Ytterligare en aspekt på kundskyddet är hanteringen av intressekonflikter. Intressekonflikter kan t.ex. finnas mellan olika kundgrupper. Kunder på institutets corporate finance-avdelning kan t.ex. ha ett intresse av institutets mäklare och rådgivare råder sina kunder acceptera erbjudanden eller teckna sig i nyemissioner som handläggs av coporate finance-avdelningen oavsett om detta är till kundernas fördel eller inte. Även mellan institutet självt och kunder kan det finnas intressekonflikter. När värdepappersinstitu-

tet gör affärer för egen räkning är institutet intresserat av att köpa billigt och sälja dyrt - med kunderna har knappast har något intresse av att sälja billigt och köpa dyrt mot institutets eget lager. Utredningen föreslår i denna del att värdepappersinstituten, i enlighet med MiFID, ska identifiera och hantera intressekonflikter så att kundernas intressen inte påverkas negativt. Lagens allmänt hållna bestämmelser om detta bör kompletteras med tillämpningsföreskrifter som liksom genomförandedirektivet anger minimikraven för att hålla olika verksamheter åtskilda från varandra.

Institutens analysverksamhet är ett av de områden där problemet med intressekonflikter blir tydligt. Läsarna av analyser och investeringsrekommendationer bör kunna utgå från att analytikern utgått från investerarens perspektiv och inte utformat analysen vare sig utifrån institutets egna intressen och eventuella innehav i de företag som analyseras eller utifrån andra kunders intressen, t.ex. kunder i corporate finance-verksamheten. Beträffande analysverksamheten finns särskilda regler i genomförandedirektivet, baserade på bl.a. principer som antagits av International Organization of Securities Commissions (IOSCO). Utredningen kommer här fram till att de föreslagna allmänt hållna reglerna i lagen kombinerat med föreskrifter utformade som analytikerreglerna i genomförandedirektivet är tillräckliga för att hantera denna intressekonflikt. Med tanke på genomförandedirektivets förbud mot ”goldplating” skulle det inte heller vara förenligt med MiFID att införa nationella avvikande regler på detta område.

I skyldigheten att iaktta kundernas intresse ligger en skyldighet att utföra kundernas order så att bästa möjliga resultat uppnås. I MiFID finns uttryckliga regler om bästa orderutförande och hantering av kundorder i övrigt. Reglerna innebär i korthet att kunders order ska utföras i den ordning de mottagits av institutet och på ett sätt så att bästa möjliga resultat, främst vad gäller priset, uppnås. För att åstadkomma bästa möjliga resultat ska instituten bedöma hur och på vilken marknadsplats ordern ska utföras. Ska affären avslutas utanför en marknadsplats mot det egna lagret eller mot en annan kunds order eller ska orden utföras på en reglerad marknad eller MTF och i så fall vilken? Instituten ska i en policy för bästa möjliga orderutförande ange hur dessa bedömningar och val görs och kunderna ska godkänna policyn.

Utredningen föreslår att regler motsvarande reglerna i MiFID tas in i den svenska lagen.

Marknadsplatser (kap. 13)

I MiFID regleras två typer av marknadsplatser, reglerad marknad och MTF. I kapitel 13 behandlar utredningen bl.a. reglerna om förhållandet mellan marknadsplatsen och dem som deltar i handeln och om marknadsplatsens förhållande till de instrument som handlas och emittenterna av sådana instrument.

Utredningen konstaterar att dagens regler om börsmedlemskap i stort sett motsvarar MIFID:s regler om deltagande i handeln på en reglerad marknad och endast några smärre tillägg och förtydliganden föreslås. Utredningen föreslår dock att den numera missvisande termen medlemmar på en börs byts ut mot deltagare. För deltagande i handeln på en MTF förslår utredningen att liknande regler införs. På en MTF ska det dock vara möjligt för fysiska personer att delta direkt i handeln, liksom i dag är fallet för deltagande i handeln på en auktoriserad marknadsplats.

MiFID:s regler för upptagande av finansiella instrument till handel på en reglerad marknad motsvaras i svensk rätt av inregistrering vid en börs och notering vid en börs eller auktoriserad marknadsplats. Utredningen föreslår i denna del att notering ersätts med MiFID:s begrepp upptagande till handel. Minimikraven som en börs måste ställa upp för att instrument ska få tas upp till handel på en reglerad marknad följer sedan av reglerna i genomförandeförordningen. Utredningen överväger i detta kapitel också om begreppet inregistrering ska behållas. Reglerna om inregistrering har införts för att införliva det kodifierade listningsdirektivets krav och utredningen föreslår att dessa regler behålls. Med den av utredningen föreslagna ordningen ska dock samtliga instrument som handlas på en reglerad marknad vara upptagna till handel. Några av dessa instrument kan också vara inregistrerade. Det senare förutsätter dock att börsen i fråga valt att ha en möjlighet till inregistrering.

Utredningen förslår också att finansiella instrument ska kunna tas upp till handel på en reglerad marknad utan att utgivaren ansökt eller samtyckt till detta. När det rör sig om överlåtbara värdepapper är en förutsättning för detta att värdepapperet redan är upptaget till handel på en annan reglerad marknad inom EES. Utgivaren vars värdepapper tagits upp till handel utan ansökan eller samtycke ska inte heller omfattas av de krav som gäller informationsgivning osv. som gäller den som ansökt om upptagande.

En MTF kan, förutom att vara en alternativ handelsplats för instrument som är upptagna till handel på en reglerad marknad, också fungera som ett alternativ för mindre företag som inte kan uppfylla alla de krav som ställs på företag vars värdepapper är upptagna till handel på en reglerad marknad. Utredningen föreslår därför att endast ett allmänt hållet lämplighetskrav ställs upp för upptagande till handel på en MTF.

I kapitlet behandlas också principerna om fritt tillträde och neutralitet för deltagare och emittenter vid en reglerad marknad. Utredningen föreslår här att dessa principer, liksom tidigare, ska gälla fullt ut för deltagare i handeln och emittenter av inregistrerade värdepapper. Principen om fritt tillträde förslås dock inte gälla i förhållande till den som ansöker om upptagande till handel. När ett värdepapper väl är upptaget till handel ska dock utgivaren behandlas som alla andra utgivare – dvs. principen om neutralitet ska tillämpas.

Slutligen behandlas i detta kapitel reglerna om marknadsövervakning och handelsstopp. När det gäller marknadsövervakningen föreslår utredningen att denna ska skötas av börsen inom ramen för den oberoende funktion som beskrivs i avsnitt 8.3.2. Beträffande handelsstopp föreslår utredningen att dagens bestämmelser ändras så att det i enlighet med MiFID blir tydligt att det är Finansinspektionens beslut om handelsstopp av ett instrument på en marknadsplats som ska leda till handelsstopp även på andra marknadsplatser.

Tillsyn och sanktioner (kap. 14)

Genom införlivandet av marknadsmissbruksdirektivet, prospektdirektivet och öppenhetsdirektivet har Finansinspektionens kontrollmöjligheter och sanktioner utvidgats på flera områden. Listan på kontrollmöjligheter och sanktioner i MiFID är ungefär densamma som i nämnda direktiv. Utredningen konstaterar att Finansinspektionen redan har flertalet av de kontrollmöjligheter en behörig myndighet ska ha enligt MiFID. För att hålla samman de regler som införlivar MiFID föreslår dock utredningen att bestämmelserna om inspektionens tillsynsbefogenheter beträffande värdepappersinstitut och reglerade marknader samlas i lagen om värdepappersmarknaden.

Rätten att företa platsundersökningar har i tidigare lagstiftningsärenden ansetts följa av de tillståndspliktiga företagens skyldighet att lämna de upplysningar inspektionen behöver. En uttrycklig lagregel avseende platsundersökningar har dock i samband med genomförandet av prospektdirektivet införts beträffande börser och auktoriserade marknadsplatser. Utredningen föreslår därför att regeln om platsundersökningar i lagen om värdepappersmarknaden också ska gälla värdepappersinstitut.

I MiFID anges att den behöriga myndigheten åtminstone ska ha rätt att tillfälligt återkalla ett tillstånd. Utredningen konstaterar i denna del att direktivet i och för sig kan tolkas så att rätten att definitivt återkalla tillståndet uppfyller direktivets krav på att åtminstone kunna återkalla tillståndet. Utredningen anser dock att ett tillfälligt återkallande av tillståndet kan vara en lämplig sanktionsmöjlighet, t.ex. i de fall då ett värdepappersinstitut missköter en av de verksamheter institutet har tillstånd till så allvarligt att det i och för sig är motiverat men en återkallelse men att det samtidigt går att konstatera att bristerna kommer att åtgärdas. Utredningen föreslår därför att Finansinspektionen ges rätta att tillfälligt återkalla tillstånd för värdepappersinstitut och börser.

I kapitlet behandlas också de nya sanktionsmöjligheterna, t.ex. straffavgifter, som i Sverige har införts på bankområdet. För att samordna reglerna på värdepappersområdet med reglerna i lagen om bank- och finansieringsrörelse och åstadkomma konkurrensneutralitet förslår utredningen att samma sanktionssystem som för banker, inklusive straffavgifter och förseningsavgifter, införs i lagen om värdepappersmarknaden.

Samarbete mellan behöriga myndigheter (kap. 15)

MiFID:s regler om gränsöverskridande verksamhet och filialetableringar bygger som nämnts på principen att ett tillstånd i ett land inom EES ska vara tillräckligt för att ett företag ska kunna driva sin verksamhet även i andra länder inom EES, det s.k. Europapasset. Företaget står enligt huvudregeln under tillsyn av den behöriga myndigheten i det land där företaget fått tillstånd. Detta gäller också om ett företag bedriver gränsöverskridande verksamhet. För filialer har dock värdmedlemsstaten ansvaret för övervakningen av filialens verksamhet i vissa avseenden – t.ex. beträffande de reglerna om skydd för investerare. För att Europapasset och den beskrivna

delade tillsynen ska fungera krävs ett samarbete mellan de behöriga myndigheterna och att myndigheterna utbyter information. I MIFID finns en rad regler om hur samarbetet och informationsutbytet ska gå till. Utredningen föreslår att dessa delar av direktivet införlivas genom en allmänt hållen bestämmelse om att Finansinspektionen ska samarbeta och utbyta information med andra behöriga myndigheter inom EES i den utsträckning som följer av MiFID.

Utredningen föreslår också att bestämmelserna om Finansinspektionens tillsynsbefogenheter utformas så att inspektionen direkt kan ingripa mot filialer genom rättelseföreläggande när det gäller efterlevnaden av kundskyddsreglerna, transaktionsrapporteringen och de genomlysningsregler som gäller värdepappersinstitut. Finansinspektionen ska i sådana fall underrätta den behöriga myndigheten i företagets hemmedlemsstat om företaget inte följer föreläggandet.

När det gäller gränsöverskridande verksamhet och de delar av filialverksamheten som inspektionen inte har tillsynsansvaret för förslår utredningen att inspektionen ska underrätta den behöriga myndigheten i företagets hemland om verksamheten strider mot de regler som antagits med stöd av MiFID. Om företaget trots detta fortsätter handla på ett sätt som tydligt skadar investerarnas intressen eller leder till att marknaderna inte fungerar korrekt får inspektionen förbjuda företaget att genomföra transaktioner i Sverige. Motsvarande förfarande ska också, enligt utredningens förslag, tillämpas på reglerade marknader och MTF:er utanför Sverige om svenska företag deltar i handeln.

Konsekvenser (kap. 17)

Införlivandet av MiFID i svensk rätt kommer att innebära en rad förändringar i det befintliga regelverket. Även om det i flertalet fall inte är fråga om några genomgripande förändringar innebär det stora antalet ändringar ökade kostnader för Finansinspektionen, värdepappersinstituten och börserna. Några av de föreslagna förändringarna – t.ex. kravet på transaktionsrapportering – är dock mer genomgripande och i avsnittet görs en uppskattning av de kostnader dessa krav kan komma att medföra. Kostnaderna kan dock ännu inte bedömas med någon närmare precision, bl.a. eftersom de är beroende av vilka föreskrifter Finansinspektionen kom-

mer att meddela. Utredningen konstaterar också att de nya kraven på genomlysning och de ökade möjligheterna till konkurrens mellan olika marknadsplatser å den ena sidan innebär en risk för fragmentisering av handeln men å den andra sidan kan ha positiva effekter på lite längre sikt.

Summary

In April 2004, the European Parliament and the Council adopted a Directive on markets in financial instruments (MiFID). MiFID replaces the Investment Services Directive (ISD) from 1993. The Member States are required by MiFID to incorporate common rules regarding investment firms and regulated markets – i.e. the operation that is conducted in Sweden by stock exchanges and authorised market places. MiFID, which is an extraordinarily extensive and complicated directive, has been prepared within the framework of the ‘Lamfalussy Process’ (see further details of what this entails in Chapter 6). As a step in this process, the Commission will adopt two legal instruments with supplementary provisions: a directive and a regulation. At the time this report is submitted, these two legal instruments are still only drafts. The Implementing Directive will be incorporated into Swedish law while the Implementing Regulation applies directly.

The main task of the Committee has been to analyse what changes need to be made to the current Swedish rules in order to implement MiFID. Furthermore, the mandate has also included, among other things, a review of Finansinspektionen’s (the Swedish Financial Supervisory Authority – FI) sanction powers, the responsibility that Finansinspektionen should have for the determination of the listing requirements on regulated markets and the handling of conflicts of interest within investment firms and stock exchanges.

Following an introduction, where the preconditions for the work of the Committee and the conduct of the work are described (Chapter 1), the Committee briefly describes the applicable conditions in the securities market area (Chapter 2), following which a brief presentation is provided of MiFID (Chapter 3). Following this there is a chapter on financial trade in Sweden (Chapter 4) and one regarding the fundamental bases for financial control (Chapter 5).

The sections of the report dealing with proposals comprise Chapters 6 to 18. The Committee describes below the most important proposals contained in the various chapters of the report.

Certain principles for new regulation (Chapter 6)

In this chapter, the Committee considers various issues of principle. The Committee concludes that MiFID in many respects entails a ‘full harmonisation’ – i.e. the Member States may neither introduce more stringent nor less extensive rules than those prescribed by the Directive and the implementing measures. This applies to the areas that are covered by the Implementing Regulation but also, according to the main rule, the areas that are covered by the Implementing Directive. The Implementing Directive contains an express prohibition of national rules that impose further provisions beyond the common system of rules (referred to as goldplating). According to Article 4 of the Implementing Directive, the Member States may not introduce any such rules, except in certain exceptional cases.

The Committee proposes in this chapter that MiFID is implemented by a new act replacing both the Securities Business Act and the Securities Exchange and Clearing Operations Act. The Committee also proposes that the Implementing Directive should largely be incorporated through regulations. It is also proposed that those parts of the Implementing Regulation where the Member States have been granted powers to introduce supplementary rules be implemented through regulations. The terminology in the new act should follow the terminology contained in MiFID in order to facilitate the application of the Implementing Regulation and the wording of the regulations incorporating the Implementing Directive. Terminological uniformity will also facilitate the ambition of achieving similar regulation within the EEA.

In this chapter, it is also proposed that Finansinspektionen should be a competent authority according to Article 48.1 of MiFID, i.e. the authority that is responsible for enforcement of the provisions adopted pursuant to the Directive.

Scope (Chapter 7)

MiFID contains a number of new definitions and terms. Examples of this are ‘financial instruments’, ‘investment services’, ‘ancillary services’ and ‘regulated markets’. The scope of the Directive is determined by the definitions of what are deemed to be financial instruments, what investment services are subject to a licence obligation and what constitutes a regulated market. The Committee proposes in these respects that the Swedish definitions are adapted both substantively and as regards terminology to the definitions contained in MiFID.

As regards the term ‘financial instruments’, the proposal of the Committee means that a new definition of this term will be introduced and that definitions of ‘transferable securities’, ‘fund units’, ‘money-market instruments’ and certain ‘derivative instruments’ will be included in the Swedish Act.

The area subject to a licence obligation for the investment firms contained in MiFID – the investment services – closely corresponds with what constitutes a securities undertaking subject to a licence obligation according to the Securities Business Act. Similarly, the ancillary services referred to in MiFID correspond to the ancillary operations referred to in the Swedish Act. However, none of the individual operations described in the Swedish Act correspond completely with the closest corresponding services as defined by MiFID. The Committee therefore proposes that the description of the services subject to a licence obligation is adjusted in relation to the current Swedish statutory provisions, so that each service corresponds both substantively and terminologically to a service according to MiFID.

This chapter also deals with the new investment services investment advice and MTF. These services are new investment services in relation to ISD but have been possible to be conducted in Sweden and other Member States pursuant to a licence for other investment and ancillary services. The term MTF means a ‘Multilateral Trading Facility’ that is conducted by a investment firm or a stock exchange and combines several buy and sell interests in financial instruments from a third party – within the system and in accordance with non-arbitrary rules – but which is not subject to regulation as extensive as that in a regulated market.

The term regulated market in its turn corresponds most closely to a stock exchange operation. The term is of importance both for

the application of MiFID and for the application of a number of other Directives. It is when an instrument is admitted to trading on a regulated market that, for example, the requirements for a prospectus according to the Prospectus Directive, the issuer’s obligations to provide information according to the Transparency Directive and the requirements for public offers according to the Take-over Directive become applicable. The Committee proposes in this chapter that market places that are currently stock exchanges and authorised market places according to the Act are defined as regulated markets. The Committee also proposes that a distinction is made so that the term ‘regulated market’ refers to the actual market place and the party who operates the market place is called a stock exchange. According to the Committee’s proposal, it should be possible for a stock exchange to operate several regulated markets. It should also be possible for a stock exchange to operate a regulated market in such a way that the trading system itself is within a legal person other than the stock exchange. However, all obligations according to MiFID are imposed on the party operating the market, i.e. the stock exchange.

This chapter also deals with the classification of clients as professional and retail clients and other equal counterparties, which is new to Swedish law. The client protection rules contained in MiFID apply to both professional and retail clients. However, when the firm provides services to retail clients, the demands imposed on the investment firms are greater and more detailed. However, the rules on exchange of information, best execution, etc. do not apply at all in relation to equal counterparties. The Committee proposes in this situation that definitions, corresponding to the MiFID definitions of the various client categories, be included in the Act.

Finally, certain exemptions from the provisions of MiFID are dealt with in the same chapter.

Licences for Swedish undertakings (Chapter 8)

In this chapter, the Committee concludes that Swedish legislation broadly corresponds to MiFID as regards requirements for management, ownership and capital. In these parts, the Committee only proposes a few minor adjustments, for example regarding capital requirements in relation to the new services investment

advice and MTF, that the minimum number of members of the board should be three instead of five and that investment firms that are also credit institutes should not be subject to the mandatory liability insurance requirements.

Among MiFID’s provisions on the requirements regarding the organisation of investment firms, there are rules that the firms should document services and transactions so that the competent authority will be able to verify that the firms have fulfilled their obligations under the Directive. In this respect, detailed documentation requirements are contained in the implementing measures only as regards certain services. At the same, it is stated in the Implementing Directive that the competent authority should prepare a list of the documentation to be kept by an investment firm. The Committee has interpreted this to mean that the Member States can specify the documentation requirements nationally regarding the services, for example investment advice and portfolio management, where the implementing measures do not contain detailed provisions. The Committee therefore proposes that the Government, or the authority appointed by the Government, is authorised to issue regulations regarding documentation requirements.

As regards the organisation requirements for a party operating a regulated market, MiFID, among other things, imposes the requirement that such a party must identify and deal with conflicts of interest. Conflicts of interest can arise between the commercial interests of the stock exchange on the one hand and the supervisory function of the stock exchange on the other. There have been discussions about whether supervision should be attended to by someone other than the stock exchange – e.g. Finansinspektionen. However, according to MiFID, it is an obligation of the Member States to ensure that a party operating a regulated market has efficient supervision of both the trade as such and issuers and participants. Anyone operating a market place also has a personal interest in ensuring efficient market supervision, regardless of the public regulation. In purely practical terms, it is also the stock exchange that has the greatest opportunity to supervise, in an efficient manner, trade on a regulated market that the stock exchange itself controls and operates. To impose the primary responsibility for market supervision on Finansinspektionen would consequently entail a duplication and comprise a less efficient means of dealing with this task. The Committee therefore proposes

that market supervision and supervision of issuers and participants, in accordance with MiFID, should be attended to by the party operating a regulated market, i.e. the stock exchange.

In order to ensure that conflicts of interest that may arise with such a solution can be dealt with, the Committee proposes that a stock exchange should establish a function that is independent from the business operation to deal with supervision. This independent function should have sufficient resources and powers for the task in hand. Supervision by Finansinspektionen in this respect is thus oriented towards verifying that the market supervision is attended to efficiently and sufficiently independently.

This chapter also deals with the ‘tied agent’ phenomenon, which is new to Swedish law. According to MiFID, a tied agent can perform certain identified investment services at the risk of an investment firm without a licence. The preconditions for this are that the agent only acts for one investment firm, that the firm is responsible for the agent’s actions and that the agent is registered in a public register. The Committee proposes introducing the possibility of engaging tied agents in Sweden and that registration is effected at the Swedish Companies Registration Office, as it is for affiliated insurance arrangers.

Cross-border operations (Chapter 9)

MiFID’s rules on the ‘European Passport’, the investment firms’ right to, with reference to a permit in its home country, provide services and establish branches in other Member States, basically correspond with those contained in ISD. Consequently, in principle no material amendments are proposed.

Regulated markets do not have a direct equivalent to the European Passport. However, MiFID contains some provisions on the possibility of implementing measures in other Member States in order to facilitate participation in trade from there. In accordance with MiFID, the Committee proposes that Swedish stock exchanges should report to Finansinspektionen if they implement such measures in other Member States and that the agency should forward this information to the competent authority in the Member State involved.

Transparency (Chapter 10)

MiFID’s provisions on prices and post-trade information (transparency) relate to trade through an investment firm, trade on an MTF as well as trade on a regulated market. One aim of the Directive in this respect is to create competitive neutrality. However, this ambition has only been clearly expressed as regards information about trade relating to shares admitted to trading on a regulated market. It is intended that information regarding prices and transactions should be publicised regardless of where such shares are traded – on a regulated market, on an MTF or directly under the auspices of an investment firm, for example against its own stock or through a combination of two clients’ orders.

The requirements for information regarding quotes and prices on a regulated market already exist in Sweden and the material amendment proposed by the Committee in this area is that the requirement for trading information regarding instruments other than shares is formulated in less detail in the Act compared with that today. The Committee also proposes that the requirements for information on trade on an MTF are formulated in a corresponding way.

There is no express requirement for information about quotes for the investment firm’s transactions outside a regulated market or an MTF – except in certain cases as regards their liquid shares, see below. However, an investment firm shall publicise limit orders that cannot be effected immediately unless the client has otherwise instructed. Such publication can be effected by the order being entered into the trading system on a regulated market. The investment firms must also publicise information retroactively about closing prices, volumes, etc. as regards transactions with shares admitted to trading on a regulated market. The Committee proposes that new provisions corresponding to these requirements are included in the Swedish Act.

The chapter on transparency also deals with the debated rules on the obligation of the investment firms to publicise firm quotes – and effect retail clients’ orders in relation to these quotes. These only apply to shares included for trade on a regulated market that are deemed to be liquid according to the computation models contained in the Implementing Regulation. The requirement to publicise quotes and complete transactions against the quotes applies to those investment firms that effect clients’ orders on an organised,

frequent and systematic basis through making completing transactions against their own stock outside a regulated market or MTF, ‘systematic internalisers’. The Committee proposes that these rules are introduced into the Swedish Act.

Reporting transactions (Chapter 11)

The ISD already contains a requirement for investment firms to report all completed transactions to the competent authority – regardless of whether they have been effected on a regulated market or outside. This provision has, at least in Sweden, Norway and Denmark, been incorporated by a reporting obligation to the market place where the security in question is listed. As the market place is normally subject to the supervision of the competent authority, this authority has in any event indirect access to the information.

MiFID contains a similar requirement for reporting transactions regarding shares that have been accepted for trade on a regulated market to the competent authority. However, the requirement in MiFID is combined first with a requirement for the rapid exchange of information between the competent authorities, and second with a requirement that the investment firms should be able to report their transactions in four different ways: themselves; through a regulated market; through a third party; or through an order matching or reporting system. A national requirement to report to a regulated market would consequently violate MiFID. The Committee therefore proposes that the obligation to report transactions is formulated with four possible reporting routes, as in MiFID.

MiFID’s rules on transaction reporting are minimum requirements within certain limits. The Member States can also require the reporting of transactions regarding instruments other than shares admitted to trading on a regulated market. The Member States can also require that the reports should contain more information, for example about the end-user identity, than the minimum information that is required according to the Implementing Regulation. In this respect, the Committee proposes that the Act imposes requirements on reporting corresponding to the minimum requirements under MiFID. The question of whether the reports should contain more information, for example the identity of the

end-user – something which Finansinspektionen would like – has been extremely controversial within the Committee. Such an increased reporting obligation has advantages from the monitoring perspective but is exceptionally expensive for the firms; it may be estimated to cost several hundred million kronor. The factual base currently available is not sufficient to be able to make a decision on this matter. The Committee proposes that Finansinspektionen, in dialogue with the firms, continues the work of the Committee requiring this item. The Government, or the authority appointed by the Government, should be empowered to issue regulations, first concerning whether the reporting should also cover other instruments, for example financial instruments that are admitted to trading on an MTF and derivative instruments for which the underlying asset constitutes an instrument that is admitted to trading on a regulated market or MTF, and second regarding what further information the reports should contain about each transaction. It is expected that, before such authorisation is granted, Finansinspektionen will present the result of its future investigations to the Government.

Protection for investors (Chapter 12)

MiFID contains a number of rules aimed at protecting investors. Besides the general obligation to protect the clients’ interests, this chapter deals with the provisions on the exchange of information between the undertaking and clients, the requirements for assessments of suitability, handling conflicts of interest and provisions on how clients’ securities orders should be managed to achieve the best possible result.

Several of the provisions of MiFID on the protection of investors, for example the rules on observing the clients’ interests, the obligation to provide certain information, and the requirements on best execution, resemble to a large extent the provisions contained in the Act on Factors and Commercial Agents, which governs the private law relationship between the client and the agent. In this chapter, the Committee deals with the relationship of MiFID’s rules with the Act on Factors and Commercial Agents on the basis of the amendments to the Act proposed in the Committee presented by the Commission on Financial Instruments Committee in the report ‘Commission on Financial Instruments –

and a new Commission Act’ (Fondkommission – och en ny kommissionslag – SOU 2005:120). The Committee has concluded that no further amendments are required as a result of MiFID other than those proposed in the report submitted by the Committee.

MiFID’s requirements to observe clients’ interests and provide information about services, the undertaking and the risks associated with certain services and investment alternatives have corresponding rules as such according to the Swedish system. However, the Committee concludes that the rules under MiFID are more detailed than the current Swedish rules. This also applies to client protection rules, and the Committee therefore proposes that the current ‘proper conduct of business section’ contained in Chapter 1, Section 7 of the Securities Business Act is replaced by a ‘proper conduct of business chapter’ formulated in accordance with MiFID’s rules, both materially and terminologically. The chapter opens with a general provision about the investment firms having to observe their clients’ interests and thereafter comply with the provisions about what information the firm should provide and gather, reporting to clients about the services performed, etc. It is proposed that the provisions of the Act apply regardless of whether or not the client is a professional. More detailed requirements will ensue from the regulations associated with the various provisions contained within the Act. These detailed regulations – which will be worded in accordance with the Implementing Directive – impose in their turn greater and more detailed requirements on the undertaking if the client is retail than if the client is professional.

The client protection rules contain a requirement that the investment firms should assess whether or not a certain service or a particular instrument is appropriate for a client. The obligation of a investment firm depends upon which investment service the undertaking performs.

If investment advice or portfolio management is involved, the firm should consequently obtain details of the client’s financial situation, experience and knowledge, etc., and on the basis of this information propose services and instruments that are appropriate to the client. If the firm performs other services, for example effects orders, the requirement on the assessment of suitability is less extensive. The firm should then assess whether the service or instrument is suitable for the client in relation to the client’s

knowledge and experience. If the service or instrument is not suitable, the undertaking should advise the client not to proceed.

Both kinds of assessments closely resemble those required according to the Financial Advisory Services Act. However, this Act is restricted to consumers and certain measures are imposed that differ from MiFID and the implementing measures contained in the Act and the regulations issued under the Act. The Committee therefore proposes that the commercial law provisions of the Financial Advisory Services Act (Sections 4 and 5 of the Financial Advisory Services Act) should not apply to investment firms. It is proposed that these provisions replace the provisions contained in the Securities Market Act. This also has the consequence that the current regulations in the area as regards the investment firms must be replaced by regulations that are compatible with the implementing measures and be issued under the Securities Market Act.

As regards the assessment of suitability that must be conducted in connection with services other than investment advice and portfolio management, there are exemptions from this obligation if the service only comprises the pure execution of orders on the client’s initiative and the undertaking makes it clear to the client that no assessment will be made of whether the service/instrument is suitable for the client. A further precondition is that the order relates to uncomplicated instruments, for example shares admitted to trading on a regulated market. The Committee proposes that a rule is introduced into the Swedish Act providing for an exemption for pure order execution.

Furthermore, the Committee proposes that the requirements contained in MiFID on written documentation about what the client and the investment firm have agreed as regards the parties’ rights and obligations should be formulated as in MiFID. As regards reporting to clients, the Committee proposes that the current requirements on contract notes and depository statements be replaced by a generally formulated requirement for reporting. The detailed rules about what reporting can be made and the content should, according to the Committee’s proposal, comply with implementing provisions, formulated in accordance with the Implementing Directive.

A further aspect of client protection is the handling of conflicts of interest. Conflicts of interest can, for instance, prevail between various client groups. Clients of the firm’s corporate finance department can, for example, have an interest in the firm’s brokers

and advisors advising their clients to accept offers or to subscribe for new issues that are being dealt with by the corporate finance department, regardless of whether this is to the advantage of the clients. There can also be conflicts of interest between the firm itself and the client. When the investment firm makes deals on its own behalf, the firm is interested in purchasing at a low price and selling at a higher price – but the clients will hardly be interested in selling cheaply and buying at a high price in relation to the firm’s own stock. In this respect, in accordance with MiFID, the Committee proposes that the investment firms should identify and deal with conflicts of interest so that the clients’ interests are not negatively affected. The generally framed provisions of the Act regarding this should be supplemented with implementing provisions that, like the Implementing Directive, stipulate minimum requirements for keeping the various operations separate from each other.

The firm’ analysis operations are one of the areas where the problem of conflicts of interest becomes clear. The readers of analyses and investment recommendations should be entitled to assume that the analyst has proceeded from the perspective of the investors and not formulated the analysis either on the basis of the firm’s own interests and possible holding in the analysed undertakings or on the basis of other clients’ interests, for example clients of the corporate finance operation. As regards analysis operations, there are special rules contained in the Implementing Directive, based, among other things, on principles that were adopted by the International Organization of Securities Commissions (IOSCO). The Committee concluded here that the proposed generally-framed rules contained in the Act combined with the regulations formulated as analysts’ rules in the Implementing Directive are sufficient to deal with this conflict of interest. Nor would it be compatible with MiFID to introduce nationally deviating rules within this area taking into consideration the prohibition contained in the Implementing Directive on ‘goldplating’.

One component of the obligation to observe the clients’ interests is an obligation to execute the clients’ orders so that the best possible result is achieved. MiFID contains explicit rules on best execution and the handling of client orders generally. These rules basically mean that the clients’ orders should be executed in the order in which they have been received by the firm and in such a way that the best possible result, primarily regarding the price, is achieved. In order to achieve the best possible result, the firms

should assess how and on which market place the order should be executed. Should the deal be concluded outside a market place against its own stock or against another client’s order or should the order be executed on a regulated market or MTF, and in that case which? The firm should stipulate how these assessments and choices are made in a policy for best policy order execution and the clients should accept this policy.

The Committee proposes that rules corresponding to the rules contained in MiFID should be included in the Swedish Act.

Market places (Chapter 13)

MiFID regulates two kinds of market places: regulated markets and MTFs. In Chapter 13, the Committee deals, among other things, with rules concerning the relationship between the market place and those who participate in trade and concerning the market place’s relationship to the instruments that are traded and the issuers of such instruments.

The Committee concludes that the current rules on stock exchange membership correspond to a large extent with MiFID’s rules on participation in trade on a regulated market and only some minor supplements and clarifications are proposed. However, the Committee proposes that the current misleading term member of a stock exchange is replaced by the word participant. For participation in trade on an MTF, the Committee proposes that similar rules are introduced. However, on an MTF it should be possible for natural persons to participate directly in the trade, as is the case today for participation in trading on an authorised market place.

MiFID’s rules for admitting financial instruments to trading on a regulated market have corresponding rules in Swedish law regarding registration on a stock exchange and listing on an exchange or authorised market place. The Committee proposes in this respect that the listing is replaced with MiFID’s term ‘admitted to trading’. The minimum requirements that a stock exchange must impose for an instrument to be admitted to trading on a regulated market then follow the rules contained in the Implementing Regulation. The Committee also deliberates in this chapter whether the term ‘registration’ should be retained. The rules on ‘registration’ have been introduced to incorporate the codified Listing Directive requirements and the Committee proposes that

these rules are retained. However, with the system proposed by the Committee, all instruments that are traded on a regulated marketplace should be admitted to trading. Some of these instruments may also be registered. However, for the latter it is a precondition that the stock exchange in question has chosen to have a possibility of registration.

The Committee also proposes that it should be possible for financial instruments to be admitted to trading on a regulated market without the issuer having applied or consented to this. When this relates to transferable securities, one precondition for this is that the security has already been admitted to trading on another regulated market within the EEA. However, the issuer whose securities are admitted to trading without an application or consent should not be covered by the requirements applicable to the provision of information, etc., that apply to those who applied to be admitted.

Besides being an alternative marketplace for an instrument that is admitted to trading on a regulated market, an MTF may also function as an alternative for small undertakings that cannot satisfy all the requirements imposed on an undertaking whose securities are admitted to trading on a regulated market. The Committee therefore proposes that only a generally-framed requirement of suitability should be imposed for admittance to trading on an MTF.

This chapter also deals with the principles of free access and neutrality for participants and issuers in a regulated market. The Committee proposes here that these principles, as previously, shall apply to their full extent for participants in trading and issuers of registered securities. However, it is proposed that the principle of free access should not apply in relation to a party who applies to be admitted to trading. However, when a security is actually admitted to trading, the issuer shall be dealt with as all other issuers – i.e. the principle of neutrality shall apply.

Finally, the rules on market supervision and suspension of trading are dealt with in this chapter. As regards market supervision, the Committee proposes that this shall be attended to by the stock exchange within the framework of its independent function as described in Section 8.3.2. As regards suspension of trading, the Committee proposes that the current provisions are amended so that, in accordance with MiFID, it becomes clear that it is Finansinspektionen’s decision on suspension of trading of an

instrument on a market place that will result in suspension of trading even on other market places.

Supervision and sanctions (Chapter 14)

Through the incorporation of the Market Abuse Directive, the Prospectus Directive and the Transparency Directive, Finansinspektionen’s control powers and sanctions have been extended in several areas. The list of control powers and sanctions contained in MiFID is approximately the same as in the said directives. The Committee has observed that Finansinspektionen already has several of the control powers that a competent authority should have according to MiFID. However, in order to keep the rules that incorporate MiFID together, the Committee proposes that the provisions on the agency’s supervisory powers regarding investment firms and regulated markets be brought together in the Securities Market Act.

The right to implement on-site inspections has in previous legislative matters been deemed to result from the obligation of those undertakings subject to a licence obligation to provide the information required by the agency. However, in conjunction with the implementation of the Prospectus Directive, an express statutory provision regarding on-site inspections has been introduced regarding stock exchanges and authorised market places. The Committee therefore proposes that the rule on on-site inspections contained in the Securities Market Act should also apply to investment firms.

It is stated in MiFID that the competent authority must be entitled to at least temporarily revoke a licence. The Committee concludes in this connection that the Directive as such can be interpreted so that the right to definitively revoke the licence satisfies the Directive’s requirements to at least be able to revoke the licence. However, the Committee considers that a temporary revocation of the licence may be an appropriate sanction power, for example in those cases where a investment firm mismanages one of the operations for which the firm has a licence so seriously that a revocation as such is justified, but at the same time it is possible to conclude that the deficiencies will be rectified. The Committee therefore proposes that Finansinspektionen is given the right to

temporarily revoke licences for investment firms and stock exchanges.

New sanction powers are also dealt with in this chapter, for example the administrative penalties that have been introduced in the banking sector in Sweden. In order to coordinate the rules in the area of securities with the rules contained in the Banking and Financial Business Act and bring about competitive neutrality, the Committee proposes that the same sanction system as for banks, including administrative penalties and charges for delay, be introduced into the Securities Market Act.

Cooperation between competent authorities (Chapter 15)

MiFID’s rules on cross-border operations and establishment of branches are based as mentioned on the principle that a licence in one country within the EEA should also be sufficient for an undertaking to be able to conduct its operation in other countries in the EEA, the ‘European Passport’. According to the main rule, the undertaking is subject to supervision by the competent authority in the country in which the undertaking was granted a licence. This also applies if an undertaking conducts cross-border operations. However, for branches, the host Member State is responsible for the supervision of the branch’s operation in some respects – for example, regarding the rules on protection of investors. In order for the European Passport and the shared supervision described to be able to function, cooperation is required between the competent authorities and the authorities must exchange information. MiFID contains a number of rules about how the cooperation and exchange of information shall be effected. The Committee proposes that these parts of the Directive are incorporated through a generally framed provision that Finansinspektionen should cooperate and exchange information with other competent authorities within the EEA to the extent provided by MiFID.

The Committee also proposes that the provisions of Finansinspektionen’s supervisory authority be formulated so that the agency can intervene directly in relation to branches through rectification orders as regards enforcement of the client protection rules, transaction reporting and the transparency rules applicable to investment firms. In such cases, Finansinspektionen shall notify

the competent authority in the undertaking’s home Member State if the undertaking does not comply with the order.

As regards cross-border operations and those parts of the branch operation for which the agency does not have the supervisory responsibility, the Committee proposes that the agency shall inform the competent authority in the undertaking’s home country if the operation violates the rules adopted pursuant to MiFID. If despite this the undertaking continues to trade in such a way that clearly damages the interests of investors or results in the markets not functioning properly, the agency may prohibit the undertaking from conducting transactions in Sweden. In accordance with the Committee’s proposal, a reciprocal procedure shall also be applied to regulated markets and MTFs outside Sweden if Swedish undertakings participate in the trading.

Consequences (Chapter 17)

The incorporation of MiFID into Swedish law will entail a number of changes to the existing set of rules. Even if in several cases these do not involve any overall changes, the large number of changes entails increased costs for Finansinspektionen, the investment firms and the stock exchanges. Some of the proposed changes – for example, the requirement for transaction reporting – are however rather extensive and in this section an estimate is made of the costs that these requirements may entail. However, the costs cannot yet be assessed with any great precision, among other things because they depend upon which regulations Finansinspektionen will make. The Committee also concludes that the new requirements for transparency and the increased opportunities for competition between various market places involve a risk of fragmentisation of trade on the one hand, but on the other hand may have positive effects over the somewhat longer term.

1. Inledning

1.1. Uppdraget

Värdepappersmarknadsutredningens uppdrag enligt direktiven är att se över frågor som rör lagstiftningen för värdepappersinstitut, börser och auktoriserade marknadsplatser.

1

Uppdraget kan delas in

i fyra delar.

I den fösta delen, som får betecknas som utredningens huvuduppgift, ingår att analysera vilka lagändringar som krävs för att genomföra Europaparlamentets och rådets direktiv 2004/39/EG av den 21 april 2004 om marknader för finansiella instrument och om ändring av rådets direktiv 85/611/EEG och 93/6/EEG och Europaparlamentets och rådets direktiv 2000/12/EG samt upphävande av rådets direktiv 93/22/EEG (MiFID). Direktivet är ett led i arbetet med att skapa en integrerad marknad för finansiella tjänster inom EU. Direktivet syftar till att skapa förutsättningar för effektiva och väl fungerande marknader för finansiella instrument, till att öka konkurrensen på dessa marknader samt till att säkerställa ett gott investerarskydd. Utredningen ska särskilt överväga hur MiFID:s definition av överlåtbara värdepapper och finansiella instrument förhåller sig till begreppen fondpapper och finansiella instrument i handelslagen. Utredningen ska så långt möjligt beakta de genomförandebestämmelser som kommissionen föreslår eller antar. Det bör alltså understrykas att utredningens arbete när det gäller huvuduppgiften inte har bedrivits förutsättningslöst utan inriktats på en implementering av det berörda direktivet och kommissionens – synnerligen omfattande och detaljerade – genomförandebestämmelser.

I den andra delen ingår att se över de sanktionsmöjligheter som Finansinspektionen har att tillgå vid överträdelser av regler på värdepappersmarknadsområdet och särskilt överväga behovet av att

1

Dir. 2004:90, 2004:172, 2005:46, 2005:149 och 2006:45. Direktiven finns intagna som bi-

lagor till betänkandet.

samordna sanktionsmöjligheterna med dem som gäller på bankområdet. Det kan nämligen i många fall anses motiverat med likartade regler för olika typer av finansiella företag. Utredningen ska även i övrigt överväga om regelverket för värdepappersinstitut behöver anpassas med anledning av de reformerade reglerna på bankområdet.

I den tredje delen ingår att överväga vilket ansvar som Finansinspektionen bör ha för fastställande av noteringskraven på de reglerade marknaderna samt om det finns behov av en särskild reglering när en reglerad marknad eller annan marknadsplats tar upp ett finansiellt instrument till handel utan emittentens samtycke.

Slutligen ingår i den fjärde delen att överväga de förslag som Förtroendekommissionen har föreslagit i sitt betänkande Näringslivet och förtroendet (SOU 2004:47) om hanteringen av intressekonflikter i värdepappersbolag och börsens roll när det gäller upprätthållandet av förtroendet för aktiemarknaden.

1.2. Arbetets bedrivande

1.2.1. Allmänt

En av utgångspunkterna för utredningen har varit att skapa en modern samlad lagstiftning på värdepappersmarknadsområdet som står redo att möta de framtida anpassningar av regelverket som kommer att bli nödvändiga, bl.a. genom det fortsatta arbete som pågår inom EU på värdepappersmarknadsområdet. En naturlig utgångspunkt har därvid varit att i samband med genomförandet av MiFID överväga om den reglering som i dag är spridd i flera olika lagar bör samlas i en ny värdepappersmarknadslag. Utredningen kom på ett tidigt stadium fram till att så borde ske.

De bestämmelser som i första hand är aktuella att flyttas över till den nya lagen är bestämmelserna i lagen om värdepappersrörelse (1991:980) och lagen (1992:543) om börs- och clearingverksamhet (börs- och clearinglagen). Utredningen har även övervägt om vissa bestämmelser i lagen (1991:980) om handel med finansiella instrument (handelslagen), t.ex. definitionerna av finansiella instrument m.m. bör flyttas över till den nya lagen.

Utformningen av de nya bestämmelserna och motiveringen till dessa har ingående diskuterats med de sakkunniga. Detta har skett

fortlöpande och vid ett tiotal möten för ändamålet. I flera frågor har meningarna varit delade. Inom utredningen har dock överenskommits att de sakkunniga som huvudregel inte ska avge några särskilda yttranden, flera av dem representerar organisationer som kan förväntas avge remissyttranden över betänkandet. Utredningen redogör i stället för de olika synpunkterna i de avsnitt där de tvistiga frågorna behandlas. Ett undantag från huvudregeln är dock frågan om transaktionsrapporteringen där Ülle-Reet Jakobson har lämnat ett särskilt yttrande.

Företrädare för utredningen har också deltagit vid ett antal möten med företrädare för motsvarande kommittéer i Danmark, Finland, Island och Norge.

I anledning av frågan om ett nytt transaktionsrapporteringssystem har utredningen träffat företrädare för såväl Finansinspektionen som Fondhandlareföreningen. Utredningen har även träffat företrädare för den svenska elbranschen för att diskutera frågan om tillståndsplikt för handel med elderivat.

Utredningen har bl.a. besökt Stockholmsbörsen AB, Skandinaviska Enskilda Banken AB och Carnegie Investment Bank AB för att få en bild av hur handeln i olika finansiella instrument fungerar. Samtal har också ägt rum med andra aktörer såsom Nordic Growth Market NGM och Aktietorget.

Reglerna i MiFID berör i flera avseenden bestämmelser i kommissionslagstiftningen. Utredningen har därvid vid ett par tillfällen haft möten med Fondkommissionsutredningen (Ju 2001:11). En av utredningens sakkunniga har även varit sekreterare i Fondkommissionsutredningen.

Den ursprungligen förordnade utredaren avled den 3 oktober 2005. Efterträdare till honom utsågs den 21 oktober 2005.

1.2.2. Huvudbetänkande och slutbetänkande

Den främsta orsaken till att utredningstiden har förlängts vid några tillfällen är, förutom det uppskjutna ikraftträdandet av MiFID, tidsplanen för antagande av de genomförandeåtgärder som ska beslutas i enlighet med den lagstiftningsprocess som gäller på värdepappersområdet (Lamfalussy-processen).

2

MiFID innehåller i

hög utsträckning mandat för kommissionen att, efter diskussion och omröstning i europeiska värdepapperskommittén, anta sådana

2

Se om genomförandeåtgärderna och Lamfalussyprocessen i kapitel 6.

genomförandeåtgärder i syfte att förtydliga direktivets bestämmelser. Enligt kommissionens tidsplan skulle de formella förslagen till genomförandeåtgärder ha presenterats i september 2005 och europeiska värdepapperskommittén röstat om förslagen i december samma år. Kommissionen presenterade i stället sina förslag till genomförandeåtgärder i februari 2006 och omröstningen har framskjutits till juni 2006.

För att en riktig bedömning ska kunna göras av hur MiFID bör införlivas i svensk rätt bör de slutliga genomförandeåtgärder som europeiska värdepapperskommittén röstat igenom också beaktas. Bl.a. avgörs möjligheterna till nationella avvikelser dels av i vilken form genomförandeåtgärderna utfärdas (förordning eller direktiv), dels av utformningen av genomförandeåtgärderna i sak. Med hänsyn till den korta tid som återstår för införlivandet av MiFID, ska emellertid utredningen senast den 28 april 2006 i ett delbetänkande redovisa sina bedömningar. Detta sker i föreliggande betänkande, som är utredningens huvudbetänkande. Därvid har utredningen utgått från förslag till genomförandeförordning och genomförandedirektiv av den 21 mars 2006.

3

Förslagen kallas i det

följande för genomförandeförordningen och genomförandedirektivet. I den mån ändringar i förslagen sker fram till och med omröstningen i europeiska värdepapperskommittén kommer de ändringar i utredningens bedömningar som detta föranleder att redovisas i utredningens slutbetänkande den 14 juli 2006.

Det bör alltså understrykas att, när det i det följande talas om genomförandeförordningen och genomförandedirektivet, det är de ännu inte slutbehandlade förslagen som åsyftas.

1.3. Bakgrund

1.3.1. Direktivet om marknader för finansiella instrument (MiFID)

MiFID antogs den 21 april 2004. Direktivet ersätter rådets direktiv 93/22/EEG av den 10 maj 1993 om investeringstjänster inom värdepappersområdet (ISD). Vidare görs ändringar i direktivet 85/611/EEG om samordning av lagar och andra författningar som avser företag för kollektiva investeringar i överlåtbara värdepapper

3

Kommissionens förslag till genomförandeförordning, Working document ESC/9/2006-rev1,

och förslaget till genomförandedirektiv, Working document ESC/8/2006-rev1.

(fondföretag), i direktivet 93/6/EEG om kapitalkrav för värdepappersföretag och kreditinstitut samt i direktivet 2000/12/EG om rätten att starta och driva verksamhet i kreditinstitut.

Bakgrunden till att kommissionen lade fram ett förslag till nytt direktiv på investeringstjänsteområdet var framför allt att 1993 års direktiv inte längre ansågs utgöra en effektiv ram för gränsöverskridande investeringar inom EU. ISD ansågs vidare sakna tydliga grundläggande regler för hur konkurrensen mellan och konsolideringen av börser och andra handelsplatser skulle få gå till. En bakgrundsfaktor var också ökningen i antalet alternativ till konventionella finansierings- och sparformer som skett under senare år i form av en rad nya finansiella produkter och tjänster. Företag kan i ökande grad vända sig till aktiemarknader, riskkapitalbolag samt marknader för företagsobligationer för att få sina kapitalbehov tillgodosedda i stället för att använda sig av traditionella banklån. Hushåll kan placera sitt sparande i värdepapper, särskilt i värdepappersfonder och pensionsfonder, i stället för på bankkonton. Vidare har de finansiella marknaderna kommit att spela en alltmer väsentlig roll i företagens riskhantering. De finansiella marknaderna har följaktligen blivit en allt viktigare del av det finansiella systemet.

1.3.2. ISD

I samband med att ISD antogs 1993 blev reglerna om värdepappersinstitut och handeln med finansiella instrument mer harmoniserade inom EU. Direktivet avsåg att förverkliga den inre marknaden på värdepappersområdet och innehåller minimiregler om kraven på verksamheten i värdepappersinstitut.

ISD innehåller bland annat en förteckning över de tjänster, s.k. investeringstjänster, som ska vara tillståndspliktiga i medlemsstaterna och för vilka direktivets bestämmelser gäller. Med investeringstjänster avses bl.a. att verkställa kunders order om köp eller försäljning av finansiella instrument och att förvalta någon annans finansiella instrument.

ISD bygger på principen om hemlandsauktorisation, dvs. ett institut som har auktorisation i sitt hemland får med stöd av denna erbjuda sina tjänster i andra medlemsstater, genom etablering av filial eller genom gränsöverskridande verksamhet, utan att krav på ytterligare tillstånd får ställas. Med stöd av hemlandsauktorisa-

tionen kan ett institut också kräva att få tillträde till börser och andra reglerade marknader i andra medlemsstater samt till marknaderna anslutna clearing- och avvecklingssystem.

Ansvaret för tillsynen över ett värdepappersinstituts verksamhet ligger i princip på myndigheterna i institutets hemland, även i fråga om verksamhet som bedrivs i andra länder. I direktivet finns särskilda regler om uppdelning av ansvar och samverkan mellan berörda tillsynsmyndigheter.

1.3.3. Brister i ISD

Som redan har berörts har mot bakgrund av utvecklingen ett antal brister i ISD och den på detta direktiv grundade nationella lagstiftningen uppmärksammats.

För det första ansågs inte direktivet medföra en tillräckligt hög grad av harmonisering för att möjliggöra ett effektivt ömsesidigt erkännande av värdepappersföretags tillstånd. Den ofta flerdubbla tillsynen av gränsöverskridande transaktioner ansågs hämma effektiviteten i det Europapass som infördes genom ISD.

För det andra ansågs ISD:s bestämmelser om skydd för investerarna vara omoderna och behövde uppdateras för att ta hänsyn till nya affärsalternativ och ny marknadspraxis och de risker som sammanhänger med dessa. Reglerna ansågs också behöva ses över för att tvinga de företag som handlar på investerarnas vägnar att aktivt dra nytta av nya handelsalternativ för att ge kunden bästa möjliga resultat. Därmed skulle konkurrensen mellan olika typer av transaktionskanaler gynna slutinvesteraren.

För det tredje omfattade ISD inte heller hela utbudet av investeringstjänster (t.ex. rådgivning, nya distributionskanaler) och finansiella instrument (t.ex. råvaruderivat). En del av dessa tjänster ansågs kunna innebära betydande risker för investerarna eller marknadseffektiviteten, speciellt om de utgjorde företagets huvudsakliga verksamhet.

För det fjärde ansågs ISD inte ge tillfredsställande behandling av de reglerings- och konkurrensfrågor som uppstod när börser i ökande omfattning började konkurrera med varandra och med nya handelsplattformar. När ISD antogs förekom konkurrens mellan börserna/handelssystemen endast i tämligen begränsad omfattning. Att reglera konkurrensen mellan olika metoder för orderutförande (börser, nya handelsplattformar, orderutförande av värdepappers-

företagen själva) sågs som en viktig utmaning. De få och underutvecklade bestämmelser i ISD som gällde reglerade marknader ansågs inte ge en tillräcklig ram inom vilken marknader och system kunde konkurrera om likviditeten och inom vilken värdepappersföretag kunde utföra order utanför börserna i samband med att de tillhandahöll andra tjänster till kunderna.

Ett annat problem var att ISD gav medlemsstaterna valfrihet att föreskriva att order från privata investerare endast skulle få utföras på en reglerad marknad (”koncentrationsregeln”). Denna möjlighet hade utnyttjats av vissa medlemsstater, medan andra valt att inte göra det. Detta hade lett till att metoderna för orderutförande skiljde sig åt mer i de senare länderna. Dessa grundläggande skillnader i regleringen av marknadsstrukturen hade i sin tur lett till skillnader mellan medlemsstaterna i fråga om handelskonventioner, regler om hur handeln på marknaden ska bedrivas, utrymmet för konkurrens mellan olika plattformar för orderutförande samt marknadsaktörernas beteende. Enligt kommissionen kunde dessa skillnader utgöra ett hinder för gränsöverskridande transaktioner.

Vidare ansågs ISD:s bestämmelser om bl.a. samarbete mellan behöriga myndigheter vara otillräckligt utvecklade. De ansågs exempelvis inte vara tillräckligt tydliga när det gäller fördelningen av tillsynsansvaret mellan medlemsstaterna och ansågs heller inte lägga en bra grund för gränsöverskridande samarbete mellan tillsynsmyndigheterna. Enligt kommissionen krävdes det att olagligt beteende beivrades och bestraffades med samma kraft i hela unionen för att en fullständigt integrerad inre marknad för finansiella tjänster ska fungera. Ytterligare ett villkor för att en integrerad och organiserad inre marknad skulle fungera ansågs vara att det fanns ett oreserverat och smidigt samarbete och informationsflöde mellan de nationella myndigheterna. Bestämmelserna i ISD om samarbete mellan tillsynsmyndigheterna utformades för en miljö där kopplingarna mellan olika nationella finansiella marknader inte var lika utvecklade. Enligt kommissionens mening fanns det därför behov av att modernisera dessa bestämmelser.

Slutligen ansågs bestämmelserna i ISD inte vara tillräckligt flexibla och moderna. De ansågs vara illa anpassade för angelägna regleringsfrågor som orsakats av förändringar i marknadsstrukturen och affärs- och tillsynsmetoderna och behövde därför skrivas om. Omfattningen av reformarbetet ansågs dessutom visa att det är utsiktslöst att försöka reglera de finansiella marknaderna genom stela bestämmelser i en oföränderlig lagstiftning.

Mot den bakgrunden ansågs det motiverat att uppdatera regelverket för handel med finansiella instrument inom EU. Med hänsyn till rekommendationer från en s.k. visemannakommité

4

be-

slutades också att direktivet skulle bygga på den nya lagstiftningsprocessen, den s.k. Lamfalussymodellen (se avsnitt 3.7). Därmed öppnades också för möjligheten att anta juridiskt bindande genomföranderegler genom ett så kallat kommittéförfarande.

4

The Committee of Wise Men on the Regulation of European Securities Markets.

2. Gällande bestämmelser på värdepappersmarknadsområdet

2.1. Inledning

Regleringen på värdepappersmarknadsområdet är omfattande. Förutom genom lagar och förordningar regleras marknaden genom myndighetsföreskrifter, interna börsregler, allmänna avtalsvillkor och rekommendationer från branschorgan m.m. Regleringen är sedan början av 1990-talet starkt influerad av EG-rätten. På grund av det stora antalet nya bestämmelser som tillkommit inom EU under senare år har lagstiftningen vuxit och blivit allt mer svåröverskådlig.

Lagen (1992:543) om börs- och clearingverksamhet (börs- och clearinglagen) innehåller bestämmelser om börser, börsmedlemmar (dvs. deltagarna i handeln vid en börs), auktoriserade marknadsplatser, clearingorganisationer, handelsstopp och tillsyn. Den huvudsakliga regleringen för värdepappersinstitutens verksamhet finns i lagen (1991:981) om värdepappersrörelse. I denna lag finns bl.a. bestämmelser om vad som krävs för att tillstånd att driva värdepappersrörelse ska lämnas, vilka krav som instituten fortlöpande måste uppfylla samt hur och under vilka förutsättningar som tillsynsmyndigheten kan ingripa mot institutens verksamhet.

Lagen (1991:980) om handel med finansiella instrument (handelslagen) innehåller bl.a. bestämmelser om krav på att upprätta prospekt vid vissa emissioner och andra erbjudanden om köp och försäljning av finansiella instrument. Lagen innehåller även bestämmelser om anmälningsskyldighet för förvärv som innebär att ett innehav uppnår vissa nivåer (s.k. flaggningsskyldighet). Lagen innehåller även definitioner av begreppen finansiellt instrument och fondpapper som har betydelse för övrig lagstiftning som rör värdepappersmarknaden. Med finansiellt instrument avses fondpapper och annan rättighet eller förpliktelse som är avsedd för handel på värdepappersmarknaden. Fondpapper definieras i sin tur som aktie och obligation samt sådana andra delägarrätter eller

fordringsrätter som är utgivna för allmän omsättning, fondandel och aktieägares rätt gentemot den som för hans räkning förvarar aktiebrev i ett utländskt bolag (depåbevis). Finansiellt instrument är således ett vidare begrepp än fondpapper. Exempel på finansiella instrument som inte utgör fondpapper erbjuder främst olika former av derivat. Dessa är i stället hänförliga till andra rättigheter och förpliktelser som är avsedda för handel på värdepappersmarknaden och som därför också omfattas av begreppet finansiellt instrument.

De ovan angivna lagarna innehåller de grundläggande bestämmelserna. Finansinspektionen har efter bemyndigande i förordningen om handel och tjänster på värdepappersmarknaden respektive förordningen om börs- och clearingverksamhet meddelat ett stort antal föreskrifter på området. Därutöver har Finansinspektionen gett ut allmänna råd. Dessa råd är i och för sig inte bindande men torde kunna tillmätas betydelse bl.a. vid tillståndsprövning och i skadeståndssammanhang.

Förutom lagar, förordningar och föreskrifter finns som redan nämnts en omfattande självreglering på området. Börser ställer upp villkor och krav i sina noteringsavtal och avtal med börsmedlemmarna. Motsvarande gäller för auktoriserade marknadsplatser. Vidare har olika branschorgan, t.ex. Näringslivets börskommitté, Svenska Fondhandlarföreningen och Fondbolagens förening genom rekommendationer och riktlinjer skapat ett internt regelverk som i vissa delar är osanktionerat men som vunnit allmän efterföljd på marknaden. Aktiemarknadsnämnden ska genom uttalanden, rådgivning och information verka för god sed på aktiemarknaden.

MiFID påverkar framför allt den svenska lagregleringen avseende värdepappersrörelse och marknadsplatser i lagen om värdepappersrörelse och börs- och clearinglagen. I följande avsnitt lämnas därför en kortfattad beskrivning av de viktigaste bestämmelserna i dessa två lagar. MiFID påverkar även lagen om kommission, vilket kommer att närmare behandlas i avsnitt 12.1.3.

1

1

Se även Fondkommissionsutredningens betänkande Fondkommission

och en ny kom-

missionslag (SOU 2005:120).

2.2. Lagen om värdepappersrörelse

2.2.1. Inledning

Lagen om värdepappersrörelse trädde i kraft den 1 augusti 1991 och ersatte då fondkommissionslagen (1979:748). Lagen i sin nuvarande form är i stora delar baserad på ISD.

I lagen definieras värdepappersinstitut som värdepappersbolag, svenska kreditinstitut som fått tillstånd enligt lagen att driva värdepappersrörelse och utländska företag som driver värdepappersrörelse från filial här i landet. Med värdepappersbolag avses ett svenskt aktiebolag som har fått tillstånd att driva värdepappersrörelse.

2.2.2. Tillstånd

Enligt huvudregeln får värdepappersrörelse endast drivas efter tillstånd av Finansinspektionen. Med begreppet värdepappersrörelse avses vissa huvudverksamheter rörande finansiella instrument, nämligen handel för egen räkning eller för annans räkning i eget namn, förmedling av kontakter mellan köpare och säljare, förvaltning åt någon annan samt garantirådgivning eller annan medverkan vid emissioner.

Utländska företag som hör hemma inom EES och som i sitt hemland har tillstånd att bedriva värdepappersrörelse behöver inget tillstånd för verksamheten i Sverige (s.k. hemlandsauktorisation).

2

Undantagna från tillståndsplikten är även i vissa fall bl.a. börser och auktoriserade marknadsplatser samt försäkringsmäklare. Lagen är endast tillämplig på rörelse som bedrivs yrkesmässigt. Med detta begrepp menas att det ska vara fråga om mer än enstaka uppdrag. En advokat som vid enstaka tillfällen i samband med ett klientuppdrag medverkar eller förmedlar en värdepappersaffär ska t.ex. inte anses bedriva tillståndspliktig värdepappersrörelse.

Tillstånd att driva värdepappersrörelse får meddelas kreditinstitut samt svenska aktiebolag och utländska företag som inte är kreditinstitut.

3

2

Principen om hemlandsauktorisation kommer från ISD, se avsnitt 1.3.2.

3

Utländskt bank- eller kreditföretag som driver bank- eller finansieringsrörelse från filial här

i landet inbegrips i begreppet kreditinstitut (se definitionen av kreditinstitut i 1 kap. 2 §).

Ett av kriterierna vid bedömningen av om ett svenskt aktiebolag ska beviljas tillstånd att driva värdepappersrörelse är att den planerade verksamheten ska kunna antas komma att uppfylla kraven på en sund värdepappersrörelse och att de personer som kommer äga ett kvalificerat innehav i företaget inte kan antas komma att motverka en sund utveckling av verksamheten. Sundhetsbegreppet återfinns även i annan lagstiftning på det finansiella området. I lagen om värdepappersrörelse har begreppet konkretiserats i sju punkter, vilka bl.a. innebär att ett företag ska handla på ett ärligt och rättvist sätt, att det ska handla med erforderlig skicklighet, omsorg och skyndsamhet samt se till att kunder erhåller tillräcklig information. Principerna är hämtade från arti- kel 11.1 i ISD men härrör ursprungligen från IOSCO:s grundprinciper. Finansinspektionen har meddelat närmare föreskrifter som preciserar vad sundhetskravet innebär.

4

Vidare ska ett värde-

pappersbolags bolagsordning godkännas av Finansinspektionen i samband med att bolaget får tillstånd att driva värdepappersrörelse. Bolagsordningen får inte strida mot lagen om värdepappersrörelse eller någon annan författning. Styrelsen i ett värdepappersbolag ska bestå av minst fem ledamöter.

Bolagets styrelse och verkställande direktör har ett övergripande ansvar för verksamheten. För att ett tillstånd ska få beviljas krävs därför att det kan antas att dessa personer har tillräckliga insikter och erfarenheter samt i övrigt är lämpliga. Tillstånd får inte heller beviljas om det kan antas att någon som i väsentlig mån har åsidosatt sina skyldigheter i näringsverksamhet eller i andra ekonomiska angelägenheter eller gjort sig skyldig till allvarlig brottslighet kommer att ha ett kvalificerat innehav i bolaget. I andra delar av lagen och i annan lagstiftning finns krav i olika hänseenden som ska följas, t.ex. kapitalkrav och krav på ansvarsförsäkring.

Ett kreditinstitut måste ha ett särskilt tillstånd enligt lagen om värdepappersrörelse för att få driva värdepappersrörelse även om institutet innehar tillstånd att bedriva rörelse enligt lagen om bank- och finansieringsrörelse. Eftersom kreditinstitutet är föremål för prövning enligt den lagen kontrollerar Finansinspektionen enligt lagen om värdepappersrörelse endast att den planerade värdepappersrörelsen kan antas komma att uppfylla kraven på en sund

4

Finansinspektionens föreskrifter (FFFS 2002:7) om uppföranderegler på värdepappers-

marknaden. Se även Finansinspektionens allmänna råd (FFFS 2002:5) om värdepappersrörelse m.m.

värdepappersrörelse och att kreditinstitutet tillhör ett investerarskydd som uppfyller minst de krav som gäller inom EES.

Ett utländskt företag som hör hemma utanför EES har möjlighet att efter tillstånd från Finansinspektionen bedriva värdepappersrörelse i Sverige från filial. Vid tillståndsprövningen ska Finansinspektionen göra samma prövning av det utländska företaget som vid en prövning av ett kreditinstitut som vill bedriva värdepappersrörelse samt därutöver kontrollera att företaget står under betryggande tillsyn av en behörig myndighet i hemlandet.

2.2.3. Rörelseregler

Rörelsereglerna syftar bl.a. till att begränsa ett värdepappersbolags exponering för risker inom annan verksamhet än sådan som tillståndet avser (vissa av bestämmelserna är även tillämpliga på utländska företag). Sålunda är möjligheterna för ett värdepappersbolag att äga kvalificerade innehav i andra företag begränsade liksom dess möjligheter att äga egendom som inte behövs i värdepappersrörelsen. Vidare gäller begränsningar för bolagets möjligheter att bedriva annan verksamhet än den som tillståndet avser, s.k. sidoverksamhet. Finansinspektionen kan dock ge tillstånd till vissa former av sidoverksamhet, nämligen rådgivning, förvaring av värdepapper, mottagande av kunders likvida medel med redovisningsskyldighet eller på konto, kreditgivning med anknytning till värdepappersaffärer samt valutaväxling. Om det finns särskilda skäl kan inspektionen även ge tillstånd till annan sidoverksamhet om verksamheten kan antas komma att underlätta rörelsen.

Tillstånd att ta emot medel på konto får beviljas endast tillsammans med tillstånd för kreditgivning eftersom dessa två verksamheter utgör den EG-rättsliga definitionen av kreditinstitut.

Ett värdepappersbolag får därutöver efter tillstånd av Finansinspektionen driva valutahandel och om det finns särskilda skäl även annan verksamhet om det kan antas att denna verksamhet underlättar rörelsen.

Rörelsereglerna innehåller även bestämmelser om hanteringen av kunders likvida medel. Om likvida medel har tagits emot med redovisningsskyldighet gäller att medlen genast ska avskiljas och sättas in på räkning i kreditinstitut, dvs. bank eller kreditmarknadsföretag. För det fall att värdepappersbolaget kommer på obestånd

kommer således dessa medel att vara skyddade från bolagets fordringsägare genom att kunderna har separationsrätt till medlen. Samma skydd gäller inte likvida medel som tas emot för att innehas på konto hos bolaget. För att få ta emot medel på konto krävs dock att ett skriftligt avtal upprättas mellan värdepappersbolaget och kunden. Ett värdepappersbolag som tar emot medel på konto ska ha en med hänsyn till rörelsens art och omfattning tillräcklig betalningsberedskap. För kreditgivning finns regler för en korrekt kreditprövning och om kreditjäv för vissa närståendesituationer.

5

Vid köp, försäljning eller byte av finansiella instrument ska en avräkningsnota upprättas. Finansinspektionen har meddelat närmare föreskrifter om vem som ska upprätta en avräkningsnota och vad den ska innehålla.

6

2.2.4. Kapitaltäckning m.m.

Värdepappersbolag ska ha ett visst kapital till skydd för insättare och uppdragsgivare. Med kapitalkrav avses dels krav på ett visst kapital för att få starta värdepappersrörelsen (startkapital), dels krav på ett visst kapital i förhållande till de risker för bl.a. kreditförluster och kursförändringar som värdepappersrörelse är förenad med (kapitaltäckning).

Det startkapital ett värdepappersbolag ska ha när verksamheten påbörjas varierar beroende på vilken verksamhet bolaget kommer att driva.

7

I normalfallet gäller ett krav på 125 000 euro. Kommer

värdepappersbolaget att ägna sig åt handel för egen räkning eller garantigivning och annan medverkan vid emissioner uppgår kravet till 730 000 euro. Om det i värdepappersbolagets verksamhet kommer ingå att ta emot kunders medel på konto gäller i stället ett krav på 5 miljoner euro. Detta krav motsvarar det krav som ställs på ett bankaktiebolag och kreditmarknadsföretag enligt lagen om bank- och finansieringsrörelse.

8

Om värdepappersbolaget endast ska

5

Finansinspektionen har i föreskrifter (FFFS 2002:6) om verksamhetsplan för värdepappers-

bolag m.fl. meddelat ytterligare föreskrifter rörande mottagare av medel på konto och kreditgivning. Se även Svenska Fondhandlareföreningens rekommendation i fråga om hållande av medel på konto och kreditgivning i värdepappersbolag (mars 1995).

6

Se 11 kap. i Finansinspektionens föreskrifter om uppföranderegler på värdepappersmark-

naden.

7

Kraven är hämtade från rådets direktiv 93/6/EEG om kapitalkrav för värdepappersföretag

och kreditinstitut.

8

Kapitalkravet är nödvändigt då ett svenskt värdepappersföretag som tar emot medel på

konto som angetts ovan även är att anse som ett kreditinstitut i EG-rättslig mening.

syssla med medverkan vid transaktioner som avser andelar i investeringsfonder enligt lagen om investeringsfonder gäller ett krav på 50 000 euro.

Regler om kapitaltäckningskrav finns i lagen (1994:2004) om kapitaltäckning och stora exponeringar för kreditinstitut och värdepappersbolag.

9

I lagen finns bestämmelser som ålägger kredit-

instituten och värdepappersbolagen ett kapitaltäckningskrav för kreditrisker och marknadsrisker som de utsätts för i sin verksamhet. Kapitaltäckningskravet för kreditrisker bestäms i förhållande till institutets och bolagets tillgångar och åtaganden. Enligt huvudregeln ska ett kreditinstitut och ett värdepappersbolag ha en kapitalbas som motsvarar minst åtta procent av tillgångarna.

Vidare stadgas i lagen om värdepappersrörelse att ett värdepappersbolag ska ha en ansvarsförsäkring för skadeståndsskyldighet som bolaget kan komma att ådra sig vid utförandet av tjänster i sin rörelse. Finansinspektionen har meddelat närmare bestämmelser om sådan försäkring i sina föreskrifter om verksamhetsplan för värdepappersbolag m.fl. Enligt Finansinspektionens allmänna råd om värdepappersrörelse bör beloppen för möjlig ersättning per skada uppgå till minst en miljon kronor och per år till minst fem miljoner kronor om verksamheten omfattar kommissionshandel. Avser verksamheten någon av de övriga tjänsterna bör motsvarande belopp uppgå till minst två miljoner kronor respektive tio miljoner kronor.

2.2.5. Tillsyn

Finansinspektionen utövar tillsyn över värdepappersinstituten. Även när det gäller tillsynen ingår som en väsentlig del att se till att instituten iakttar sundhetskravet. Tillsynen avser således delvis samma aspekter som ingår i tillståndsprövningen. Instituten ska lämna inspektionen de upplysningar om sin verksamhet som inspektionen begär.

10

Här i landet etablerade filialer till företag

hemmahörande i annat EES-land står, enligt den s.k. principen om

9

Finansdepartementet har nyligen lämnat ett förslag till en ny lag om kapitaltäckning och

stora exponeringar, se Finansdepartementets promemoria Fi 2005/6495 av den 22 december 2005.

10

Därutöver har Finansinspektionen enligt 6 kap. 1 a § handelslagen rätt att anmoda dels ett företag eller någon annan att tillhandahålla uppgifter, handlingar eller annat, dels den som förväntas kunna lämna upplysningar i saken att inställa sig till förhör.

hemlandstillsyn, i första hand under tillsyn av tillsynsmyndigheten i hemlandet.

I lagen finns bestämmelser om ägarprövning. Syftet med ägarprövning är att förhindra att inflytelserika ägare missbrukar sin ställning och sitt inflytande över värdepappersbolaget verksamhet så att grundläggande skyddsintressen äventyras, t.ex. att en kunds finansiella instrument används i spekulationssyfte.

Finansinspektionen får förordna en särskild revisor att tillsammans med övriga revisorer delta i revisionen av ett svenskt värdepappersinstitut. Inspektionen kan vidare kalla till styrelsesammanträde i ett sådant institut, vid vilket företrädare för inspektionen har rätt att närvara. Sådan närvarorätt föreligger generellt när svenska värdepappersinstitutet håller bolagsstämma.

Om ett svenskt värdepappersinstitut har fattat beslut som strider mot lagen om värdepappersrörelse eller någon annan författning som reglerar institutets verksamhet får Finansinspektionen förbjuda verkställighet av beslutet. Detta kan ske genom förelägganden som får förenas med vite. Inspektionen kan även meddela varning eller återkalla tillståndet.

Finansinspektionen har även möjlighet att pröva lämpligheten av en delägare i ett värdepappersbolag vars innehav uppgår till, eller överstiger vissa i lagen angivna nivåer.

2.3. Börs- och clearinglagen

2.3.1. Inledning

I samband med att börs- och clearingslagen trädde i kraft den 1 januari 1993 upphävdes lagen om Stockholms fondbörs (1979:749). Den nya lagstiftningen innebar att det legala monopolet på att organisera handel med fondpapper (främst aktier och obligationer) som Stockholms fondbörs hade avskaffades. Börslagstiftningen utvidgades samtidigt till att inbegripa handel med alla slag av finansiella instrument. Därigenom kom bl.a. derivatinstrument såsom optioner och terminer att omfattas.

Enligt lagen kan ett företag som driver verksamhet i syfte att åstadkomma regelbunden handel med finansiella instrument få auktorisation som börs eller marknadsplats. Någon skyldighet föreligger emellertid inte att söka auktorisation utan börsliknande verksamhet kan även bedrivas med stöd av tillståndsreglerna i lagen

om värdepappersrörelse. Det företag som vill ha status som börs eller auktoriserad marknadsplats kan dock i stället välja att söka auktorisation enligt börs- och clearinglagen och är i så fall undantaget från tillståndsplikt enligt lagen om värdepappersrörelse, dvs. det behövs endast auktorisation eller tillstånd enligt en av lagarna.

En auktoriserad marknadsplats kan beskrivas som en enklare form av börs då kraven är högre ställda för att ett företag ska få kalla sig börs. En viktig skillnad mellan börs och auktoriserad marknadsplats är att det för en auktoriserad marknadsplats saknas bestämmelser för krav på medlemmar – dvs. deltagare i handeln –, vilket innebär att det i princip ankommer på marknadsplatsen själv att bestämma vilka aktörer som får bli medlemmar. Vidare kan inregistrering av fondpapper endast ske vid en börs och reglerna i lagen om värdepappersrörelse om halvårsrapporter och i handelslagen om prospektskyldighet gäller endast för aktiebolag vars fondpapper är upptagna till handel på en börs. Något lagkrav på att en auktoriserad marknadsplats ska ha en disciplinnämnd finns inte heller.

Bestämmelserna i lagen riktar sig mot den som bedriver verksamheten, dvs. mot börsen och den auktoriserade marknadsplatsen. Genom bestämmelserna förpliktas börsen och den auktoriserade marknadsplatsen att se till att lagens krav är uppfyllda. De får sedan genom avtal med emittenterna och börsmedlemmarna respektive dem som handlar på marknadsplatsen se till att dessa uppfyller lagens krav.

2.3.2. Auktorisation som börs m.m.

En börs ska driva sin verksamhet så att allmänhetens förtroende för värdepappersmarknaden upprätthålls och enskildas kapitalinsatser inte otillbörligen äventyras samt i övrigt så att verksamheten kan anses sund. Börsen ska därvid tillämpa principerna om fritt tillträde, neutralitet och god genomlysning. Med principen fritt tillträde avses att de aktörer som uppfyller lagens och börsens krav ska ha rätt att bli börsmedlemmar. I kravet på neutralitet ligger att börsen inte ska särbehandla några medlemmar och kravet på god genomlysning innebär att börsmedlemmarna ska få en snabb och korrekt information om handeln och att allmänheten får tillfälle att ta del av sådan information. Några motsvarande neutralitets- krav gäller inte uttryckligen beträffande börsens behandling av

emittenter, men det ligger i sakens natur att det även i detta sammanhang förutsätts likabehandling.

Auktorisation som börs får meddelas svenska aktiebolag eller svenska ekonomiska föreningar, om de uppfyller de i lagen angivna kraven.

11

Förutom sundhetskravet finns bestämmelser motsvarande

dem i lagen om värdepappersrörelse som ställer vissa krav på större ägare och företagets ledning samt om företagets bolagsordning eller stadgar. En börs ska ha ett aktiekapital (eller summan av medlemsinsatser och förlagsinsatser om det är fråga om en ekonomisk förening) som med hänsyn till verksamhetens art och omfattning är tillräckligt stort. Vid bedömningen av om aktiekapitalet är tillräckligt stort ska hänsyn tas även till andra finansiella resurser som börsen har eller kan utnyttja. En börs ska ha en styrelse med minst fem ledamöter.

Auktorisation kan även ges till utländska företag att här i landet driva verksamhet som börs från avdelningskontor med självständig förvaltning (filial).

En börs får som medlemmar ha Riksbanken och Riksgäldskontoret samt juridiska personer som har en betryggande kapitalstyrka, ändamålsenlig organisation av verksamheten, nödvändiga riskhanteringsrutiner, säkra tekniska system och i övrigt bedömas vara lämpliga att delta i handeln vid en börs.

En börsmedlem ska till börsen anmäla avslut som medlemmen utanför börsen har gjort för egen eller någon annans räkning i de finansiella instrument som noteras vid börsen. Rapporteringen ska ske i den ordning och omfattning som börsen bestämmer. Enligt Stockholmsbörsens regelverk (NOREX Member Rules) ska en medlem normalt rapportera sådana avslut inom 5 minuter.

12

Har

avslut skett efter börsens stängning ska rapportering normalt ske senast 15 minuter före börsens öppnande nästa börsdag.

Utöver den verksamhet som auktorisationen omfattar får en börs endast bedriva sådan verksamhet som har nära samband med den. Finansinspektionen kan dock medge undantag från denna regel. Vilken verksamhet som kan anses ha nära samband med börsverksamheten kan skifta beroende på hur den enskilde börsen

11

Finansinspektionen har meddelat allmänna råd (FFFS 1996:16) om ansökan om att få auktorisation som börs eller marknadsplats eller tillstånd att bedriva clearingverksamhet enligt lagen om börs- och clearingverksamhet.

12

NOREX bildades år 1997 och utgör numera ett samarbete mellan börserna i Helsingfors, Köpenhamn, Stockholm, Oslo, Talinn, Riga, Vilnius samt på Island. Syftet med alliansen är att skapa en samnordisk värdepappersmarknad. NOREX Member Rules är de ingående börsernas gemensamma regelverk.

är organiserad. Som exempel kan nämnas clearingverksamhet samt tillhandahållande av tjänster rörande marknadsinformation och utbildning med anknytning till börshandeln.

En börs ska ha en fristående disciplinnämnd med uppgift att handlägga ärenden om medlemmars och emittenters överträdelser av de regler som gäller vid börsen. Finansinspektionen har meddelat närmare föreskrifter om disciplinnämnder.

13

Nämnden ska

endast pröva rena disciplinärenden. Ärenden av mer administrativ karaktär ligger utanför nämndens ansvarsområde.

En börs är skyldig att övervaka handeln och kursbildningen och se till att handeln sker i överensstämmelse med lagen samt med god sed på värdepappersmarknaden. Finansinspektionen har meddelat närmare föreskrifter hur sådan marknadsövervakning ska bedrivas.

14

Kurser noteras med ledning av köpanbud, säljanbud och betalkurser som förekommer vid eller rapporteras till börsen. En god genomlysning av handeln vid en börs är av väsentlig betydelse för marknaden och dess aktörer. Information om kurser och omsättningsuppgifter beträffande varje finansiellt instrument som noteras vid börsen ska därför offentliggöras omedelbart, om inte Finansinspektionen med hänsyn till handelns effektivitet tillåter något annat. Sådan information ska vidare dagligen samman- ställas och offentliggöras i den ordning och omfattning som Finansinspektionen föreskriver. I Finansinspektionens föreskrifter (FFFS 1995:43) om inregistrering av fondpapper m.m. finns bl.a. bestämmelser om information om kurser och omsättningsuppgifter.

15

2.3.3. Inregistrering av fondpapper och fondpapper som inte inregistreras

Ett fondpapper kan antingen inregistreras eller noteras vid en börs. Det ställs högre krav på fondpapper som ska inregistreras. På Stockholmsbörsen är de räntebärande värdepapperna och de aktier som finns på den s.k. A-listan inregistrerade medan det finns en särskilt lista för oregistrerade aktier, den s.k. O-listan är noterade.

13

Finansinspektionens föreskrifter (FFFS 1998:16) om disciplinnämnd för börser.

14

Finansinspektionens föreskrifter (FFFS 2001:15) om marknadsövervakning vid börser, auktoriserade marknadsplatser och värdepappersinstitut och Finansinspektionens föreskrifter (FFFS 2005:7) om ändring i dessa föreskrifter.

15

Dessa föreskrifter har ändrats genom FFFS 2005:8.

Avtalet mellan börsen och emittenten kallas dock numera i båda fallen noteringsavtal.

Inregistrering av fondpapper vid en börs sker efter ansökan av den som har gett ut fondpapperna. En börs kan således inte självmant inregistrera ett fondpapper. Inregistrering får endast ske om det med hänsyn till marknadsförhållandena för de fondpapper som avses och omständigheterna i övrigt föreligger förutsättningar för en ändamålsenlig börshandel med fondpapperna. Lagens bestämmelser är tämligen allmänt hållna. Finansinspektionen har emellertid bemyndigats att meddela närmare föreskrifter om villkoren för inregistrering.

16

Ett aktiebolag vars aktier är inregistre-

rade är skyldig att offentliggöra halvårsrapporter.

Notering vid en börs av fondpapper som inte är föremål för inregistrering sker efter ansökan av den som gett ut fondpapperna. Notering får endast ske om det med hänsyn till marknadsförhållandena för de fondpapper som avses och omständigheterna i övrigt föreligger förutsättningar för en ändamålsenlig börshandel med fondpapperna. Till skillnad från vad som gäller vid inregistrering har regeringen inte bemyndigats att meddela närmare föreskrifter utan det är upp till varje enskild börs att närmare ange vilka krav som ska vara uppfyllda för att fondpapperen ska noteras. Utgivarens informationsskyldighet är dock detsamma som vid inregistrering av fondpapper.

2.3.4. Auktorisation som marknadsplats m.m.

Prövningen för att få auktorisation som marknadsplats överensstämmer i stort med den som gäller för börs. Kraven avseende fritt tillträde och neutralitet är dock något annorlunda formulerade mot bakgrund av att det vid en auktoriserad marknadsplats inte är

16

Finansinspektionens föreskrifter (FFFS 1995:43) om inregistrering av fondpapper m.m. Föreskrifterna har ändrats genom FFFS 2005:8. I föreskrifterna ställs bl.a. olika villkor upp för att ett fondpapper ska få inregistreras. Ett fondpapper ska t.ex. vara fritt överlåtbart och för aktier gäller att värdet av bolagets aktier ska uppgå till minst tio miljoner kr. Vidare finns bestämmelser om tillräcklig ägarspridning. Reglerna är minimiregler och inget hindrar en börs för att i sina noteringsavtal ställa upp högre krav. Stockholmsbörsen har t.ex. i sina noteringsavtal tillkommande noteringskrav som delvis varierar beroende på om aktierna ska inregistreras på A-listan eller noteras på O-listan. För notering på A-listan gäller högre krav än för O-listan. De svenska bestämmelserna om inregistrering av fondpapper innebär en anpassning till det numera kodifierade börsdirektivet (Europaparlamentets och rådets direktiv 2001/34/EG av den 28 maj 2001 om upptagande av värdepapper till officiell notering och om uppgifter som ska offentliggöras beträffande sådana värdepapper).

obligatoriskt att de som deltar i handeln ska vara anslutna medlemmar.

En auktoriserad marknadsplats, där det förekommer notering av fondpapper som är inregistrerade vid en börs, ska till börsen rapportera alla avslut i dessa fondpapper som sker vid marknadsplatsen eller som anmäls dit. Hur denna rapportering ska gå till får överenskommas mellan börsen och marknadsplatsen.

Kurser på en auktoriserad marknadsplats ska på samma sätt som på en börs noteras med ledning av köpanbud, säljanbud och betalkurser som förekommer vid eller anmäls till marknadsplatsen. Det ställs dock inte samma krav på att omedelbart offentliggöra kurser och omsättning. I stället ska denna information sammanställas dagligen och offentliggöras i den ordning och omfattning som Finansinspektionen föreskriver.

2.3.5. Avbrytande av handel och avregistrering

En börs eller en auktoriserad marknadsplats är i vissa fall skyldig att avbryta handeln med ett finansiellt instrument. Syftet med ett handelsstopp är i första hand att eliminera eller förebygga en väsentlig snedvridning av kursbildningen på grund av att aktörerna på värdepappersmarknaden inte på lika villkor eller i tillräcklig omfattning har tillgång till relevanta upplysningar om utgivaren eller det finansiella instrumentet. Enligt förarbetena kan ett handelsstopp användas som påtryckningsmedel för att förmå en emittent att offentliggöra viktig information. Handelsstopp ska även kunna användas om t.ex. en börsmedlem bryter mot reglerna och därigenom framkallar en snedvridning av kursen.

Om handeln med ett finansiellt instrument vid en börs eller auktoriserad marknadsplats har avbrutits ska även handeln med samma instrument vid annan börs eller marknadsplats avbrytas. Det är börsen och den auktoriserade marknadsplatsen som primärt beslutar om handelsstopp men om marknadsplatsen underlåter att fatta ett sådant beslut får Finansinspektionen besluta om handelsstopp.

En börs har rätt att under vissa förutsättningar besluta om avregistrering av ett fondpapper. Detta är fallet om t.ex. utgivaren av fondpappret begär eller om han allvarligt åsidosatt sina förpliktelser. Avregistrering kan dock inte ske om det är olämpligt från allmän synpunkt. Enligt förarbetena ska en helhetsbedömning

göras där samtliga för- och nackdelar vägs in. Bl.a. nämns att börsen ska beakta de olägenheter som drabbar innehavarna av de aktuella fondpapperna (prop. 1991/92:113 s. 189). På motsvarande sätt kan en börs enligt praxis besluta att avnotera ett fondpapper som är noterat men inte inregistrerat. Stockholmsbörsen har vid flera tillfällen beslutat att avregistrera eller avnotera aktier även när emittenten inte själv har gjort ansökan om detta. Skälen för detta har bl.a. varit att bolaget ställt in betalningarna, att bolagets verksamhet varit av ringa omfattning och att kravet på aktiespridning inte var uppfyllt, att bolagets ledning och styrelse inte uppfyllde de krav som ställs på inregistrerade bolag samt att det förelegat brister beträffande bolagets ledning och informationslämnande.

2.3.6. Clearingorganisation

Clearingorganisationernas verksamhet innebär i korthet att medverka till avvecklingen av de affärer med finansiella instrument som genomförts på börsen. Med clearingverksamhet avses fortlöpande verksamhet som består i

  • att på clearingmedlemmarnas vägnar göra avräkningar beträffande deras förpliktelser att leverera finansiella instrument eller att betala i svensk eller utländsk valuta,
  • att genom inträdande som part eller som garant ta över ansvaret för förpliktelsernas fullgörande, eller
  • på annat väsentligt sätt sörja för att förpliktelserna avvecklas genom överförande av likvid eller instrument.

Yrkesmässig clearingverksamhet får endast bedrivas av Riksbanken eller av företag som fått tillstånd som clearingorganisation. En clearingorganisation ska bedriva sin verksamhet så att allmänhetens förtroende för värdepappersmarknaden upprätthålls och enskildas kapitalinsatser inte otillbörligen äventyras samt i övrigt så att verksamheten kan anses sund. På samma sätt som för en börs finns krav på att en clearingorganisation ska tillämpa principerna om fritt tillträde och neutralitet. Även bestämmelserna om lednings- och ägarprövning samt sidoverksamhet motsvarar dem som gäller för en börs.

Beroende på hur clearingverksamheten är organiserad kan verksamheten vara föremål för betydande risker som kräver mycket god finansiell styrka. En clearingorganisation ska därför genom eget

kapital, garanti eller försäkring eller på annat liknande sätt ha en tillfredsställande beredskap att uppfylla ett sådant betalningsansvar som kan uppkomma för organisationen till följd av clearingverksamheten. En clearingorganisation som inträder som part eller garanterar förpliktelser ska enligt huvudregeln se till att det vid clearingverksamheten ställs betryggande säkerhet för gjorda åtaganden och att sådan säkerhet vidmakthålls så länge åtagandet består.

Även för de som vill bli medlemmar i en clearingorganisation ställs krav på en betryggande kapitalstyrka. De ska vidare ha ändamålsenlig organisation av verksamheten, nödvändiga riskhanteringsrutiner, säkra tekniska system och i övrigt vara lämpliga att delta i clearingverksamheten hos organisationen.

17

2.3.7. Tillsyn

Företag med auktorisation eller tillstånd står under tillsyn av Finansinspektionen. Företagen ska lämna inspektionen de upplysningar om sin verksamhet som inspektionen begär. De ovan nämnda tillsynsbefogenheter för Finansinspektionen enligt handelslagen gäller även gentemot börser, auktoriserade marknadsplatser och clearingorganisationer (se avsnitt 2.2.5).

På samma sätt som i lagen om värdepappersrörelse finns bestämmelser om ägarprövning samt bestämmelser som ger Finansinspektionens rätt att förordna en särskild revisor, att kalla till styrelsesammanträde och att ingripa mot beslut som strider mot lagen.

Finansinspektionen har möjlighet att återkalla en auktorisation eller ett tillstånd. Ett beslut om återkallelse gäller inte omedelbart om inte Finansinspektionen särskilt förordnat om detta i sitt beslut. Om det är tillräckligt får Finansinspektionen i vissa fall i stället meddela varning.

Finansinspektionen har vidare fått möjlighet att i vissa fall förelägga vite i samband med att inspektionen meddelar förelägganden eller förbud.

17

Finansinspektionen har i sina allmänna råd (FFFS 1996:16) om ansökan om att få auktorisation som börs eller marknadsplats eller tillstånd att bedriva clearingverksamhet enligt lagen om börs och clearingverksamhet lämnat råd om vilka krav en clearingorganisation bör ställa på sina medlemmar.

2.4. Regler om uppförande på värdepappersmarknaden

2.4.1. Inledning

Som ovan angetts har Finansinspektion meddelat ett stort antal föreskrifter och allmänna råd på värdepappersområdet. Flera av dessa har nämnts i tidigare avsnitt. För förhållandet mellan värdepappersinstitut och kund är framförallt Finansinspektionens föreskrifter (FFFS 2002:7) om uppföranderegler på värdepappersmarknaden av intresse. Vissa av bestämmelserna i dessa föreskrifter har berörts tidigare. Med hänsyn till att MiFID innehåller ett stort antal kundskyddsregler finns det dock anledning att i korthet redogöra för ytterligare några bestämmelser i dessa föreskrifter. Detta görs i avsnitt 2.4.2.

Svenska Fondhandlareföreningen är en samarbetsorganisation för företag som bedriver värdepappershandel. För närvarande (mars 2006) har föreningen 30 medlemmar. Föreningen ska tillvarata medlemmarnas gemensamma intressen och verkar på olika sätt för en effektiv kapitalmarknad. Föreningen har fastställt regler och rekommendationer för vissa aspekter på värdepappershandeln. I avsnitt 2.4.3 kommer kortfattat vissa delar av dessa regelverk att kommenteras.

2.4.2. Finansinspektionens föreskrifter (FFFS 2002:7) om uppföranderegler på värdepappersmarknaden

Ett värdepappersföretag

18

ska utfärda instruktioner för hur intresse-

konflikter som uppstår ska hanteras i samband med utförande av egna affärer, uppdrag åt emittenter och andra kunder. Om värdepappersföretaget bedriver s.k. corporate financeverksamhet ska denna verksamhet vara åtskild från övrig verksamhet på ett sådant sätt att informationen inte otillbörligen kan utnyttjas i någon annan del av verksamheten.

19

Ett värdepappersföretag ska dokumentera uppgifter om en kunds identitet samt, i den utsträckning det behövs för att tillvarata kundens intresse, uppgift om kundens situation, erfarenhet av värdepappersmarknaden och syftet med de tjänster kunden efter-

18

Begreppet värdepappersföretag är i föreskrifterna ett samlingsnamn för bl.a. värdepappersbolag, värdepappersinstitut och utländska företag. I 1 kap. i föreskrifterna framgår vilka bestämmelser som gäller för vilka företag.

19

Svenska fondhandlareföreningen har fastställt principer och riktlinjer för corporate financeverksamhet.

frågar. Innan ett värdepappersföretag träffar avtal med en kund om diskretionär förvaltning ska institutet, i den utsträckning det behövs för att tillvarata kundens intressen, inhämta uppgifter om kundens riskprofil, placeringshorisont samt placeringsrestriktioner. Dessa uppgifter ska dokumenteras.

Ett värdepappersföretag ska lämna bl.a. följande information till sina kunder (informationen ska vara anpassad efter kundens behov av information).

  • Information om företagets namn, vilka tillstånd företaget har, förekomsten av eventuella intressekonflikter mellan kunden och företaget, om kunderna omfattas av insättningsgarantin eller investerarskyddet, hur klagomål från kunden hanteras och om företaget står under Finansinspektionens tillsyn.
  • Innan ett värdepappersföretag utför en värdepapperstjänst för en kunds räkning för första gången ska företaget lämna information om riskerna med de finansiella instrument och värdepapperstjänster som företaget tillhandahåller kunden.
  • Om ett värdepappersföretag lämnar investeringsrådgivning till en kund ska detta dokumenteras i anslutning till rådgivningstillfället.
  • Innan ett värdepappersföretag utför en värdepapperstjänst för en kunds räkning ska institutet lämna kunden information om gällande priser och avgifter.

Telefonsamtal vid ett mäklarbord ska spelas in.

Enligt lagen om värdepappersrörelse ska en avräkningsnota upprättas vid köp, försäljning eller byte av finansiella instrument. Enligt Finansinspektionens föreskrifter ska avräkningsnotan, om båda parterna är värdepappersföretag, upprättas av säljaren. Är endast en av parterna ett värdepappersföretag ska avräkningsnotan upprättas av värdepappersföretaget. Om avslut har skett i kommission ska en särskild avräkningsnota upprättas mellan värdepappersföretaget och den för vars räkning företaget handlat. Avräkningsnotan ska upprättas på avslutsdagen eller, om detta inte är tidsmässigt möjligt, senast påföljande bankdag. Därutöver föreskrivs bl.a. detaljerat vad en avräkningsnota ska innehålla. T.ex. ska det anges på vilken börs eller auktoriserad marknadsplats avslutet skett samt om avslutet har gjorts i kommission eller för egen räkning eller om institutet medverkat vid avslutet utan att själv vara part i detta.

2.4.3. Svenska Fondhandlareföreningens riktlinjer m.m.

Allmänna villkor m.m. för handel med finansiella instrument (från 2003-11-17)

Dessa villkor används som baksidetext till avräkningsnotor och orderunderlag. I dokumentet anges bl.a. att värdepappersinstitut får, om inte annat har överenskommits, bestämma på vilken börs eller annan marknadsplats och i vilken handelsvaluta kundens uppdrag ska utföras. Avslut som genomförs i Sverige ska enligt huvudregeln ske på den börs eller auktoriserade marknadsplats där det finansiella instrumentet noterats. Kundens order gäller, om inte annat har överenskommits, den dag ordern tas emot och längst till dess institutet den dagen avslutar handeln med det slag av finansiellt instrument ordern avser. Dokumentet innehåller i övrigt vissa frågor kring avvecklingen av genomförd affär, bl.a. vad kunden har att iaktta för att tillhandahålla de pengar respektive finansiella instrument som institutet behöver få tillgång till för att kunna medverka i avvecklingen efter utfört köp- respektive säljuppdrag.

Riktlinjer vid handläggningen av affärsuppdrag avseende aktier och aktierelaterade finansiella instrument

20

I inledningen till riktlinjerna anges att dessa syftar till att oklarenheter om kundernas affärsuppdrag undviks, att kundernas intressen så långt som möjligt tillgodoses och att förtroendet för värdepappershandeln upprätthålls. Riktlinjerna ska ses som ett komplement till lagar och föreskrifter på värdepappersområdet. Delvis utgör riktlinjerna en upprepning av vad som framgår av andra regelverk, t.ex. Finansinspektionens föreskrifter.

Ett affärsuppdrag ska enligt riktlinjerna handläggas av värdepappersinstitutet på ett professionellt, omsorgsfullt och skyndsamt sätt och i enlighet med kundens instruktioner.

Affärsuppdrag som mottagits med kursvillkoret ”marknadspris” bör fullgöras så snart detta är möjligt. Sker avslutet mot marknadsplats gäller bästa anbudspriset (köp-/säljkurs) vid tidpunkten för avslutet. Affärsuppdrag som utförs av institutet vid sidan om den aktuella marknadsplatsen när denna är öppen ska enligt huvudregeln genomföras till ett pris inom gällande spread. Om den

20

Från 2003.

aktuella marknadsplatsen är stängd gäller den spread som noterades vid stängningstillfället.

Övrigt

Utöver ovan nämnda villkor och riktlinjer kan nämnas fondhandlareföreningens regler för handel och avveckling av värdepapper (2003-11-17) samt ett utkast till riktlinjer för etiskt uppträdande i banker och värdepappersbolag. Det senare är avsett att användas som modell för riktlinjer av instituten. Dokumentet innehåller allmänna principer samt erinringar om innehållet i regler i lagstiftning m.m. som har betydelse för uppträdandet inom instituten i etiskt hänseende.

3. MiFID i korthet

3.1. Inledning

Liksom ISD innehåller MiFID bestämmelser om reglering och tillsyn av värdepappersföretag och om rätt för dessa företag att med stöd av sitt hemlandstillstånd bedriva gränsöverskridande verksamhet i andra medlemsstater. Direktivet innebär dock en ökad harmonisering av reglerna för företagen och är betydligt mer omfattande och detaljerat än ISD. Harmoniseringen har i direktivet emellertid ingen enhetlig karaktär. Direktivet har i vissa avseenden karaktär av minimiharmonisering, dvs. med utrymme att på nationell nivå anta strängare reglering. Dit hör exempelvis direktivets genomlysningsregler, som medlemsstater i princip kan vidga tillämpningsområdet för. I andra avseenden liknar direktivet mer s.k. fullharmonisering, dvs. utan sådana möjligheter. Till den senare kategorin hör exempelvis bestämmelserna om när värdepappersföretag ska tvingas och inte tvingas begära upplysningar om sina kunders kunskaper och erfarenheter av en viss produkt eller tjänst. På den punkten ger skrivningarna i direktivet föga handlingsfrihet att i nationell reglering anta restriktivare bestämmelser. På många områden framgår graden av harmonisering inte av direktivet, utan har lämnats för klarläggande i genomförandebestämmelser på nivå två.

Genom direktivet harmoniseras bland annat reglerna för reglerade marknader, dvs. i Sverige börser och auktoriserade marknadsplatser. Direktivet innehåller bl.a. regler om auktorisation och krav på viss organisation. Vidare finns bestämmelser om vilka krav som ska gälla för att ett finansiellt instrument ska tas upp till handel på en reglerad marknad, och regler om vilka som ska ha tillträde till reglerade marknader. Direktivet innehåller även vissa begränsade bestämmelser om clearing och avveckling av transaktioner i finansiella instrument, bl.a. om vilka möjligheter en aktör har att välja system.

3.2. Nya områden

MiFID har ett vidare tillämpningsområde än ISD, och inför harmoniserad reglering av en rad investeringstjänster och finansiella instrument. Bland annat klassificeras investeringsrådgivning, som tidigare betraktats som en sidotjänst, nu som en investeringstjänst. Därigenom måste ett företag som ägnar sig åt investeringsrådgivning först söka auktorisation som värdepappersföretag och ställs därmed under en rad krav om exempelvis uppförande, hantering av intressekonflikter och kapitaltäckning. Företag som enbart ägnar sig åt investeringsrådgivning eller enbart utför order för kunders räkning åläggs något mildare kapitalkrav än värdepappersföretag eller åläggs krav att inneha en professionell skadeförsäkring.

Vidare betraktas erbjudande av investerings- eller finansanalys hädanefter som en sidotjänst. Det medför att direktivets bestämmelser blir tillämpliga om en sådan tjänst tillhandahålls tillsammans med en investeringstjänst. När ett värdepappersföretag ger generella rekommendationer i form av finansiella analyser, eller ger andra typer av investeringsråd, måste det följa direktivets regler om hantering av intressekonflikter.

Tillämpningsområdet vidgas även genom att direktivets definition av finansiella instrument utsträcks till att omfatta bl.a. råvaruderivat och kreditderivat. Företag vars huvudsakliga verksamhet består i att handla med råvaruderivat eller råvaror för egen räkning tillåts utföra sådan handel utan att ställas under direktivets regler. Ett specifikt exempel utgörs av kraftbolag som handlar med elderivat.

3.3. MTF

En annan ny investeringstjänst är drift av en s.k. multilateral handelsplattform (MTF)

1

. En MTF är ett handelssystem inom vilket deltagare sinsemellan kan handla med aktier eller andra finansiella instrument, men som inte i sig ingår som handelssystem på en reglerad marknad. Denna verksamhet blir således tillståndspliktig enligt MiFID. Hittills har dessa handelssystem reglerats antingen som värdepappersföretag eller som reglerade marknader i de olika medlemsstaterna. För att skapa mer likartade konkurrensbetingelser för de olika marknadsplatserna blir även dessa handelssystem

1

Multilateral Trading Facility.

föremål för harmoniserad reglering. Reglerna för sådana MTF:er kommer i många avseenden motsvara reglerna för reglerade marknader. Skälet till detta är att MTF:er och reglerade marknader anses ha många gemensamma beröringspunkter och likartade funktioner. En MTF ska enligt direktivet ha transparenta och objektiva regler för deltagande och åläggs samma organisatoriska krav som ett värdepappersföretag. Genom MiFID öppnas det upp för värdepappersföretag i EU att etablera MTF:er för handel med finansiella instrument.

Ett viktigt syfte med direktivet är att skapa förutsättningar för konkurrens mellan olika sätt att verkställa order i finansiella instrument. Direktivet ger därför, till skillnad mot ISD, inte utrymme för medlemsstaterna att i nationell lagstiftning ha en koncentrationsregel, dvs. en regel som kräver att transaktioner genomförs på en reglerad marknad. Direktivet medför således att det i samtliga medlemsstater blir tillåtet för företagen att verkställa kundorder antingen på en reglerad marknad eller MTF, eller genom att ordern t.ex. utförs mot eget lager. Detta är dock förknippat med förstärkta krav på genomlysning.

3.4. Ökad genomlysning

Genom direktivet införs regler om ökad genomlysning i syfte att förbättra marknadsdeltagarnas möjligheter att jämföra de priser som erbjuds av olika marknadsplatser/marknadsaktörer och därmed utjämna konkurrensförutsättningarna mellan de olika aktörerna. Bland annat införs kraven om genomlysning. Dessa krav berör enbart handeln med aktier.

Genomlysning före handel (”pre-trade transparency”) innebär i direktivets mening offentliggörande av priser och volymer som antagits för handel, dvs. det ska föreligga ett fast bud från den som erbjuder handeln. Genomlysning efter handel (”post-trade transparency”) innebär i direktivets mening offentliggörande av priser och volymer i den faktiskt genomförda transaktionen.

Dessa genomlysningskrav är tillämpliga på reglerade marknader, MTF:er och på så kallade systematiska internhandlare, dvs. värdepappersföretag som utför kundorder mot egna handelspositioner på ett organiserat, regelbundet och systematiskt sätt (exempelvis genom att ha system som är direktkopplade till handel mot det

egna handelslagret). Illikvida aktier och mycket stora transaktioner undantas från kravet om genomlysning före handel.

3.5. Investerarskydd

I direktivet uppställs ett antal regler som syftar till att skydda investerarna och se till att marknaden har en väl fungerande prisbildning. Bland annat finns regler om hur värdepappersföretag ska uppföra sig gentemot sina kunder och om hur de ska verkställa och i övrigt hantera kundernas order.

Värdepappersföretagen åläggs att informera sina kunder om en rad förhållanden rörande företaget och dess tjänster liksom om avgifter och kostnader i samband med värdepapperstransaktioner. När det gäller att utföra en order i okomplicerade finansiella instrument, t.ex. aktier och obligationer, behöver värdepappersföretaget inte informera sig om kundens situation, s.k. execution only. I övriga fall åläggs dock värdepappersföretaget att skaffa sig information om kundens erfarenhet av olika investeringar, kundens finansiella ställning och investeringsmål för att finna lämpliga investeringsprodukter för denne och ge råd i enlighet med dessa. I direktivet införs också en regel som innebär att värdepappersföretag måste vidta alla rimliga åtgärder för att säkerställa ”bästa möjliga utförande”, dvs. bästa möjliga resultat för kunden i en värdepapperstransaktion. Bedömningen av bästa möjliga utförande måste ta hänsyn till en rad faktorer som pris, kostnader, snabbhet i utförandet, storleken på transaktionen och andra relevanta faktorer. Värdepappersföretag åläggs vidare att införa interna riktlinjer för hur bästa genomförande ska säkerställas.

Enligt MiFID är värdepappersföretag skyldiga att identifiera konflikter som kan uppstå mellan värdepappersföretagets intressen i dess olika aktiviteter och kundens intressen. Vidare krävs att värdepappersföretag åläggs att hantera sådana intressekonflikter så att de inte kan få en negativ inverkan på kundens intressen. I fall då en intressekonflikt inte förväntas kunna hanteras på ett rimligt sätt måste kunden informeras om detta av värdepappersföretaget.

3.6. Tillsyn

I direktivet finns vidare bestämmelser om tillsyn och om de behöriga myndigheter som ska utöva tillsynen. Det finns inte något krav på att det enbart får finnas en behörig myndighet som ska utöva tillsyn över det som direktivet reglerar. Dock ska varje medlemsstat utse en behörig myndighet som ska agera som kontaktpunkt vid kontakter med behöriga myndigheter i andra medlemsstater. Om det finns flera behöriga myndigheter i en medlemsstat ska myndigheternas ansvarsområden vara klart avgränsade och myndigheterna ska samarbeta med varandra.

I direktivet finns en minimikatalog med befogenheter som en behörig myndighet ska ha. Av direktivet följer även att medlemsstaterna, utan att det påverkar deras system för civilrättsligt ansvar eller deras rätt att utdöma straffrättsliga påföljder, ska se till att administrativa åtgärder kan vidtas eller administrativa sanktioner kan beslutas mot de ansvariga, när bestämmelser som antagits enligt direktivet inte har följts. Vidare finns i direktivet bestämmelser om samarbete och informationsutbyte mellan behöriga myndigheter i olika medlemsstater.

3.7. Kommittéförfarande

Slutligen införs ett kommittéförfarande i enlighet med den resolution om en effektivare reglering av värdepappersmarknaden i EU som Europeiska rådet antog vid toppmötet i Stockholm i mars 2001 och Europaparlamentets resolution om genomförande av lagstiftningen om finansiella tjänster i februari 2002. Den nya lagstiftningsmodellen, Lamfalussymodellen, bygger på de rekommendationer som visemannakommittén

2

om regleringen av de

europeiska värdepappersmarknaderna gav i sin slutrapport i februari 2001.

Lagstiftningsmodellen innebär kortfattat att proceduren indelas i fyra olika nivåer. På nivå ett antas direktiv eller förordningar i form av övergripande principer. Dessa rambestämmelser ska därefter kompletteras på nivå två med genomförandeåtgärder som kommissionen antar i enlighet med direktivets bestämmelser. Genomförandeåtgärderna kan syfta till att beakta utvecklingen på de finansiella marknaderna eller till att åstadkomma en enhetlig

2

The Committee of Wise Men on the Regulation of European Securities Markets.

tillämpning av den grundläggande rättsakten. På nivå tre ska ett utökat samarbete mellan medlemsstaternas tillsynsmyndigheter komma till stånd. Slutligen ska kommissionen på nivå fyra ta ett ökat ansvar för efterlevnaden av bestämmelserna.

I MiFID ges kommissionen relativt omfattande möjligheter att anta genomförandeåtgärder. Bland annat gäller detta de närmare organisationskrav som ska ställas på värdepappersföretag och hur instituten ska uppföra sig gentemot sina kunder och utföra sina kunders order.

3.8. Ikraftträdande

MiFID trädde i kraft den 30 april 2004 och ska vara överfört i nationell lagstiftning senast den 31 januari 2007 och ska börja tillämpas senast den 1 november 2007.

4. Den finansiella handeln i Sverige

4.1. Inledning

I det här kapitlet beskrivs handeln med finansiella instrument i Sverige.

1

Bland annat redogörs för hur handeln på de olika finan-

siella marknaderna för närvarande är organiserad, de huvudsakliga aktörerna samt grundläggande begrepp och statistik. Finansmarknaderna är visserligen inte något statiskt och oföränderligt. Tvärtom är det enligt utredningens mening få näringsområden som under senare år haft en lika dynamisk och omvälvande utveckling, en utveckling som förefaller fortsätta. En överblick av aktuella förhållanden på finansmarknaderna behövs dock för att sätta in MiFID i ett svenskt perspektiv och som underlag för utredningens bedömningar.

Eftersom en stor del av de bestämmelser som anges i MiFID i första hand är inriktade mot aktiehandeln, inleds avsnitten med en beskrivning av denna (avsnitt 4.2). Därpå följer en redogörelse för räntemarknaden (avsnitt 4.3), som i sin tur delas in i olika delmarknader: obligationsmarknaden och penningmarknaden. Detta följs av ett avsnitt om valutamarknaden (avsnitt 4.4). Kapitlet avslutas med en redogörelse för värdepappersinstituten (avsnitt 4.5).

Innan beskrivningen av de olika delmarknaderna görs, kan det vara till hjälp att betrakta fem stiliserade modeller för värdepappershandel. De beskriver inte alla tänkbara varianter, men kan vara värdefulla att ha i bakhuvudet vid den fortsatta beskrivningen.

1

Kapitlet bygger till stor del på den statistik och de beskrivningar som återfinns i den årliga

riksbankspublikationen Den svenska finansmarknaden.

4.1.1. Handel via medlemmar på en börs eller liknande marknadsplats

På många värdepappersmarknader utförs handeln genom att kunden först kontaktar en intermediär – en mäklare – som i sin tur vidarebefordrar ordern till en marknadsplats. Vanligen är det ett krav att intermediären i sin tur är medlem på marknadsplatsen. För att bli medlem ställs speciella krav som bl.a. innebär en bedömning av medlemmens lämplighet, inte minst i fråga om att kunna garantera att kundernas affärer fullföljs ordentligt med betalning och leverans. Detta har betydelse för att marknadsplatsen och de som handlar där ska kunna lita på att handeln genomförs på ett omsorgsfullt sätt. Medlemskap är typiskt sett ett krav för handel på de flesta aktiebörser.

Mäklaren/medlemmen är visserligen formellt en motpart i affären, men denne agerar i praktiken som förmedlare av köp- och säljintressen till en marknadsplats.

4.1.2. Exekvering av kundorder mot det egna lagret

I stället för att vidarebefordra kundens order till en marknadsplats kan mäklaren/värdepappersinstitutet ibland genomföra ordern mot det egna lagret av värdepapper. I detta fall träder således värdepappersinstitutet själv in som motpart i affären.

4.1.3. Matchning av kunders köp- och säljintressen i det egna systemet

Om värdepappersinstitutet har två motstående kundorder som motsvarar varandra kan institutet i stället välja att matcha dessa i det egna systemet. I detta fall behöver värdepappersinstitutet i princip inte träda in som motpart i affären. I praktiken sker detta dock.

4.1.4. Interbankhandel

I viss värdepappershandel är det vanligt att värdepappersinstitut handlar direkt med varandra utan att använda en marknadsplats. Handeln sker ofta genom att värdepappersinstituten ringer runt till

varandra och hör efter vilka köp- och säljintressen som finns. Denna form av handel kan ske antingen på kunders uppdrag eller för egen räkning. Detta är den dominerande handelsformen på exempelvis räntemarknaden (se vidare avsnittet om räntemarknaden). Även denna handel sker typiskt sett genom att ett värdepappersinstitut går in som motpart och utför affären mot eget lager.

4.1.5. Interbankhandel som förmedlas via broker

Ibland kan dock affärerna på den professionella räntemarknaden förmedlas av en särskild mellanhand – en broker. Skälet till detta är framför allt att parterna vill kunna uppnå anonymitet i handeln. Detta förekommer exempelvis på en del av räntemarknaden.

Varianter och blandformer av de ovan skisserade handelsmodellerna förekommer givetvis. Det behöver heller inte vara klart på förhand vilken modell som i slutändan blir tillämplig. Man kan tänka sig att en kund har ett köp- eller säljintresse i en mycket stor post. Kunden vänder sig till en mäklare, som i sin tur kanske först sonderar intresset bland egna kunder, i andra hand ringer runt till andra mäklare. Enligt vilken modell affären slutligen genomförs beror således på omständigheterna.

Under 2004 var den andel av den totala rapporterade aktieomsättningen som utfördes utanför börsens automatiska ordersystem ca 24 procent – eller ca 800 miljarder kronor.

4.2. Aktiemarknaden

Aktier är benämningen på ägarnas andelar i ett bolag(aktiebolag), och den kapitalinsats som ägarna bidragit med i utbyte mot aktier bildar bolagets aktiekapital. En aktie är i grunden en rätt till bolagets tillgångar och resultat efter det att bolagets fordringsägare, i första hand bolagets långivare, fått sitt. Eftersom värdet på denna rätt är beroende av bolagets lönsamhet, är aktiekapital att betrakta som riskkapital. Aktieägarna har dock begränsat ansvar för bolagets verksamhet i den meningen att de inte kan förlora mer än vad de satsat i bolaget. En del av bolagets vinster brukar komma aktieägarna till del direkt i samband med aktieutdelningen, som i Sverige vanligen sker en gång per år, medan resten av resultatet tillförs

bolagets egna kapital. Aktieinnehav ger också bestämmanderätt över bolaget; varje aktie ger upphov till ett visst röstvärde på bolagets stämma.

2

Bolag som expanderar och som har behov av tillskott av finansiering kan antingen låna pengar av ett kreditinstitut, ge ut obligationer på räntemarknaderna eller emittera nya aktier. De risker som är förknippade med att låna ut till expanderande affärsverksamhet gör att företagens kapitalbehov sällan helt kan tillgodoses av enbart ränte- och kreditmarknaderna, åtminstone inte till rimliga kostnader. En del av dessa bolags finansieringsbehov kan därför behöva tillgodoses genom att de ger ut nya aktier som de säljer till riskvilliga investerare.

För att förmedlingen av riskkapital mellan företag och en bredare skara investerare ska ske så effektivt som möjligt är det ofta fördelaktigt att vända sig till en organiserad marknadsplats för aktier (se kapitel 5 Principer för en finansiell reglering för en utförligare genomgång av aktiemarknadens roll).

Den övervägande delen av handeln i svenska aktier sker fortfarande över Stockholmsbörsen. Vid sidan av handeln på Stockholmsbörsen organiseras aktiehandel även lokalt hos värdepappersinstitut och på några mindre marknadsplatser.

4.2.1. Aktiehandeln på Stockholmsbörsen

I några följande avsnitt görs en genomgång över handelsstruktur, omsättning, börsmedlemmar, emittenter och placerare på Stockholmsbörsen.

Börsmedlemmarna

All handel på Stockholmsbörsen sker genom börsens medlemmar och såväl stora som små investerare måste gå via någon av dessa medlemmar för att få köpa eller sälja aktier. Börsmedlemmarna består dels av svenska värdepappersinstitut, dvs. värdepappersbolag och kreditinstitut med Finansinspektionens tillstånd att bedriva värdepappersrörelse, dels av s.k. fjärrmedlemmar, dvs. utländska företag som bedriver börshandel i Sverige. Stockholmsbörsen har

2

Vanligen gäller principen en aktie/en röst, men avvikelser med differentierade röstvärden

förekommer. Exempelvis kan det i ett aktiebolag finnas A-aktier som ger 10 röster per aktie och B-aktier som endast ger en röst per aktie.

ett sjuttiotal medlemmar i handeln, varav ett fyrtiotal är fjärrmedlemmar.

Börsmedlemmarna har ca 600 auktoriserade mäklare med tillträde till marknadsplatsen knutna till sig.

Tabell 4.1 De 25 mest aktiva medlemmarna på Stockholmsbörsen 2004

*

Börsmedlem Omsättning Miljarder kronor

1 Enskilda Securities AB

681

2 Carnegie Investment Bank AB

581

3 Fischer Partners Fondkommission AB

518

4 Svenska Handelsbanken AB

472

5 Morgan Stanley & Co. International Ltd.

392

6 Hagströmer & Qviberg Fondkommission AB

384

7 Kaupthing Bank Sverige AB

278

8 Nordea Bank AB (publ)

249

9 FöreningsSparbanken AB

241

10 NeoNet Securities AB

236

11 Deutsche Bank AG

233

12 Goldman Sachs International

227

13 Alfred Berg Fondkommission AB

206

14 UBS Limited

195

15 ABG Sundal Collier AB

177

16 E*Trade Sverige AB

169

17 Credit Suisse First Boston (Europe) Ltd

166

18 Citigroup Global Markets Limited

157

19 Öhman J:or Fondkommission AB, E.

153

20 Nordnet Securities Bank AB

117

21 Danske Bank A/S

115

22 Avanza Fondkommission AB

111

23 Lehman Brothers International

101

24 Merrill Lynch International

84

25 Dresdner Kleinwort Wasserstein Sec. Ltd.

68

Summa 1

  • 6

311

Totalt, samtliga 68 börsmedlemmar

6 781

Källa: Stockholmsbörsen AB *) Gäller avistahandeln i aktier på A-, O- och Xterna listan. Omsättningssiffrorna är dubbelräknade, eftersom båda sidorna av en transaktion alltid involverar en börsmedlem.

Handelsstruktur

En stor del av aktiehandeln i Sverige är automatiserad i bemärkelsen att order matchas i Stockholmsbörsens elektroniska handelssystem SAXESS. Systemet består av en centraldator med

anslutna arbetsstationer placerade hos medlemmarna. Mäklaren kan kontinuerligt följa vad som händer på marknaden, t.ex. vilka avslut som görs och vilka order som de andra börsmedlemmarna lägger in.

Efter det att en köpare eller säljare gett en köp- eller säljorder till sitt värdepappersinstitut vidarebefordras ordern till en mäklare och läggs in i en orderbok i handelssystemet. Många av börsmedlemmarna tillhandahåller i dag tjänster för orderläggning via Internet, vilket ofta kan innebära lägre explicita transaktionskostnader (t.ex. courtage) än handel som går via värdepappersbolag och banker.

Ordern kan antingen läggas in i systemet som en s.k. limitorder med högsta köpkurs eller lägsta säljkurs angiven eller som en s.k. marknadsorder där mäklaren får uppdraget att handla till bästa tillgängliga kurs. I orderboken sorteras limitorderna efter pris och tidpunkt. Den högsta köp- och lägsta säljkursen hamnar högst upp i orderboken. Om priset är detsamma för flera order sorteras de in efter den tidpunkt de registrerades i systemet. Hur länge ordern ligger i systemet beror på om det i orderboken finns motsvarande order att göra avslut mot. När en marknadsorder når det automatiska handelssystemet expedieras den i princip i tidsordning direkt mot inlagda limitorder. Innan dess har den dock hanterats av en mäklare, som bedömer när olika delar av den ska läggas in. Man kan något tillspetsat säga att limitorder tillför likviditet medan marknadsorder konsumerar likviditet i handeln.

En avvikelse från tidsordningen gäller när en och samma medlem lagt in både en köporder och en säljorder för samma värdepapper i systemet. I detta fall matchas dessa order först, utan avseende på var i turordningen dessa order befinner sig. Detta gäller såväl limitorder som marknadsorder. Det finns också en rad handelsregler, exempelvis för att hantera order som kan verka störande för handeln, som innebär att de inte nödvändigtvis exekveras. Vidare finns det rutiner som innebär att genomförda avslut som skett i strid med börsens regler kan makuleras.

Efter ett avslut skickas informationen till VPC, där affären avvecklas. Det innebär att aktierna avregistreras från säljarens avstämningskonto och registreras på köparens (om kunden har en depå hos en mäklare registreras transaktionen i stället på depåhållarens förvaltarkonto i VPC). Samtidigt sker betalning via köparens och säljarens banker. Först när detta är gjort är affären slutgiltigt genomförd (vanligen tre dagar efter avslut).

Även om limitorder och marknadsorder är de enda typer av order som förekommer i börsens handelssystem finns det varianter

av hur dessa exekveras. Det är exempelvis inte ovanligt att en kund vill att en större order portioneras ut i systemet i mindre poster, framför allt för att undvika alltför kraftiga förändringar i prisbilden. Det finns då en möjlighet för kundens mäklare att i börsens handelssystem lägga s.k. isbergsorder, där endast en del av den totala orderstorleken (”toppen av isberget”) är synlig för andra aktörer. När en delpost är exekverad läggs automatiskt nästa delpost ut i systemet, och så vidare tills hela ordern är utförd.

Även i ledet mellan kund och mäklare kan det givetvis förekomma andra typer av order än rena limitorder eller marknadsorder. En inte alldeles ovanlig ordetyp är s.k. VWAP-order (Volume Weighted Average Price). I en VWAP-order sker prissättningen gentemot kunden som ett viktat genomsnitt av priserna i samtliga transaktioner under dagen i det aktuella värdepappret.

Emittenter på Stockholmsbörsen

Vid utgången av 2004 var 277 bolag inregistrerade eller noterade på Stockholmsbörsen.

3

De bolag som vill bli noterade på börsen måste

förbinda sig att förse marknaden med information om beslut och händelser som kan ha kurspåverkande effekt. Skälet är att alla som handlar ska ha tillgång till samma information. Kraven på de bolag som söker börsnotering varierar något beroende på vilken av listorna de söker sig till.

Börsbolagen noteras antingen på A-listan eller på O-listan. På Alistan ställs bl.a. krav på dokumenterad vinstintjäning och historik vilket inte gäller för O-listan.

4

Dessutom ska ett bolag på A-listan

ha minst 2 000 aktieägare som vardera äger aktier motsvarande minst en handelspost, som är det antal aktier som motsvarar ca 20 000 kronor, medan ett bolag på O-listan ska ha minst 500 aktieägare som vardera äger aktier motsvarande minst en handelspost, men som här motsvarar ca 10 000 kronor. Beslut om notering

3

I detta avsnitt används begreppet ”noterad” generiskt för både inregistrerade och noterade

börsbolag.

4

För att noteras på O-listan måste emellertid ett bolag som inte har dokumenterad vinst-

intjäningsförmåga i prospektet visa att bolaget har tillräckliga finansiella resurser för att kunna bedriva planerad verksamhet minst under den närmaste tolvmånadersperioden efter första noteringsdag. Vidare ställs på bolag som saknar finansiell historik särskilda krav på den icke-finansiella informationen i prospektet för att investerarna sak kunna göra en välgrundad bedömning av bolaget och dess verksamhet. Detta gäller särskilt om när bolaget räknar med att gå med vinst samt hur bolaget avser att finansiera sin verksamhet fram till dess.

fattas av Stockholmsbörsens bolagskommitté. Vid utgången av 2004 befanns knappt 20 procent av börsbolagen på A-listan och resten på O-listan.

A-listan är indelad i segmenten Mest omsatta och Övriga, medan O-listan delats in i Attract 40 och Övriga. Avgörande för vilket segment ett bolag hamnar i är omfattningen på handeln och bolagets marknadsvärde.

Tillförseln av nytt kapital på börsen kan ske antingen genom nyemissioner, dvs. att befintliga börsbolag ökar aktiekapitalet genom att ge ut nya aktier, eller genom att nya bolag introduceras på börsen. Under 2004 gjordes 27 nyemissioner i befintliga börsbolag till ett sammanlagt värde av ca 7,5 miljarder kronor. Inget riskkapital tillfördes under året via nyintroduktioner.

Placerare på aktiemarknaden

Aktieägandet i Sverige är spritt och omfattande. Det samlade börsvärdet uppgick vid utgången av 2004 till ca 2 700 miljarder kronor. Av detta avsåg 15 procent de svenska hushållens direkta aktieinnehav. De finansiella företagens andel av aktieägandet uppgick vid utgången av 2004 till knappt 29 procent, varav 11 procentenheter utgjordes av fonder. De icke-finansiella företagens andel var knappt 9 procent. Den offentliga sektorns innehav utgjorde drygt 9 procent av den samlade aktieförmögenheten, varav APfondernas innehav utgjorde knappt fyra procentenheter. Drygt en tredjedel av det samlade börsvärdet innehades vid utgången av 2004 av utländska placerare. Icke vinstdrivande organisationers aktieinnehav uppgick till knappt 5 procent av det totala börsvärdet.

Omsättning och marknadsvärde på Stockholmsbörsen

Omsättningen i aktiehandeln på Stockholmsbörsen uppgick till ca 3 390 miljarder kronor under 2004, en ökning med nästan 1 000 miljarder jämfört med föregående år. Den genomsnittliga omsättningen per börsdag uppgick därmed till ca 13,5 miljarder kronor. Runt 27 procent av omsättningen på aktiemarknaden under 2004 skedde i Ericssonaktier.

Tabell 4.2 Nyckeltal för aktiehandeln på Stockholmsbörsen 2004

Marknadsvärde 31/12 2004 2 699 miljarder kronor Omsättning, 2004 3 391 miljarder kronor Genomsnittlig dagsomsättning 13, 5 miljarder kronor Årsomsättning, antal aktier 83 miljarder Antal avslut under året 10 ,5 miljoner Genomsnittligt belopp per avslut 323 645 kronor Genomsnittligt antal avslut per dag 41 907 Stockens omsättningshastighet 1,24

Källa: Stockholmsbörsen.

Diagram 4.1 Aktieomsättning och marknadsvärde på Stockholmsbörsen

1994–2004, miljarder kronor

Källa: Stockholmsbörsen.

Integrationstendenser i börshandeln

Aktiehandeln inom Norden och Baltikum har alltmer kommit att integreras. I dag tillämpas en rad gemensamma regler för börshandeln i Danmark, Estland, Finland, Island, Lettland, Litauen, Norge och Sverige, inom ramen för det s.k. NOREX-samarbetet. Numera tillämpas även samma aktiehandelssystem – SAXESS – på börserna i Helsingfors, Köpenhamn, Oslo, Reykjavik, Riga, Stockholm, Tallinn och Vilnius.

0

1 000 2 000 3 000 4 000 5 000

1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

Aktieomsättning Marknadsvärde

Stockholmsbörsen drivs av OMX Exchanges, som är ett hel- ägt dotterbolag till OMX AB.

5

OMX ägdes vid slutet av 2003 till

62,2 procent av svenska institutioner. Andelen finskt ägande var 8,2 procent. Den totala andelen utländskt ägande var 26,9 procent. Börsverksamheten drivs organisatoriskt i huvudsak inom affärsområdet OMX Nordic Market Places och kommuniceras externt under det gemensamma namnet ”Den Nordiska Börsen”.

OMX äger och driver, förutom Stockholmsbörsen, även börserna i Helsingfors, Köpenhamn, Tallinn, Riga och Vilnius samt värdepapperscentralerna i Estland och Lettland. Den finländska värdepapperscentralen, APK, ägs i dag till 100 procent av VPC AB, som i sin tur ägs till ca 20 procent av OMX AB.

Genom att skapa en integrerad aktiemarknad hoppas man uppnå skalfördelar och synergier samt förbättra likviditeten i aktiehandeln. En effekt av integrationen är att börsmedlemmar och investerare i ökad omfattning får tillgång till nordiska och baltiska värdepapper via en anslutningspunkt till det gemensamma handelssystemet. Harmoniserade regler, öppettider m.m. anses också vara faktorer som gynnar handeln.

Den 30 december 2004 var totalt 509 bolag noterade på de av OMX ägda börserna. Totalt fanns 122 medlemmar, varav 48 var medlemmar på mer än en börs. Den sammanlagda aktieomsättningen på de börser som under 2004 ingick i OMX Exchanges uppgick under året till i genomsnitt 20 miljarder kronor per dag (varav Stockholmsbörsen stod för ca två tredjedelar). Det totala marknadsvärdet för alla noterade bolag på OMX Exchanges uppgick vid slutet av 2004 till ca 4 225 miljarder kronor (varav värdet av bolagen på Stockholmbörsen utgjorde ca 64 procent).

4.2.2. Övriga börser

Utöver Stockholmsbörsen har också Nordic Growth Market (NGM) Finansinspektionens tillstånd att driva börs i Sverige. NGM har specialiserat sig på mindre tillväxtbolag och erbjuder notering och aktiehandel på listorna NGM Official och NGM Equity samt derivathandel på listan Nordic Derivatives Exchange (NDX). På NGM Equity finns ett femtiotal aktier noterade. Under 2004 var omsättningen i handeln ca 1,4 miljarder kronor.

5

Tidigare OM Hex AB. Namnbytet skedde den 31 augusti 2004.

4.2.3. Auktoriserade marknadsplatser

I svensk lagstiftning finns även begreppet auktoriserad marknadsplats. En auktoriserad marknadsplats fungerar i allt väsentligt som en börs, men har inte samma krav på styrelsens sammansättnng och inrättande av disciplinnämnd som en börs och har något mindre långtgående krav i fråga om kursnotering, information och rapportering. För närvarande är det endast AktieTorget AB som driver verksamhet som auktoriserad marknadsplats i Sverige. AktieTorget AB ägs helt av AktieTorget Holding AB, som i sin tur ägs av Stiftelsen Lokal Aktiehandel samt ett antal fysiska personer. På AktieTorget handlas framför allt s.k. tillväxtaktier i mindre bolag. I mars 2005 fanns 33 bolag noterade på AktieTorget. Under 2004 uppgick omsättningen i handeln på AktieTorget till ca 700 miljoner kronor.

4.2.4. Organiserad handel utanför marknadsplatserna

Det sker även inofficiell handel i mindre bolags aktier, som inte är noterade på börs eller auktoriserad marknadsplats. Sådan handel benämns ibland listhandel och organiseras av företag med tillstånd att driva värdepappersrörelse. Den handel som sker på Nya Marknaden är ett exempel på detta. De bolag som handlas på Nya Marknaden är inte noterade på Stockholmsbörsen, men handeln sker, liksom AktieTorgets, via Stockholmsbörsens handelssystem SAXESS. Information om kurser, volymer och orderdjup offentliggörs i realtid genom samma kanaler som för börsaktier. Däremot ansvarar inte Stockholmsbörsen för övervakningen av bolagen på Nya Marknaden. Varje bolag har istället en ”sponsor” som utgörs av någon av Stockholmsbörsens medlemmar, som enligt avtal med Stockholmsbörsen ansvarar för att bolaget uppfyller kraven för att handlas på Nya Marknaden och följer vissa informationskrav. Sponsorerna måste i sin tur ingå avtal med de bolag som de ansvarar för på Nya Marknaden. I dessa avtal specificeras kraven för att handlas på Nya Marknaden, bl.a. i fråga om aktiespridning, marknadsvärde och informationsgivning.

Ett annat exempel på listhandel i onoterade aktier är den handel som sker på Göteborgs OTC-lista

6

.

På Stockholmsbörsen finns även en kurslista för handel med aktier i utländska bolag som inte är noterade på Stockholmsbörsen, den s.k. Xterna listan. Handeln på Xterna listan sker i börsens handelssystem och regelverket för börsens medlemmar tillämpas. Men bolag på Xterna listan tecknar inte något noteringsavtal med Stockholmsbörsen på det sätt som gäller för bolag på börsens A- och O-lista. För att ett bolag ska bli upptaget på Xterna listan krävs bl.a. att en eller flera marknadsgaranter har åtagit sig att svara för en marknad i bolagets aktier. Marknadsgaranterna måste teckna avtal med börsen om innehållet i åtagandet. Bolagets aktier måste avvecklas och kontoföras i VPC i enlighet med VPC:s regelverk och flertalet bolagshändelser som kan inträffa kommer att hanteras av VPC.

För närvarande handlas endast ett bolag (Pfizer Inc.) på Xterna listan.

4.2.5. Handeln med aktierelaterade derivat

Stockholmsbörsen tillhandahåller integrerad handel och clearing av standardiserade optioner och terminer baserade på svenska och vissa utländska aktier. Handeln bedrivs i en gemensam orderbok, i vilken även medlemmar på Oslo Börs respektive EDX London kan delta. Vidare tillhandahåller börsen en OTC-clearing med bl.a. aktiederivatkontrakt som inte är upptagna till handel.

En aktieoption är ett kontrakt där innehavaren har rätten, men inte skyldigheten, att köpa eller sälja en aktie vid en given tidpunkt i framtiden till ett förutbestämt pris. Utfärdaren av optionen har i sin tur skyldigheten men inte rätten att genomföra affären. En aktietermin är ett kontrakt där köpare och säljare förbundit sig att vid en given framtida tidpunkt till ett i förväg fastställt pris köpa respektive sälja en viss aktie.

Förutom derivatkontrakt kopplade till enskilda aktier, handlas på Stockholmsbörsen optioner och terminer som är kopplade till börsens egna aktieindex, s.k. OMX-optioner och OMX-terminer.

6

Göteborgs OTC-lista startades 1995 av Thenberg & Kinde Fondkommission AB med syfte

att hjälpa företag som önskade öka sitt riskkapital eller sprida ägandet. Under åren har ett tjugotal företag varit noterade på Göteborgs OTC-lista och därefter gått vidare till andra listor eller blivit uppköpta. I dag omfattar listan sju företag.

Antalet standardiserade derivatkontrakt relaterade till svenska aktier och OMX-index som omsattes på Stockholmsbörsen under 2004 var total ca 87 miljoner. Största delen (två tredjedelar) avsåg aktieoptioner, 18 procent avsåg OMX-terminer, 10 procent OMXoptioner och 5 procent utgjordes av aktieterminer. Handeln bedrivs i kontrakt om 100 aktier vardera.

Förutom denna handel med standardiserade aktie- och aktieindexderivat sker på Stockholmsbörsen även handel med s.k. warranter. Ordet warrant används i dag på den svenska finansmarknaden för en ganska vildvuxen flora av värdepapper. Warranter liknar i flesta avseenden köpoptioner, dvs. de ger innehavaren rättigheten, men inte skyldigheten, att köpa en underliggande tillgång till ett bestämt pris innan eller vid en bestämd tidpunkt. Warranter kan ges ut med ett stort spektrum av underliggande tillgångar, som inhemska aktier, utländska aktier, inhemska aktieindex, utländska aktieindex, aktiekorgar, valuta, råvaror etc. Utmärkande för warranter är att de i regel har betydligt längre tidshorisont än vanliga optioner – ibland flera år. De utfärdas också av någon annan – oftast en bank eller ett värdepappersbolag – än den som emitterat den underliggande tillgången, vilket skiljer warranten från exempelvis en teckningsoption. Vidare är warranten överlåtbar. Därmed skiljer den sig från de icke överlåtbara kontrakt som upprättas för standardiserade optioner på Stockholmsbörsen (som agerar central motpart i dessa affärer). Motpartsrisken torde därmed vara högre för warranter än för standardoptioner.

Under 2004 uppgick omsättningen i warranter på Stockholmsbörsen till ca 9 miljarder kronor. Dessa var fördelade på ca 315 000 avslut. I slutet av året var 1 491 warranter noterade på Stockholmsbörsen.

Warranter handlas i Sverige även på Nordic Derivatives Exchange (NDX), som drivs av börsen Nordic Growth Market (NGM).

4.3. Räntemarknaden

4.3.1. Inledning

Marknaden i räntebärande instrument avviker på många sätt från marknaden i aktier såväl vad avser aktörer som motiv och handelssätt. Till skillnad mot aktiemarknaden handlas på räntemarknaden

med instrument med en i förväg fastställd avkastning – en ränta. Räntehandeln baseras i hög grad på jämförelser med en räntekurva för riskfri placering i statspapper, vilken sätter en norm för räntan på olika löptider. Detta kan jämföras med aktiehandeln där varje bolag i princip erbjuder unika förutsättningar, varför en aktieplacerare kan komma att göra omplaceringar mellan bolag i samma bransch.

Räntemarknaden brukar ofta delas in i en obligationsmarknad och en penningmarknad. På obligationsmarknaden handlas värdepapper – obligationer – med löptider i regel från ett år och uppåt, medan handeln på penningmarknaden omfattar t.ex. statsskuldväxlar och certifikat, vanligen med löptider om upp till ett år.

Även om aktörerna i stort är desamma (framför allt staten, bostadsinstitut och banker) och utgivningsförfarande samt handelsstruktur är likartade på obligations- och penningmarknaderna, med undantag för det allra kortaste löptidssegmentet, så skiljer sig syftet med handeln på de olika delmarknaderna något. Förenklat kan man säga att obligationsmarknadens huvudsakliga uppgift är att förmedla långsiktigt sparande till aktörer som har behov av kapital. På penningmarknaden är likviditetshantering en framträdande uppgift vid sidan om kort finansiering. På penningmarknadens kortaste avsnitt – med löptider från en dag upp till en vecka – sker bl.a. daglig utjämning av under- och överskott på marknadsaktörernas transaktionskonton. En mycket stor del av omsättningen på räntemarknaden sker i detta kortaste segment och kontraktslösningarna är ofta speciella.

Som komplement till de grundläggande instrumenten på räntemarknaden handlas även derivatinstrument med räntebärande instrument som underliggande tillgång. Dessa derivatinstrument hjälper bl.a. räntemarknadens aktörer att sprida och hantera risker. Med hjälp av derivatinstrumenten kan också aktörerna förändra sina nettopositioner och skapa i stort sett vilka löptider de vill i sina ränteportföljer. På så sätt är investerarna i praktiken inte så beroende av om värdepapperet ursprungligen emitterats med en kort eller lång löptid. Att förklara uppdelningen av räntemarknaden i en obligationsmarknad och en penningmarknad utifrån placerarnas skilda syften i form av likviditetsbehov eller långa placeringshorisonter ska därför ses som en pedagogisk förenkling. I verkligheten kan aktörernas syften på de olika delmarknaderna avvika från denna beskrivning.

4.3.2. Obligationsmarknaden

Räntebärande värdepapper ges ut på obligationsmarknaden där handeln i regel omfattar löptider från ett år och längre. En obligation är ett löpande skuldebrev, vanligtvis bestående av en serie delbetalningar (kuponger) och en slutbetalning. Obligationer ges ut av exempelvis staten, bostadsinstitut, kommuner eller företag och kan enkelt överlåtas mellan innehavare. På obligationsmarknaden sammanförs de aktörer som förvaltar långsiktigt sparande med dem som är i behov av lånekapital.

Obligationsmarknaden kan delas in i en primärmarknad, där nya obligationer ges ut (emitteras), och en sekundärmarknad, där obligationerna köps och säljs vidare. En försäljning på primärmarknaden ger ett betalningsflöde direkt till utfärdaren av obligationen. Utfärdaren av obligationen är således låntagare på marknaden.

De dominerande låntagarna på obligationsmarknaden är staten och bostadsinstituten. Utgivning av obligationer hör ofta samman med ett finansieringsbehov som sträcker sig över lång tid. Placerarna på obligationsmarknaden har ofta också ett intresse av ett mer långsiktigt innehav. Den som köpt en obligation vid emissionstillfället kan även välja att sälja den vidare på sekundärmarknaden. Om sekundärmarknaden fungerar väl skapas god likviditet i handeln, vilket leder till att obligationerna blir mer attraktiva för placerarna. Detta leder i sin tur till minskade upplåningskostnader för emittenterna på primärmarknaden.

Emittenter på obligationsmarknaden

Den största emittenten på obligationsmarknaden är staten. Statens upplåning på obligationsmarknaden via Riksgäldskontoret finansierar underskotten i statsbudgeten. Statsobligationer svarade i slutet av 2004 för knappt hälften av den utestående stocken på obligationsmarknaden, vilket motsvarade ca 770 miljarder kronor. Detta innebar en ökning med 40 miljarder kronor jämfört med utgången av föregående år.

Den näst största gruppen av emittenter är bostadsinstituten. Bostadsinstituten emitterar obligationer främst för att finansiera utlåning till allmänhetens köp av fastigheter. Bostadsinstitutens samlade upplåning hade vid slutet av 2004 ökat med tre miljarder

kronor till 552 miljarder kronor jämfört med utgången av föregående år. Detta kan jämföras med en ökning om ca 60 miljarder kronor mellan slutet av 2002 och slutet av 2003. Bostadsinstitutens upplåning svarade för drygt en tredjedel av den totala utestående stocken på obligationsmarknaden.

Även de icke-finansiella företagen kan genom utgivning av obligationslån skaffa sig kapital. De icke-finansiella företagens upplåning på den svenska obligationsmarknaden svarade vid utgången av 2004 för ca 110 miljarder kronor, vilket var en minskning om knappt tio miljarder kronor jämfört med föregående år. Många företag, främst större börsbolag, vänder sig till internationella företagsobligationsmarknader i euro eller amerikanska dollar för att få tillgång till kapital. I regel används derivatinstrument, främst valutamarknadssvappar, för att omvandla lånet i utländsk valuta till svenska kronor (se vidare avsnitt 4.3.4, Derivatinstrument på valutamarknaden).

Endast ett litet antal kommuner och landsting (åtta kommuner och två landsting) hade vid utgången av 2004 utestående börsnoterade obligationslån i eget namn. Av dessa tio hade Stockholms läns landsting den i särklass största utestående stocken. Bland kommunerna hade Sundsvalls kommun och Södertälje kommun störst utestående stockar. Utöver dessa hade ytterligare 125 kommuner och tre landsting utestående obligationslån i samverkan med Kommuninvest, som är ett kreditmarknadsföretag. Kommunernas upplåning uppgick vid slutet av året till ca 13 miljarder kronor, vilket var en smärre minskning jämfört med utgången av föregående år.

Även banker och ”övriga kreditmarknadsföretag” ökade sin upplåning via obligationsmarknaden under 2004. För bankernas del innebar detta en ökning på drygt 50 procent till 70 miljarder kronor. Upplåningen för övriga kreditmarknadsföretag motsvarade drygt 60 miljarder kronor.

Placerare på den svenska obligationsmarknaden

Bland placerarna på obligationsmarknaden hade kategorin ”utlandet” och försäkringsbolagen de största innehaven i slutet av 2004. Vid utgången av 2004 hade försäkringsbolagen ökat sitt innehav på obligationsmarknaden med ca 60 miljarder kronor i jämförelse med föregående år till drygt 600 miljarder kronor, vilket

motsvarade drygt två femtedelar av totalt utestående belopp. Även utlandet ökade sitt innehav på obligationsmarknaden i slutet av 2004 i jämförelse med föregående år, vilket innebar en ökning med ungefär 70 miljarder kronor till drygt 530 miljarder kronor. Detta motsvarade en tredjedel av det totala utestående beloppet.

Bankernas innehav på obligationsmarknaden minskade med en tredjedel till drygt 130 miljarder kronor vid utgången av 2004 jämfört med innehaven föregående år. Kategorin ”företag och övriga” minskade sitt innehav på obligationsmarknaden till närmare 200 miljarder kronor vid utgången av 2004.

AP-fondernas innehav av svenska obligationer har minskat betydligt över åren, men hade vid utgången av 2004 ökat något jämfört med föregående år. AP-fondernas innehav på obligationsmarknaden motsvarade drygt 130 miljarder kronor.

Emissionsförfarande

På primärmarknaden emitteras statsobligationer som försäljs genom auktioner, där Riksgäldskontorets auktoriserade återförsäljare deltar. Återförsäljare är ett antal banker och värdepappersbolag som Riksgäldskontoret ingått avtal med. I dagsläget används sex eller sju återförsäljare, beroende på vilken form av värdepapper som ska auktioneras ut.

Enligt återförsäljningsavtalen åtar sig återförsäljarna att vara marknadsgaranter (”market makers”). Att vara marknadsgarant innebär ett åtagande om att lämna bud i alla emissioner och att till kunder ställa priser på värdepapper som staten gett ut. Även bostadsinstituten ger ut sina obligationer genom auktoriserade återförsäljare, som består av banker och värdepappersbolag. På primärmarknaden för bostadsobligationer sker dock inget auktionsförfarande utan försäljningen till återförsäljarna sker löpande efter bostadsinstitutens lånebehov, så kallad on tap-försäljning.

Företag har ofta avtal med en eller flera banker om låneprogram inom vilka företagen emitterar obligationer till vissa i förväg bestämda villkor. Som tidigare nämnts emitterar företag även värdepapper utomlands och omvandlar sedan lånen till svenska kronor med hjälp av derivatinstrument. Eftersom omvandlingen till svenska kronor inte beaktas i statistikberäkningen, ger statistiken i praktiken en underskattning av företagens upplåning i svenska kronor.

Vid sidan av de företagsemissioner som riktar sig till en större krets placerare finns en marknad för riktade emissioner (”private placements”). Med dessa avses oftast obligationslån som i sin helhet placeras hos en eller ett fåtal investerare. Villkoren är föremål för förhandlingar och utformningen av emissionen anpassas i stor utsträckning till investerarens önskemål. Det har blivit allt vanligare att företag väljer denna form av obligationsupplåning.

Handelsstruktur

En aktiv sekundärmarknad, dvs. en andrahandsmarknad, i obligationer finns huvudsakligen för stats- och bostadsobligationer, medan företagsobligationer normalt hålls till förfall av placerarna. Statsobligationerna är, som en följd av att de ges ut i stora volymer och har en låg kreditrisk, de värdepapper som har den största omsättningen på obligationsmarknaden.

Marknaden för statsobligationer är till stor del fortfarande en telefonmarknad, även om det förekommer en viss utveckling mot en mer terminalbaserad marknad. I maj 2001 introducerades nämligen en elektronisk plattform för interbankhandel i statsobligationer. För närvarande sker handeln på denna med tre så kallade benchmarkobligationer, vilka är de mest omsatta statsobligationerna med löptider om två, fem respektive tio år. Denna handel sker i Stockholmsbörsens elektroniska system SAXESS. För närvarande är den elektroniska handeln i benchmarkobligationer tillgänglig endast för marknadsgaranter. Det beror på att interbankmarknaden har alltför få aktörer för att garantera likviditet i en rent orderdriven marknad. Likviditeten, i meningen av hur stora volymer som kan avslutas utan att prisbilden förändras, har under det senaste året ökat på denna elektroniska ränteplattform. Än så länge sker dock endast en mindre del av all omsättning på obligationsmarknaden i SAXESS. De flesta affärerna görs dock som sagt alltjämt upp på telefon.

Jämfört med aktiehandeln sker betydligt färre avslut på räntemarknaden, men vanligtvis till avsevärt högre belopp. Eftersom antalet affärer är relativt litet används i stor utsträckning marknadsgaranter, som ställer köp- och säljkurser både i handeln sinsemellan och i handeln med kunder. Handeln mellan marknadsgaranterna brukar kallas ”interbankhandel”, medan övrig handel brukar kallas ”kundhandel”. All kundhandel, även sådan där varken slutlig

köpare eller säljare är en marknadsgarant, sker via en marknadsgarant som motpart. Att marknadsgaranten går in som motpart och alltså utför affären mot eget lager hänger samman med att de fåtaliga avsluten inte möjliggör orderdriven handel. Eftersom marknadsgaranterna hela tiden ställer tvåvägspriser mot varandra blir prisskillnaderna dem emellan obetydliga.

Som stöd för interbankhandeln finns särskilda mäklarhus. I den institutionella räntehandeln är dessa s.k. brokers väletablerade internationella företag. De har enbart institutionella aktörer som kunder och tar inga egna positioner. Interbankaktörerna kan välja att annonsera sina intressen via en broker för att slippa visa dem för sina konkurrenter.

En interbankaktör vet inte vem som finns ”på andra sidan” av en affär, bara att det är en sedan tidigare godkänd motpart. En majoritet av marknadsgaranterna i statsobligationer uppträder också som marknadsgaranter i bostadsobligationer. Eftersom handeln i företagsobligationer inte är så omfattande i Sverige är det ovanligt att både köp- och säljpriser noteras för dessa.

Omsättning på obligationsmarknaden

Omsättningen på obligationsmarknaden ökade något under 2004 i jämförelse med föregående år till i genomsnitt drygt 32 miljarder kronor per dag. Denna ökning kan hänföras till en ökning i den genomsnittliga omsättningen i statsobligationer från 19 miljarder kronor per dag under 2003 till drygt 22 miljarder kronor per dag under 2004. Den genomsnittliga omsättningen i bostadsobligationer uppgick till drygt nio miljarder kronor per dag under 2004 och var därmed oförändrad från föregående år. Av den totala omsättningen i statsobligationer under hela 2004 skedde över 97 procent på sekundärmarknaden. Endast ca 150 miljarder kronor (mindre än tre procent) avsåg primärmarknaden, dvs. i form av nyemissioner.

Vid sidan av den institutionella obligationshandeln sker även viss obligationshandel i mindre skala på SOX, som är en del av Stockholmsbörsen. Här handlas exempelvis privatobligationer utgivna av bostadsinstitut och som främst är riktade till privatpersoner och andra mindre placerare. Omsättningen på SOX uppgick totalt till drygt 4,2 miljarder kronor under 2004. Detta innebar dels en

ökning med en tredjedel från föregående år, dels att de senare årens trend med gradvis minskande omsättning bröts.

Diagram 4.2 Genomsnittlig omsättning per dag på obligationsmarknaden,

1998

  • miljarder kronor

Källa: Riksbanken.

4.3.3. Penningmarknaden

Penningmarknaden är ett samlingsbegrepp för marknader för räntebärande tillgångar som emitteras med löptider i regel upp till ett år.

En viktig uppgift för penningmarknaden är att underlätta likviditetshanteringen i ekonomin. Exempelvis behöver banker ha en beredskap för möjliga in- och utbetalningar i framtiden. Bankerna placerar tillgångar efter sina bedömningar om kommande betalningar, dvs. så att placeringarna enkelt kan omvandlas till likvida medel när betalningarna ska göras.

Tillvägagångssättet vid utgivning av och handel i värdepapper på penningmarknaden är i stort sett detsamma som på obligationsmarknaden. Marknaden för penningmarknadspapper utgör knappt en fjärdedel av det totala värdet av utestående värdepapper på räntemarknaden.

0 10 20 30 40

1998 1999 2000 2001 2002 2003 2004

Statsobligationer

Bostadsobligationer

Emittenter på penningmarknaden

Statens upplåning på penningmarknaden sker via statsskuldväxlar medan övriga institut lånar genom att ge ut certifikat, t.ex. bankcertifikat och bostadscertifikat. En statsskuldväxel är ett löpande skuldebrev som representerar en kortfristig fordran på staten och som kan omsättas på penningmarknaden. Ett certifikat är ett skuldebrev av samma typ som en statsskuldväxel, men emittenten är exempelvis en bank eller ett företag.

De av Riksgäldskontoret utgivna statsskuldväxlarna har en dominerande ställning på penningmarknaden. Mängden utestående statsskuldväxlar minskade marginellt med tre miljarder kronor under 2004 och uppgick vid slutet av året till knappt 270 miljarder kronor, vilket svarade för drygt hälften av den utestående stocken av kortfristiga värdepapper. Riksgäldskontorets utgivning av statsskuldväxlar görs bl.a. för att underlätta hantering av svängningar i statens kortfristiga lånebehov. Riksgäldskontoret har även löpande försäljning av statsskuldväxlar, så kallad on tap-försäljning. On tapväxlar används för kortfristig likviditetshantering (upp till sex veckor), där växelns löptid kan skräddarsys genom att emissionstidpunkt och förfallodatum kan väljas efter Riksgäldskontorets behov.

Även bostadsinstituten minskade sin upplåning på penningmarknaden under 2004 med en tiondel till ca 90 miljarder kronor jämfört med föregående år. Bostadsinstitutens avsikt med kort upplåning är i första hand att nå överensstämmelse med utlåningen till kunder och på så sätt hantera sina ränterisker.

Bankerna och de icke-finansiella företagen ökade sin upplåning under 2004. Bankernas upplåning ökade under 2004 med 2 miljarder kronor till knappt 50 miljarder kronor i slutet av året. Upplåningen för icke-finansiella företag ökade i sin tur med en femtedel till ca 60 miljarder kronor under motsvarande period.

För gruppen ”övriga kreditmarknadsföretag” minskade upplåningen med mer än 50 procent under 2004 till knappt 10 miljarder kronor i slutet av året efter att ha legat relativt konstant under flera år. Kommunernas upplåning uppgick vid utgången av 2004 till drygt 5 miljarder kronor, vilket var i nivå med senare års upplåning.

Den totala utestående stocken av värdepapper på penningmarknaden var ca 480 miljarder kronor vid slutet av 2004, vilket innebar en marginell minskning jämfört med slutet av föregående år.

Placerare på den svenska penningmarknaden

De placerare som har de största innehaven på penningmarknaden är dels kategorin ”företag och övriga”, dels banker. Vid utgången av 2004 förfogade dessa kategorier över ca 30 procent vardera av den utestående stocken av kortfristiga räntepapper. Företag och övriga minskade sina innehav marginellt till ca 140 miljarder kronor medan bankernas placeringar ökade med en tiondel till omkring 150 miljarder kronor jämfört med slutet av föregående år. Försäkringsbolagen minskade sina innehav på penningmarknaden under 2004 med drygt 10 miljarder kronor till knappt 120 miljarder kronor i slutet av året.

Försäkringsbolagen stod fortfarande för drygt en fjärdedel av den totala utestående stocken värdepapper på penningmarknaden.

Kategorin ”utlandet” minskade sitt innehav med tre miljarder kronor till ca 80 miljarder kronor i slutet av 2004, men innehaven motsvarade fortfarande en sjättedel av den totala utestående stocken av värdepapper på penningmarknaden jämfört med 2003.

Vid utgången av 2004 var AP-fondernas penningmarknadsplaceringar i stort sett oförändrade jämfört med föregående år. Innehaven uppgick till blygsamma 2 miljarder kronor (0,4 procent av den totala utestående stocken).

Omsättning på penningmarknaden

Under 2004 omsattes i genomsnitt omkring 12 miljarder kronor per dag i svenska statsskuldväxlar, vilket innebar en ökning om knappt en tiondel jämfört med föregående år. Omsättningen i bostadscertifikat minskade däremot med nästan en tiondel jämfört med föregående år till i genomsnitt drygt 3 miljarder kronor per dag under 2004.

Av den totala omsättningen i statsskuldväxlar under hela 2004 omsattes drygt 2 300 miljarder kronor på sekundärmarknaden och bara 455 miljarder kronor (ca 15 procent) på primärmarknaden, det vill säga i form av nyemissioner, varav en stor del sannolikt utgjorde ersättningar för förfallna växlar.

Totalt sett ökade omsättningen på penningmarknaden något under 2004 jämfört med 2003.

Diagram 4.3 Genomsnittlig omsättning per dag på penningmarknaden,

1998–2004, miljarder kronor

Källa: Riksbanken.

Penningmarknadens kortaste del

När löptiderna på penningmarknaden går ner mot en vecka och kortare blir vanliga värdepapper mindre praktiska. Istället används andra kontraktslösningar, som depositkontrakt, repor och valutamarknadssvappar. Med dessa standardiserade kontraktslösningar behöver aktörerna endast komma överens om löptiden, belopp och räntan på in- eller utlåningen.

Bankerna har transaktionskonton i Riksbankens centrala betalningssystem RIX, som återspeglar deras dagliga in- och utbetalningar till varandra. Penningmarknadens kortaste del är av särskild betydelse för att utjämna bankernas dagliga under- och överskott på dessa transaktionskonton. Sådana under- och överskott uppstår när bankernas framtida in- och utbetalningar inte matchar varandra tidsmässigt och när oförutsedda betalningar uppkommer under dagen. Det är framför allt kunders affärstransaktioner och portföljförvaltares eller andra finansiella aktörers omflyttningar i sina valuta- och värdepappersportföljer som ger upphov till oförutsedda betalningar.

Genom att Riksbanken erbjuder de banker som deltar i RIX att låna eller placera över natten till fördefinierade räntor, kommer dessa räntor alltid att vara ett alternativ till upplåning och place-

0 4 8 12 16

1998 1999 2000 2001 2002 2003 2004

Statsskuldväxlar Bostadscertifikat

ringar i finansiella kontrakt med löptider upp till en vecka. Utgångspunkten för prissättningen på denna delmarknad är således dessa in- och utlåningsräntor samt övriga villkor i Riksbankens räntestyrningssystem. Därmed bestämmer Riksbanken i praktiken förutsättningarna för penningmarknadens kortaste löptidssegment.

Depositkontrakt

Depositkontrakt är standardiserade in- och utlåningsavtal utan krav på underliggande säkerheter och med i förväg bestämda räntor och löptider. De utgör inte finansiella instrument i MiFID:s mening (se avsnitt 7.1). Liksom för exempelvis obligationer och certifikat sätts lånetaket för deposits av bankernas motpartslimiter. Placeringar i depositkontrakt påverkar bankernas balansräkningar och kapitaltäckningskrav beroende på kreditrisken hos den aktör som behöver krediten. Marknadsaktörer använder vanligen inte depositkontakt vid in- och utlåning längre än en vecka på grund av att motpartslimiterna och kapitaltäckningskraven gör kontraktsformen relativt sett dyrare än andra finansiella kontrakt på längre löptider.

Storbankerna uppskattar att ca 90 procent av omsättningen i depositkontrakt avser löptider upp till två dagar. Merparten av depositinlåningen i kronor med löptiden en svensk bankdag sker mellan svenska kreditinstitut. Under perioden december 2001 – augusti 2004 hade kreditinstituten kring månadsskiften en genomsnittlig utestående inlåningsvolym i deposits om ca 130 miljarder kronor.

Repor (”repurchase agreements”)

En repa är ett avtal där den ena parten förbinder sig att sälja ett värdepapper till en motpart i utbyte mot likvida medel. Samtidigt sker det en överenskommelse om att värdepapperet ska köpas tillbaka till ett bestämt pris vid en given tidpunkt i framtiden. Repotransaktionen består således av två delar, dels en försäljning (avista), dels ett avtal om återköp vid en framtida tidpunkt (termin). Det företag som vill skaffa sig likviditet via repor måste i motsats till när deposits utnyttjas ha en egen värdepappersstock som kan belånas. Det innebär också att den finansiella risken för den aktör som lånar ut i en repotransaktion är väsentligt lägre än i

ett depositkontrakt. Den utgörs endast av risken att marknadsvärdet på det repade värdepappret ska falla.

Repoinstrumenten fungerar i stort sett som lån mot säkerhet över repans löptid. Omvänt kan repor fungera som värdepapperslån mot säkerhet i likvida medel. Kombinationer repotransaktioner är också vanligt förekommande.

Omsättningen i repor med underliggande stats- och bostadspapper är mycket stor. Bland Riksbankens primära penningpolitiska motparter uppgick omsättningen till i genomsnitt drygt 123 miljarder kronor per dag under 2004. Detta kan jämföras med den totala omsättningen i statsskuldväxlar och bostadscertifikat som uppgick till ca 15 miljarder kronor per dag under 2004, alltså endast en dryg åttondel av omsättningen i repor. Omsättningen i repor var oförändrad under 2004 i jämförelse med föregående år. Uppskattningsvis omkring 90 procent av repoomsättningen avser löptider upp till en vecka.

SCB:s finansmarknadsstatistik visar att svenska kreditinsti- tuts utestående volymer i repoinlåningen stadigt legat kring 80 miljarder kronor kring månadsskiften under perioden december 2001 – augusti 2004.

En annan typ av instrument som används för att utjämna dagliga under- och överskott är s.k. valutamarknadssvappar (fx swaps). Dessa beskrivs mer ingående i valutamarknadsavsnittet. Omsättningen i valutamarknadssvappar med löptider över natten (O/N) och med löptider fram till nästnästa morgon (T/N) hos Riksbankens primära motparter på valutamarknaden ökade med knappt en tiondel i jämförelse med föregående år till ca 80 miljarder kronor per dag under 2004.

Diagram 4.4 Genomsnittlig omsättning per dag i repor, miljarder kronor

Källa: Riksbanken.

4.3.4. Derivatinstrument på räntemarknaden

På räntemarknaden finns derivatinstrument i olika kontraktsformer: ränteterminer, räntesvappar och ränteoptioner.

En termin är ett kontrakt där parterna förbundit sig att vid en given framtida tidpunkt köpa respektive sälja en finansiell tillgång till ett i förväg fastställt pris (ränta). De mest använda derivatinstrumenten på den svenska räntemarknaden benämns International Money Market Forward Rate Agreements (IMM-FRA). Dessa räntederivat är standardiserade ränteterminer med depositkontrakt som underliggande instrument och med bestämda förfallodagar, så kallade IMM-dagar. Statistiken över omsättningen i IMM-FRA är bristfällig och omfattar enbart den handel som sker över Stockholmsbörsen. Omsättningen i IMM-FRA på Stockholmsbörsen var i genomsnitt 18 miljarder kronor per dag under 2004, vilket innebar en ökning med drygt 6 procent från föregående år. Uppskattningsvis utgör dock detta mindre än hälften av den verkliga omsättningen i IMM-FRA.

Övriga terminskontrakt på den svenska räntemarknaden utgörs av obligationsterminer och statsskuldväxelterminer. Dessa terminskontrakt innebär bindande avtal om köp eller försäljning av stats- eller bostadsobligationer respektive statsskuldväxlar på ett förut-

0 20 40 60 80 100 120 140

1998 1999 2000 2001 2002 2003 2004

bestämt datum i framtiden. Marknaden för obligations- och statsskuldväxelterminer är, i relation till den uppskattade omsättningen i IMM-FRA, inte särskilt stor. Den genomsnittliga omsättningen i obligationsterminer med underliggande statsobligation var ca 7 miljarder kronor per dag under 2004, vilket utgjorde en mindre ökning från föregående år. Omsättningen i obligationsterminer med bostadsobligationer som underliggande instrument var i genomsnitt knappt 2 miljarder per dag under 2004, vilket innebar en smärre minskning från föregående år. Omsättningen i statsskuldväxelterminer har stadigt minskat under de senaste åren och var under 2004 i genomsnitt ca 600 miljoner kronor per dag. Nedgången i omsättningen över åren i statsskuldväxelterminerna kan troligen förklaras av att IMM-FRA gradvis tagit en större marknadsandel.

En annan viktig typ av derivatinstrument på räntemarknaden är svappar. En räntesvapp innebär en överenskommelse mellan två aktörer om att under en bestämd tidsperiod utbyta ränteflöden. Exempelvis kan en aktör välja att betala en fast ränta i utbyte mot en rörlig ränta. Ett svappinstrument fungerar i praktiken som en portfölj med terminskontrakt. Räntesvappar med lång löptid som används i Sverige benämns internationellt IRS (Interest Rate Swap) och innebär byten av ränteflöden under flera år. Räntesvappar med kortare löptid har benämningen STINA (Stockholm TomNext Interbank Average). Ett STINA-kontrakt innebär en överenskommelse om att, under en löptid om högst ett år, erlägga eller erhålla skillnaden mellan en fast avtalad ränta och en över perioden rörlig dagslåneränta. Tyvärr finns ingen löpande statistik över omsättningen i räntesvappar tillgänglig. Men enligt den senaste i raden av undersökningar, som vart tredje år genomförs av BIS (Bank for International Settlements), låg den genomsnittliga omsättningen i svenska räntesvappar på knappt 20 miljarder kronor per dag under 2004.

En option på räntemarknaden utgörs av ett kontrakt där innehavaren har rätten, men inte skyldigheten, att köpa eller sälja ett räntepapper vid en given tidpunkt i framtiden till ett förutbestämt pris. Utfärdaren av optionen har å sin sida skyldigheten men inte rätten att genomföra affären. I Sverige handlas så kallade statsobligationsoptioner, där den underliggande finansiella tillgången utgörs av en statsobligation.

Omsättningen i statsobligationsoptioner har genom åren minskat och uppgick under 2004 till i genomsnitt endast ca 125 mil-

joner kronor per dag, vilket är tämligen blygsamt i relation till omsättningen i de övriga räntederivaten.

Handelsstruktur

Derivatinstrument kan handlas antingen direkt mellan en köpare och en säljare, det vill säga OTC-handel, eller via organiserade börser. På en börs är handeln i derivatinstrument standardiserad med kända förfallodagar och kontraktsstorlekar. Derivatinstrument som handlas OTC kan antingen vara standardiserade eller skräddarsydda utifrån köparens eller säljarens behov. Likviditeten är generellt sett bättre i de börshandlade derivaten. I Sverige handlas enbart OTC-derivat på räntemarknaden och är oftast av det standardiserade slaget. Clearingen av en del av dessa OTCderivat görs av Stockholmsbörsen som därmed går in som motpart gentemot köpare och säljare. Den aktiva handeln i derivatinstrumenten sker på en marknad där ett antal marknadsgaranter fastställer priser per telefon eller elektroniskt.

4.4. Valutamarknaden

4.4.1. Handel med valutor

En annan betydelsefull finansiell marknad är valutamarknaden. Valuta är dock inte ett finansiellt instrument i MiFID:s mening (se avsnitt 7.1). Handeln med svenska kronor i utbyte mot utländsk valuta och omvänt sker bl.a. för att anskaffa likvida medel för köp av varor och tjänster från skilda länder och för att matcha framtida in- och utbetalningar i utländsk valuta.

Det som normalt brukar kallas valutamarknaden är en grossistmarknad, som kännetecknas av ett stort antal aktörer, låga transaktionskostnader och snabb spridning av prisinformation. På valutamarknaden sker handel i valuta genom marknadsgaranter, som vid förfrågan ställer köp- och säljpriser i valuta per telefon eller via elektroniska system. Tendensen går mot en alltmer orderdriven handel genom olika elektroniska plattformar och system. På avistamarknaden sker 85 procent av interbankhandeln i elektroniska system. Merparten av interbankhandeln i kronor avista sker i system som Reuter Dealing 3000, medan de stora valutaparen (EUR/USD, USD/YEN, EUR/YEN och USD/CHF) handlas i

Electronic Broking System (EBS ). Något mindre än 25 procent av kundhandeln i kronor avista sker i elektroniska system. De större bankerna har också ofta egenutvecklade elektroniska plattformar i valutahandeln mot kunder, men använder även så kallade multibankplattformar där flera banker är medlemmar. Bankernas egna plattformar omfattar ofta alla tillgångsslag, medan multibankplattformarna inriktar sig på ett enstaka tillgångsslag (exempelvis valuta).

Likt räntederivaten handlas valutaderivaten i svenska kronor enbart OTC. På avistamarknaden i svenska kronor sker betalning och leverans normalt två bankdagar efter affärsavslutet. På derivatmarknaden sker betalning och leverans vid en på förhand uppgjord leveranstidpunkt någon gång i framtiden.

Av handeln på valutamarknaden består ca två tredjedelar av interbankhandel. Denna handel uppkommer oftast till följd av kundaffärer, där bankerna vill neutralisera sina kundpositioner. Om exempelvis ett svenskt företag behöver euro för att genomföra en betalning i dag, kommer företaget att vända sig till sin bank för att köpa euro mot kronor avista. Banken erbjuder företaget att köpa euro till ett i dag bestämt pris. Samtidigt kommer banken för att neutralisera denna position att köpa euro mot kronor avista hos en annan bank. Denna affär mellan två banker kan i sin tur ge upphov till ytterligare affärer med fler banker involverade.

Det största antalet transaktioner i valuta berör relativt små belopp och genomförs normalt inte på denna grossistmarknad. I stället sker transaktionerna genom att bankerna utnyttjar de transaktionskonton i utländsk valuta som de har i utländska banker, s.k. korrespondentbanker. Med hjälp av dessa konton i utländska banker kan bankerna balansera inkommande och utgående betalningar i olika valutor mellan sig utan att behöva växla valuta på valutamarknaden. Banken har dessutom ofta en kredit på sitt konto i utländsk valuta. Om en bankkund exempelvis i dag önskar växla kronor till dollar för att göra en betalning till en kund i USA kan den svenska banken ge i uppdrag till den amerikanska banken (korrespondentbanken), vari den svenska bankens konto i dollar finns, att genomföra betalningen för den svenska kundens räkning. Den svenska bankens interna växelkurs (kronor mot dollar) bestämmer i sin tur storleken på det belopp i kronor som kunden behöver betala för dollarna. Om den svenska banken samtidigt förväntar sig en inbetalning på sitt dollarkonto i den amerikanska banken i samband med någon annan kundaffär, kan den svenska

banken delvis eller helt neutralisera valutaaffärerna utanför valutamarknaden. Även större företag kan hantera valutor utanför valutamarknaden. Företag med verksamhet i olika länder kan neutralisera inkomster och utgifter i olika valutor internt. Exempelvis kan försäljning i euro utjämnas mot inköp av varor i euro. På så sätt kan företag bl.a. minska behovet av valutasäkring.

När det gäller transaktioner i större belopp och när bankerna behöver minska eller öka mängden utländsk valuta på sina konton i utländsk bank vänder sig bankerna dock normalt till den institutionella valutamarknaden. Därmed kan den största omsättningen i belopp räknat förväntas ske på valutamarknaden.

Prissättningen av valuta bestäms i hög grad på interbankmarknaden, där köp- och säljkurser fortlöpande noteras för olika valutor mot den svenska kronan. De priser som svenska kunder möter är därmed oftast en följd av prissättningen på denna marknad. Differensen (spreaden) mellan köp- och säljkurs påverkas av volatiliteten och omsättningen i respektive valutapar. Eftersom omsättningen i den svenska kronan är relativt låg jämfört med många andra valutor är differensen i köp- och säljkurs mellan svenska kronor och främmande valutor i regel större än mellan de dominerande valutaparen på valutamarknaden.

Handel i valuta sker oftast via någon av de största valutorna. För den svenska kronans del innebär detta att marknadspriset avista på kronor i termer av andra valutor ställs via euro. Det här innebär att prissättningen av kronor mot exempelvis brittiska pund först sker genom kronans pris gentemot euro och därefter via priset på euron gentemot det brittiska pundet. Detta kallas vanligen för ”crosshandel”. Crosshandeln är praktisk eftersom bankerna utan denna skulle behöva prissätta kronor mot alla tänkbara valutor. På väl fungerande marknader har det ingen betydelse vilken valuta prissättningen sker igenom, om transaktionskostnaderna är låga. Det omvända skulle annars innebära arbitragemöjligheter, dvs. riskfria vinstmöjligheter, där aktörerna skulle kunna sälja kronor dyrt mot en valuta och köpa tillbaka kronor billigt via någon annan valuta. I motsats till avistahandeln sker terminshandeln i svenska kronor mot andra valutor inte mot euro utan med amerikanska dollar som central valuta.

4.4.2. Derivatinstrument på valutamarknaden

Derivatinstrumenten har bl.a. till uppgift att sprida och hantera risker och beroende på vilket syfte aktörerna har skiftar valet av derivatinstrument. Derivatinstrument på valutamarknaden utgörs av valutamarknadssvappar (fx swaps), valutasvappar (currency swaps), valutaterminer samt valutaoptioner.

Till de vanligaste kontrakten på valutamarknaden hör valutamarknadssvappar (fx swaps). Dessa är inga renodlade derivatinstrument, utan kan snarare ses som en motsvarighet till penningmarknadens repor (se avsnitt 4.3.3 under rubriken Penningmarknadens kortaste del).

En valutamarknadssvapp innebär en överenskommelse om att köpa en valuta i dag och att sälja tillbaks samma valuta vid ett bestämt tillfälle i framtiden. Svapptransaktionen är således en kombination av en avistatransaktion och en terminstransaktion. Svappkontrakten används bl.a. för likviditetshantering; med hjälp av valutamarknadssvappar kan marknadsaktörer utjämna sina dagliga under och överskott på sina transaktionskonton. Det företag som exempelvis har ett underskott i sina kronbetalningar kan skaffa sig kronor genom att låna utländsk valuta på avistamarknaden, och därefter växla valutan mot kronor. För att undvika valutakursrisk säljer företaget samtidigt valutan mot kronor på terminsmarknaden. Om företaget har ett överskott i kronor som behöver placeras, görs affärerna i motsatt riktning. Valutamarknadssvapparna kan delas in efter löptid: korta svappar med löptider upp till två dagar (short fx swaps) och längre svappar (fx swaps) med löptider över två dagar och upp till (normalt) ett år. Valutamarknadssvappar är centrala instrument för bankerna vid prissättning av ränteskillnader i respektive valutapar. En annan typ av kontrakt som också är en kombination av transaktioner är s.k. valutasvappar (currency swaps). En valutasvapp är valutamarknadens motsvarighet till räntesvappar. Valutasvappen innebär byten av ränteflöden i två valutor, exempelvis svensk ränta mot euroränta samt, i förekommande fall, utbyte av kapitalbelopp (i början och i slutet av perioden). Valutasvappen har normalt en löptid på över ett år.

På valutamarknaden handlas även renodlade derivatinstrument, som terminer och optioner. Termins- och optionsaffärerna på valutamarknaden är uppbyggda på samma sätt som på räntemarknaden, med skillnaden att den underliggande tillgången här representeras av ett valutapar.

Valutaterminer används bl.a. av företag för att säkra sig mot valutaexponering i hanteringen av betalningar till och från utlandet. En valutatermin innebär en förbindelse att köpa/sälja valutan vid en bestämd dag i framtiden oavsett kursutvecklingen på valutan. Valutaoptioner syftar också till att minimera valutarisken i framtida transaktioner, men köparen av en valutaoption kan dock välja om denne vill utnyttja optionen eller växla valutan till aktuell marknadskurs på förfallodagen.

4.4.3. Omsättning

Omsättningen i den svenska kronan är, med tanke på dess ringa utbredning i förhållande till de dominerande valutorna, god. Omsättningen i svenska kronor har också ökat under senare år, samtidigt som omsättningen på de globala valutamarknaderna bedöms ha ökat. Kronan är den åttonde största valutan på de globala valutamarknaderna, men den är marginell i jämförelse med framförvarande valutaslag.

Omsättningen i svenska kronor på valutamarknaden uppgick till i genomsnitt ca 210 miljarder kronor per dag under 2004, vilket i princip var oförändrat från föregående år. Totalt omsattes valutamarknadssvappar för ca 140 miljarder kronor, valutaterminer för knappt 14 miljarder kronor, samt valutaoptioner, som minskade med 75 procent, för ca 8 miljarder kronor. Detta kan jämföras med omsättningen i den renodlade avistahandeln, som uppgick till i genomsnitt ca 50 miljarder kronor per dag under 2004. Avistahandeln i kronor ökade därmed med knappt en tredjedel jämfört med föregående år.

Det finns ingen komplett statistik över omsättningen i valutasvappar för 2004, men enligt den tidigare nämnda BIS-enkäten uppgick den genomsnittliga omsättningen till ca 0,4 miljarder kronor per dag under 2004.

Diagram 4.5 Genomsnittlig omsättning i svenska kronor per dag på

valutamarknaden, 1998–2004, miljarder kronor

Källa: Riksbanken.

4.5. Värdepappersinstituten

4.5.1. Inledning

För att få driva värdepappersrörelse krävs Finansinspektionens tillstånd. Enligt lagen om värdepappersrörelse får tillstånd ges för:

1. handel med finansiella instrument för annans räkning i eget

namn,

2. förmedling av kontakt mellan köpare och säljare av finansiella

instrument eller i annat fall medverkan vid transaktioner avseende sådana instrument,

3. handel med finansiella instrument för egen räkning,

4. förvaltning av någon annans finansiella instrument,

0 50 100 150 200 250

1998 1999 2000 2001 2002 2003 2004

Avista Termin Option Fx swap Short swap

5. garantigivning eller annan medverkan vid emissioner av fond-

papper eller erbjudanden om köp eller försäljning av finansiella instrument som är riktade till en öppen krets.

7

Värdepappersinstitut är samlingsbegreppet för de värdepappersbolag och svenska kreditinstitut, dvs. banker och kreditmarknadsföretag, som har Finansinspektionens tillstånd att driva värdepappersrörelse samt utländska företag som driver värdepappersrörelse från filial här i landet. I januari 2005 hade ca 200 svenska företag Finansinspektionens tillstånd att bedriva värdepappersrörelse. Drygt hälften av dessa var värdepappersbolag, medan de övriga huvudsakligen var bankaktiebolag och sparbanker.

Möjligheten för kreditmarknadsföretag att ansöka om tillstånd för att driva värdepappersrörelse öppnades i samband med införandet av lagen (2004:297) om bank- och finansieringsrörelse. I januari 2005 hade emellertid inget kreditmarknadsföretag utnyttjat denna möjlighet.

Även införandet av lagen (2004:46) om investeringsfonder innebar en viss utvidgning av möjligheten att bedriva värdepappersrörelse. Genom lagen fick fondbolag möjlighet att söka tillstånd att förvalta någon annans finansiella instrument. Fondbolagen hade ditintills inte haft denna möjlighet att vid sidan av fondförvaltning bedriva s.k. diskretionär förvaltning. I januari 2005 var det endast Robur Fonder AB som utnyttjat denna möjlighet.

4.5.2. Svenska värdepappersbolag

Av de 102 värdepappersbolag som var registrerade i januari 2005 var ett tiotal s.k. fullsortimentbolag, dvs. med tillstånd för samtliga ovan angivna investeringstjänster. Dessa bolag är i regel också medlemmar på Stockholmsbörsen. I gruppen av fullsortimentbolag märks kända värdepappersbolag som Alfred Berg, Enskilda Securities, E. Öhman J:or, Erik Penser, Fischer Partners och Hagströmer & Qviberg m.fl.

De övriga värdepappersbolagen, som inte innehar samtliga tillstånd, är ofta tämligen specialiserade på någon eller några verksamheter för vilka det räcker med endast ett eller ett par tillstånd. I den

7

Det är inte ovanligt att tillstånd för denna femte verksamhet delas upp i två delar. Det före-

kommer alltså att tillstånd ges för ”annan medverkan vid emissioner…” men inte för ”garantigivning…”.

här gruppen finns exempelvis ett stort antal mindre kapitalförvaltningsbolag, men även andra specialiteter förekommer. I gruppen av värdepappersbolag som inte innehar samtliga tillstånd är ett knappt tiotal medlemmar på Stockholmsbörsen.

Bland värdepappersbolagen återfinns även 16 kraft- och råvarubolag. Dessa innehar visserligen ofta ett flertal tillstånd, men de skiljer sig från de övriga bolagen genom att vända sig till professionella kunder och inte agera på detaljistmarknaden. De flesta av dem torde omfattas av undantaget i artikel 2.1 i MiFID.

4.5.3. Svenska kreditinstitut

Utöver värdepappersbolagen driver även många banker omfattande värdepappersverksamhet. Av de totalt 29 bankaktiebolag som var inregistrerade i Sverige i januari 2005 hade 26 tillstånd att driva värdepappersrörelse. Tolv av dessa var börsmedlemmar, varav åtta innehade ett fullt sortiment av värdepappersrörelsetillstånd. Här återfinns exempelvis de fyra storbankerna FöreningsSparbanken, Handelsbanken, Nordea och SEB.

Här återfinns även en kategori företag som i grunden endast driver värdepappersrörelse, men som av olika skäl ansökt om och fått banktillstånd. De värdepappersbolag som inte haft någon bank i koncernen har ofta upplevt detta som en begränsning och konkurrensnackdel gentemot banker och har därför valt att söka banktillstånd. I denna kategori återfinns t.ex. Carnegie Investment Bank, EFG Investment Bank, Kaupthing Bank Sverige och Nordnet Securities Bank. För närvarande överväger ytterligare ett antal värdepappersbolag med fullsortimenttillstånd att ansöka om banktillstånd. Därutöver har svenska värdepappersbolag en möjlighet att ansöka om att med vissa begränsningar få ta emot inlåning på konto, vilket är ett svenskt särdrag.

Förutom ovan nämnda värdepappersbolag och bankaktiebolag hade i januari 2005 ett knappt sjuttiotal sparbanker något eller några värdepappersrörelsetillstånd. Vanligen rör det som om tillstånd att förmedla värdepappersaffärer, dvs. att ta emot en kunds order lokalt och ringa in den till någon anknuten fullsortimentbank. Bland de företag som till associationsformen är sparbanker, är Sparbanken Finn ensam om att inneha ett fullt sortiment av värdepappersrörelsetillstånd och är dessutom medlem på Stockholmsbörsen.

4.5.4. Utländska värdepappersföretag och banker med verksamhet i Sverige

En hel del utländska företag bedriver gränsöverskridande värdepappersverksamhet i Sverige med stöd av tillstånd givna av hemlandets myndigheter och efter notifiering till Finansinspektionen. I januari 2005 var inte mindre än 1 066 utländska värdepappersföretag notifierade för gränsöverskridande handel i Sverige. Ett tiotal av dessa är fjärrmedlemmar på Stockholmsbörsen. Bland dessa företag märks bl.a. några av de större, internationella värdepappersföretagen, som JP Morgan Securities, Lehman Brothers International (Europe) UK, Merrill Lynch International och Morgan Stanley & Co International. I gruppen finns även ett antal nordiska värdepappersföretag, som tillika är fjärrmedlemmar på Stockholmsbörsen. Dit hör exempelvis Christiania Securities (Norge) samt FIM Securities och Opstock (Finland). Att få ett samlat grepp om omfattningen på den verksamhet som bedrivs av de över tusen övriga gränsöverskridande utländska värdepappersföretagen förefaller i det närmaste omöjligt.

Antalet utländska banker som var registrerade för gränsöverskridande verksamhet i Sverige var 249 i januari 2005. Hur många av dessa som ägnar sig åt värdepappersverksamhet i Sverige i någon större omfattning är också svårt att få ett grepp om. Ett tiotal av dessa banker är dock tillika fjärrmedlemmar på Stockholmsbörsen. Av dessa känns några igen som större europeiska banker (eller deras Londonbaserade enheter – filialer, dotterbolag eller moderbolag). Hit hör exempelvis ABN AMRO Bank NV London Branch, Commerzbank AG, Credit Suisse First Boston (Europe) Ltd, Deutsche Bank AG samt HSBC Bank Plc. Därutöver återfinns även ett antal nordiska banker, som bedriver handel på Stockholmsbörsen med utgångspunkt från fjärrmedlemskap från sina hemländer. Hit hör Danske Bank och Jyske Bank (Danmark), eQ Bank och Evli Bank (Finland) samt Íslandsbanki (Island).

Det finns även utländska företag som bedriver värdepappersrörelse från filial i Sverige. I januari 2005 hade 13 utländska värdepappersbolag svensk filial. Några av dessa företag deltar i handeln på Stockholmsbörsen, men då inte i första hand via den svenska filialen, utan med utgångspunkt från de fjärrmedlemskap på börsen som företagen har i sina Londonbaserade verksamheter. Till denna kategori hör Citigroup Global Markets Ltd UK, Goldman Sachs International och Lehman Brothers International (Europe).

Det fanns i januari 2005 19 utländska banker med filial i Sverige. Av dessa är det några som är renodlade banker som inte bedriver någon värdepappersrörelse i Sverige eller som gör det endast i begränsad omfattning. Men det finns även sådana som har en tämligen omfattande värdepappershandel. I likhet med värdepappersföretagen sker dessa bankers handel vanligen med utgångspunkt från fjärrmedlemskap från koncernens hemlands- eller Londonbaserade enheter. Till denna senare kategori hör Danske Bank, Deutsche Bank, Evli Bank och UBS Limited.

4.6. Den finansiella elmarknaden

4.6.1. Inledning

Sedan elmarknaden avreglerades i Sverige 1996 har marknaden för fysisk el kommit att kompletteras med en finansiell elmarknad. Den finansiella elmarknaden omfattar handel med elderivat, dvs. derivatinstrument som har el som underliggande tillgång, och s.k. elcertifikat. Elderivat är ett verktyg för de företag som köper och säljer el att prissäkra sina kontrakt och på så sätt minska sina risker. Derivathandeln möjliggör också spekulation i förändringar i elpriser. Elcertifikat är ett energi- och miljöpolitiskt verktyg som införts i Sverige genom lag för att främja produktionen av förnybara energikällor. Såväl den finansiella som den fysiska elmarknaden är i hög grad integrerad mellan de nordiska länderna (utom Island).

4.6.2. Handeln på Nord Pool

Handeln med elderivat och elcertifikat sker på den nordiska marknadsplatsen Nord Pool, som även fungerar som marknadsplats för fysisk el i Norden. Handeln med fysisk el sker på spotmarknaden och handeln med finansiella instrument med el som underliggande vara sker på den finansiella elmarknaden. På Nord Pool handlas även s.k. utsläppsrätter, som är ett miljöpolitiskt instrument för att minska de totala utsläppen av växthusgaser.

Nord Pool är belägen i Oslo och har tillstånd som fullvärdig börs enligt norsk börslagstiftning. Nord Pool ägs till hälften var av Affärsverket Svenska Kraftnät och Statnett SF i Norge och har,

förutom i Oslo, även kontor i Stockholm och Odense, samt representeras i Finland av EL-EX i Helsingfors.

Utgångspunkten för den finansiella elmarknaden är den fysiska elmarknaden. Kraftpriset sätts per timme på Nord Pools spotmarknad. Producenter och konsumenter lägger in sälj- och köpbud för kommande dygn och priset sätts där utbuds- och efterfrågekurvorna möter varandra. Därmed får man ett s.k. systempris vilket fungerar som referenspris för den övriga elmarknaden. Sedan 2006 prissätts de kontrakt som handlas på Nord Pool i euro.

Aktörerna

Aktörerna på Nord Pool är kraftproducenter, distributörer, industriföretag, mäklare och handlare. I dag (april 2006) har Nord Pool 337 medlemmar, varav ett 40-tal utanför de nordiska länderna. En förutsättning för börsmedlemskap på Nord Pool är att man är accepterad av Nord Pool Clearing som clearingmedlem.

Alla svenska företag med Finansinspektionens tillstånd att bedriva värdepappersrörelse har i princip rätt att agera på den finansiella elmarknaden, dvs. för närvarande omkring ett hundratal bolag. I dag finns det emellertid inget svenskt bolag som kontinuerligt eller i mer betydande utsträckning är aktivt på den finansiella elmarknaden som inte också har en mer direkt anknytning till den fysiska elmarknaden. Marknaden domineras helt av aktörer med nära koppling till företag som producerar eller handlar med el och som endast eller huvudsakligen handlar med el-relaterade finansiella instrument. De svenska bolag som är aktiva på den finansiella elmarknaden är för närvarande ett femtontal till antalet.

Det finns heller inga privatpersoner som handlar med elderivat på motsvarande sätt som i den derivathandel som sker med aktier som underliggande tillgång. Den finansiella elmarknaden är således en marknad där endast professionella aktörer agerar.

Typer av finansiella instrument

På Nord Pools finansiella marknad kan aktörer handla i standardiserade finansiella kontrakt med en löptid upp till fyra år. Den totala omsättningen på marknaden uppgick år 2004 till 1 964 TWh.

Elderivat

De elderivat som handlas på Nord Pool är terminer och optioner.

Ett terminskontrakt i el innebär ett åtagande att köpa eller sälja el till ett bestämt pris vid en viss framtida tidpunkt och värdet på terminskontrakten speglar marknadens förväntningar på framtida prisutveckling på avistamarknaden för el. Terminskontrakt kan vara standardiserade ”futures” eller skräddarsydda OTC-kontrakt, ”forwards”. På Nord Pool handlas futures med löptider på normalt ett par månader och forwards med löptider upp till fyra år. Nord Pool erbjuder även en särskild typ av forwardkontrakt, s.k. Contracts for Differences, som gör det möjligt för aktörer att säkra sig mot prisskillnader på el som uppstår mellan olika områden i Norden till följd av begränsningar i överföringskapaciteten mellan olika områden. När överföringskapaciteten inte räcker till för att upprätthålla systempriset i hela området kommer olika marknadspriser att gälla inom olika prisområden. Nord Pools terminsmarknad uppgick under 2004 till 590 TWh. Genom eloptioner kan aktörerna säkra sig mot både pris- och volymrisker. De optioner som handlas på Nord Pool är ”europeiska” optioner, dvs. de kan lösas först på lösendagen. På Nord Pool är optionens underliggande tillgång ett forwardkontrakt.

Avvecklingen av samtliga affärer i elderivat på Nord Pool sker utan fysisk leverans av el.

Även om affärer med eldrivat kan göras för att spekulera i prisförändringar är agerandet på eldrivatmarknaden i första hand ett sätt för företag som handlar med el att säkra de priser man kontrakterat med sina kunder mot de ibland kraftiga fluktuationer som präglar elpriserna. Derivatmarknaden påverkar därigenom det elpris som hushåll och företag betalar.

Elcertifikat

Handel med elcertifikat har funnits i Sverige sedan 2003. Elcertifikat är inte ett derivatinstrument i konventionell mening utan ett energi- och miljöpolitiskt verktyg som införts genom lag för att främja produktionen av förnybara energikällor.

8

För närvarande är

det övergripande politiska målet att produktionen av förnybar el ska stiga med 10 TWh fram till 2010. För leverantörerna och

8

Lagen (2003:113) om elcertifikat.

användarna av el har det därför införts en kvotplikt, dvs. en skyldighet att inneha elcertifikat i förhållande till den egna försäljningen eller förbrukningen av el. Handeln med elcertifikat organiseras sedan våren 2004 av Nord Pool. I dag deltar arton medlemmar i denna handel.

Att elcertifikat kommit att omfattas av legaldefinitionen för finansiella instrument bottnar i att det rör sig om en icke-fysisk tillgång eller rättighet som kan prissättas samt köpas och säljas på en marknad. Priset på elcertifikat påverkas förutom av hydrologiska faktorer i hög grad även av politiska beslut om tilldelning, annullering m.m.

Utsläppsrätter

Som nämnts handlas även utsläppsrätter på Nord Pool. Utsläppsrätter har utvecklats som ett miljöpolitiskt verktyg och upphovet till konstruktionen finns i ett EG-direktiv som antogs mot bakgrund av det s.k. Kyotoprotokollet. Tanken med utsläppsrätter är att på marknadsmässiga grunder skapa incitament för att minska de totala utsläppen av växthusgaser och fördela de utsläpp som kvarstår på ett så rationellt sätt som möjligt. Företag med höga kostnader för att minska utsläppen kan köpa utsläppsrätter från företag med lägre kostnader för att minska utsläpp. Grunden för handeln läggs genom att staten sätter ett tak för hur stora de totala utsläppen får vara under en viss period. Lagen (2004:1199) om handel med utsläppsrätter har varit ikraft sedan den 1 januari 2005.

Utsläppshandeln omfattar än så länge ett begränsat antal industrigrenar, särskilt energianläggningar och vissa tunga industribranscher.

Priset på utsläppsrätter påverkas bland annat av utomhustemperaturen och variationer i bränslepriset. Därutöver har priset påverkats av den generositet vid utdelning av rätterna som präglat vissa politiska beslut inom EU-länderna. Marknaden för utsläppsrätter på senare tid har fått en påtaglig effekt, i uppåtgående riktning, på elpriserna. Mellan januari och till mitten av april 2005 har priset på utsläppsrätter ökat från 6 till 17 euro. Den del av elproduktionen som baseras på fossila bränslen har genom systemet fått ökade kostnader för sina koldioxidutsläpp, vilket i sin tur pressar upp marknadspriset på el.

Eftersom vissa elproduktionsanläggningar genererar stora koldioxidutsläpp kan marknaden för utsläppsrätter påverka såväl den fysiska som den finansiella elmarknaden. Kostnaderna för utsläppsrätter påverkar därmed produktionskostnader och priser för el.

I slutet av april 2005 fanns 43 medlemmar knutna till handeln med utsläppsrätter på Nord Pool. Nord Pool Clearing är motpart i alla transaktioner och garanterar därmed betalning till säljaren och fysisk leverans till köparen. Nord Pool clearar även standardiserade kontrakt som handlas OTC.

4.6.3. Handel utanför Nord Pool

Vid sidan av handeln på Nord Pool omsätts kontrakt på OTCmarknaden. Denna marknad är mäklardriven och sker via telefon eller vid elektroniska marknadsplatser. Vid sidan om OTC-handeln finns även en bilateral marknad. Där omsätts kontrakten direkt mellan aktörer på marknaden, dvs. utanför värdepappersmarknaden. Att handla utanför Nord Pool medför ofta att transaktionskostnaderna blir lägre. Aktörerna tar emellertid en motpartsrisk, något som dock kan elimineras om affären clearas hos Nord Pool, som då tar över den risken. Skälen till att genomföra handel utanför Nord Pool kan vara många, men Nord Pools avgift är sannolikt ett av skälen. Dessutom är det en fördel för aktörer som inte vill visa sina handelsvolymer.

5. Principer för finansiell reglering

5.1. Inledning

Lagstiftning är en oundgänglig del av den infrastruktur som är nödvändig för att en modern ekonomi ska fungera. Utan grundläggande regler om köp och avtal är det svårt att genomföra ekonomiska transaktioner på ett effektivt sätt. De standardiserade företagsformer som erbjuds av associationsrätten spelar också en viktig roll för att minska etableringskostnaderna för nya företag och informationskostnaderna för företagens kunder, leverantörer och finansiärer. Det finns också ett grundläggande skydd för konsumenter samt regler och mekanismer för hur tvister som uppstår i samband med ekonomisk verksamhet ska lösas. Denna grundläggande legala infrastruktur är något som alla har nytta av och som kan sägas vara minst lika betydelsefull för ekonomins förmåga att fungera effektivt som den fysiska infrastrukturen i form av exempelvis vägar, elnät och telenät. För de flesta företagsverksamheter krävs inga särskilda regler utöver detta generella regelverk.

Med den finansiella sektorns företag förhåller det sig emellertid annorlunda. För dessa finns det dessutom ett stort antal speciella regler, som bland annat styr av vem och på vilka villkor som olika typer av finansiella verksamheter får bedrivas och hur tillsynen av verksamheterna ska ske. Särregleringen av finansiella företag har så lång tradition att det nästan verkar överflödigt att fråga sig varför det är så. Handlingsfriheten att på nationell nivå utforma finansiell lagstiftning och reglering är dessutom numera betydligt kringskuren genom de omfattande och detaljerade direktiv på området som antagits i EU och som Sverige har åtagit sig att följa. MiFID är bara ett av många exempel på detta. Trots detta kan det vara värdefullt att reflektera över varför den finansiella sektorn är så speciell att den kräver särreglering utöver exempelvis den generella civilrätten, bolagsrätten och konsumenträtten. Att försöka precisera grunden för och syftet med det finansiella regelverket är

angeläget inte minst för att ge underlag för tolkningar och avvägningar i samband med tillämpningen av det gemensamma regelverket. Dessutom ger det förutsättningar för att kunna skapa välgrundande uppfattningar om hur gemensamma regelverk bör utvecklas och förbättras i framtiden.

I det här avsnittet görs ett försök att utifrån ett principiellt perspektiv klarlägga motiven för och problemen med reglering av den finansiella sektorn, särkilt de delar som berör värdepappersmarknaderna och de tjänster som har ett nära samband med handeln på dessa marknader. För att kunna göra detta är det först viktigt att förstå vilka grundläggande funktioner som fylls av den finansiella sektorn.

5.2. Det finansiella systemets funktioner

Det finansiella systemet brukar sägas fylla tre grundläggande huvuduppgifter i ekonomin: kapitalförmedling, riskhantering och betalningsförmedling.

5.2.1. Kapitalförmedling – omvandling av sparande till finansiering

Behovet av kapitalförmedling kommer av två förhållanden: dels att hushåll behöver jämna ut sin konsumtion över livets olika faser, dels att företag behöver finansiering. Hushåll kan exempelvis behöva låna till investeringar i bostäder och utbildning i unga år och spara till pension och konsumtion på äldre dagar. Samtidigt finns det företagsprojekt som behöver finansiering för att kunna förverkligas och komma samhället till godo med ekonomisk tillväxt och sysselsättning. Genom att knyta samman dem som av olika skäl vill spara, dvs. inte konsumera hela sin aktuella inkomst, med dem som behöver resurser för investeringar av olika slag eller för konsumtion, kan stora effektivitetsvinster uppnås.

I sin mest basala form kan kapitalförmedling exemplifieras av en bank. I stället för att varje sparare enskilt måste leta upp ett investeringsprojekt att bedöma och övervaka, eller att varje enskild företagare måste leta upp, övertyga och förhandla ersättning med potentiella investerare i sitt projekt, kan båda uppnå fördelar av att få hjälp av en specialiserad mellanhand, en bank. Sparare, som vill

jämna ut sin konsumtion över livscykeln, kan sätta in medel på ett konto i banken och ta ut dem (plus ränta) vid ett senare tillfälle. Samtidigt kan banken låna ut pengar till företag och hushåll med investeringsbehov. Banken är i det här fallet specialist på att värdera, övervaka och hantera kreditrisker i de hushåll och företag som den lånar ut till. Man kan säga att banken i det här fallet både möjliggör utnyttjandet av stordriftsfördelar och löser ett problem med asymmetrisk information. Det sistnämnda tar sig uttryck i att det räcker för låntagaren/företagaren att övertyga banken om sin egen eller projektets kreditvärdighet; han behöver inte övertyga varje enskild sparare om denna. På motsvarande sätt behöver inte spararna bedöma varje låntagares kreditvärdighet, det räcker med att vara övertygad om bankens solvens. Den finansiella sektorn – i detta enkla fall i form av en bank – bidrar därmed till att kapitalet styrs till de projekt som är mest produktivt, dvs. en effektivare resursanvändning i ekonomin.

Det kan emellertid finnas ännu effektivare sätt att förmedla kapital än genom en bank. I vissa fall finns förutsättningar att av finansieringstjänster skapa standardiserade finansiella kontrakt – värdepapper – som kan köpas och säljas på en andrahandsmarknad. Genom standardiseringen kan ytterligare effektivitetsvinster vinnas.

Klassiska exempel på framgångsrik ”värdepapperisering” av finansiella tjänster är aktier, obligationer och penningmarknadens instrument. Utgivarna – emittenterna – av obligationer och andra räntebärande instrument kan förenklat sägas motsvara bankernas låntagare. Dessa kan få billigare finansiering av sina projekt än vad de skulle få genom att exempelvis låna i bank, givet att marknadens efterfrågan på deras värdepapper är stor. De risker som är förknippade med att låna ut till expanderande affärsverksamhet gör att företagens kapitalbehov sällan helt kan tillgodoses enbart genom bank- eller obligationslån, i vart fall inte till rimliga kostnader. Åtminstone en del av dessa företags finansieringsbehov kan behöva tillgodoses genom aktiemarknaden. Aktier ger till skillnad mot obligationer och penningmarknadsinstrument inte en fast förräntning utan representerar andelar i ett företag och avkastningen beror på företagets framtida vinster. Eftersom dessa vinster kan variera avsevärt över tiden, tar de som placerar i aktier normalt en högre risk än de som placerar i t.ex. stats- eller bostadsobligationer. Samtidigt kan avkastningen bli betydligt högre.

Förekomsten av en aktiv andrahandsmarknad i värdepapper innebär att den som har kapitalbehov kan vända sig till en bredare grupp av investerare. Standardiseringen innebär att informations- och transaktionskostnader kan hållas nere. En organiserad handel med tydliga regler och en hög grad av standardisering ger förutsättningar för en bra prisbildning på den finansiella tjänsten. När många aktörer följer, analyserar och handlar i de instrument som saluförs på marknaden så blir priserna på dessa mer rättvisande. Detta innebär i sin tur att det blir lättare för investeraren att bedöma värdet på den finansiella tjänsten och därmed fatta mer välgrundade investeringsbeslut. Eftersom den löpande handeln gör det enklare att sälja ut ett innehav minskar även placerarnas risk att bli sittande med en tillgång som plötsligt faller i värde.

En aktiv andrahandsmarknad förbättrar även primärmarknadens funktion. I avsaknad av en andrahandsmarknad vill investeraren ha kompensation för de sämre möjligheterna att avyttra tillgången snabbt och till ett rimligt pris. Kompensationen består i ett lägre emissionspris. För företaget som är i kapitalbehov innebär detta att kapitalkostnaden ökar om det inte finns en aktiv andrahandsmarknad för de värdepapper det ger ut.

En kanske mer subtil effekt av en aktiv andrahandsmarknad i aktier är att den möjliggör uppkomsten av en effektiv marknad för företagskontroll. Om ett företag inte sköts på ett effektivt sätt och det finns utomstående som kan sköta det bättre, ger aktiemarknaden dem en möjlighet att köpa sig kontrollen över företaget. Den som anser sig kunna sköta företaget bättre än den nuvarande ledningen, torde också vara villig att betala mer för företaget än existerande aktieägare; han kan således erbjuda en premie utöver rådande marknadsnotering. Andrahandsmarknader bidrar därmed till att underlätta övertaganden och andra omstruktureringar, som leder till en effektivare resursanvändning i ekonomin.

En viktig biprodukt av en aktiv andrahandsmarknad för värdepapper är att de priser som bildas på en sådan blir bärare av information som annars inte skulle vara tillgänglig. Den information som finns i marknadspriser på värdepapper har tydliga drag av kollektiv nyttighet, dvs. att priserna innehåller information som är till nytta även för andra än för dem som är direkt inblandade i transaktionen. Bland annat underlättar de jämförelser mellan tänkbara investeringar, de underlättar för företag att bedöma sina kapitalkostnader, de gör det möjligt att snabbt utvärdera hur väl emittenter av olika värdepapper sköter sina verksamheter.

All den information som bärs av marknadspriserna på värdepapper har således ett betydande värde för att rationella beslut ska kunna tas i ekonomin, även i fråga om realekonomiska investeringar. Detta har i sin tur stor betydelse för tillväxten i ekonomin.

Alla finansiella tjänster lämpar sig emellertid inte lika väl för att göras om till standardiserade kontrakt som kan handlas på en marknad. Exempelvis kräver lån till privatpersoner och småföretag ofta en betydande insyn i låntagarens ekonomiska förhållanden och en löpande övervakning som gör att sådana kontrakt inte lätt kan standardiseras. Även om det på senare år blivit allt vanligare att banker värdepapperiserar delar av sina låneportföljer, spelar de en viktig roll för att lösa problem med asymmetrisk information av detta slag. Det är också därför som finansiella marknader inte helt kan ersätta banker och andra intermediärer. I stället kompletterar intermediärer och organiserade marknader varandra.

Handeln på värdepappersmarknaden har dessutom gett upphov till efterfrågan på en rad relaterade tjänster som vanligtvis tillhandahålls av mer eller mindre specialiserade intermediärer, t.ex. värdepappersbolag, som kan erbjuda exempelvis rådgivningstjänster och mäklartjänster samt fondbolag, som hjälper hushållen att förvalta sitt sparande.

Mäklartjänsterna på värdepappersmarknaderna kan vara av lite olika art. En viktig uppgift är att hjälpa till vid och garantera emissioner av nya värdepapper på marknaden. Sådant bistånd vid emissioner spelar en stor roll för att investerare ska våga investera i nyutgivna värdepapper. Denna verksamhet bidrar alltså till att minska problem med asymmetrisk information. En annan viktig uppgift utförs av marknadsgaranter, s.k. market makers, dvs. mäklare som erbjuder sig att hela tiden ställa priser i något finansiellt instrument, så att detta hela tiden kan köpas och säljas till bestämda kurser. Denna funktion är mycket betydelsefull för att säker- ställa likviditeten på värdepappersmarknaden. Bland övriga mäklartjänster brukar man skilja på brokerverksamhet, som består av att enbart föra samman köpare och säljare, och dealerverksamhet, dvs. handel för egen räkning. När en mäklare bedriver handel för kunders räkning i eget namn, kallas detta för kommissionsverksamhet. Genom att genomföra analyser av företag och marknader och genom att bedriva handel, både för egen räkning och för kunders räkning, bidrar mäklarna till prisbildningen på värdepappersmarknaderna.

Även rådgivningstjänster har kommit att spela en allt viktigare roll i takt med att finansiella tjänster blivit mer komplicerade. Det kan i dag vara mycket informationskrävande att sköta ekonomin på bästa sätt, varför många hushåll och småföretag efterfrågar rådgivning i finansiella frågor. Rådgivarna måste inte bara vara väl insatta i värdepappersmarknaderna och det regelsystem som styr dessa, de måste också vara informerade om sina kunders finansiella situation. Man kan säga att de därmed bidrar till effektivare kapitalallokering och bidrar till att avhjälpa problem med asymmetriskt fördelad information.

5.2.2. Riskhantering

Förutom behovet att kanalisera sparande till investeringar har företag och hushåll även behov av att gardera sig mot olika slags risker. När det gäller riskhantering tänker vi kanske först på försäkringsbolagens verksamheter. Privatpersoner kan exempelvis behöva försäkra sig mot villabrand eller stöld. Detta kan de göra med hjälp av sakförsäkringsbolagens produkter. De kan också behöva säkra sin försörjning om de skulle råka bli äldre än genomsnittet, alternativt trygga sina efterlevandes ekonomi om de skulle dö i förtid. Detta gör de t.ex. genom att teckna liv- och pensionsförsäkringar hos livbolagen. Försäkringsbolagen är finansiella intermediärer som är specialiserade på att bedöma och hantera försäkringsrisker.

Men den finansiella sektorn bidrar till riskhanteringen i ekonomin även i en vidare mening än att bara tillhandahålla traditionella försäkringstjänster. De finansiella marknaderna erbjuder en rad möjligheter att sprida risker, att diversifiera risker och att omfördela risker mellan individer med olika tillgång till kapital och med olika riskpreferenser.

Riskspridning

En viktig anledning till förekomsten av exempelvis en aktiemarknad, är att den gör det lättare att dela risken för en investering mellan fler personer. Ju fler personer som går samman och bidrar till att finansiera projektet, desto mindre risk behöver var och en av finansiärerna bära. Aktiebolagsformen möjliggör riskspridning så

att en person kan genomföra en affärsidé med begränsad egen insats.

Riskdiversifiering

Den risk som möts av en investerare i ett värdepapper kan dels vara specifik för företaget som emitterat värdepappret, dels systematisk, dvs. gemensam för hela marknaden eller den bransch som företaget verkar i. Den företagsspecifika risken består i att företaget oväntat ska börja gå med förlust utan att samma sak inträffar i andra företag. Denna företagsspecifika risk kan undvikas genom diversifiering. Risken finns kvar på företagsnivå, men en enskild placerare kan komma undan den genom att köpa värdepapper i ett antal olika företag. Placeraren kan därmed uppnå samma förväntade avkastning på investeringen som en lika stor investering i ett enda företags värdepapper, men till avsevärt reducerad risk. Förutsatt att det finns likvida och välfungerande värdepappersmarknader, är kostnaden för denna diversifiering närmast försumbar.

Riskomfördelning

Den systematiska delen av risken, dvs. den variation i företagets avkastningar som beror på att hela marknaden rör sig, går inte att eliminera med riskspridning. De finansiella marknaderna erbjuder då möjligheten att mot betalning överföra risken på någon annan, som av något skäl har bättre förutsättningar att bära den. Derivatinstrument av olika slag, som optioner, terminer och svappar, spelar en viktig roll för möjligheten att omfördela risker. Exempelvis kan ett skogsföretag eliminera den valutarisk det löper på sina förväntade försäljningsintäkter genom att ingå ett terminskontrakt som fastställer i dag till vilken kurs de kommande intäkterna i utländsk valuta ska kunna växlas till kronor. Väl fungerande derivatmarknader är alltså en viktig förutsättning för att riskomfördelning ska kunna ske på ett effektivt sätt. Den samhällsekonomiska vinsten av effektiv riskomfördelning är inte att den totala risken i ekonomin blir mindre, men att riskerna fördelas på ett sätt som gör det möjligt att uppnå bättre allokerade investeringar och därmed högre produktivitet och ekonomisk tillväxt.

5.2.3. Betalningsförmedling

Vid sidan av att förmedla kapital och hantera risker skapar de finansiella företagen förutsättningar för en effektivare förmedling av betalningar i ekonomin. Betalkort, kreditkort och kontoöverföringar är numera vanliga, vilket gör att varor och tjänster kan utbytas på ett smidigt och ekonomiskt effektivt sätt. Genom att ta emot medel på konto avsedda för framtida transaktioner spelar banker en viktig roll för att dessa betalningsmedel ska kunna användas. Ett annat sätt att tillhandahålla effektiva betalningstjänster är att bevilja kredit och betalningsanstånd vid utförande av betalningstransaktioner. En mängd transaktioner kan därmed effektueras utan att betalningsmedel i form av kontanter behöver komma till användning. Bankernas kontosystem utgör därför en viktig del av betalningsväsendet. En förutsättning för ett effektivt betalningsväsende är att det finns väl fungerande rutiner för clearing och avveckling av betalningstjänster. Det finns en stark koppling mellan värdepappersmarknaderna och betalningsväsendet, eftersom de stora betalningsflöden som genereras i handeln i olika finansiella instrument, svarar för en betydande del av det samlade flödet i det kommunikationsnät och de fordringsrättsliga kedjor mellan banker, clearingorganisationer och centralbanker som betalningsväsendet utgör. Alla de marknadsplatser, clearingorganisationer, institut, betalningsinstrument och tekniska och administrativa system som används för betalningar och värdepappersöverföringar brukar sägas utgöra den finansiella infrastrukturen. En effektiv och stabil finansiell infrastruktur är en förutsättning för att ekonomiska transaktioner ska kunna ske smidigt och därmed för att ekonomin som helhet ska fungera på ett effektivt sätt.

5.3. Motiv för reglering

5.3.1. Inledning

Ett övergripande samhällsekonomiskt intresse är att uppnå en effektiv allokering av resurser i ekonomin, dvs. styra resurser till de projekt och användningsområden där de är mest produktiva och gör störst nytta. De samhällsekonomiskt mest effektiva lösningarna framträder i regel på välfungerande marknader som präglas av god konkurrens och som verkar under ett minimum av statliga regleringar och ingripanden. Att behov av statliga ingripanden trots

detta uppstår beror på att en marknad av olika skäl kan präglas av mer eller mindre allvarliga imperfektioner eller misslyckanden, som gör att den inte förmår att allokera kapitalet på ett samhällsekonomiskt effektivt sätt. Utan att ett sådant marknadsmisslyckande identifierats saknas tydliga motiv för särreglering.

Det huvudsakliga marknadsmisslyckande som brukar motivera särreglering av den finansiella sektorn är förekomsten externa effekter. Negativa externa effekter föreligger när beslut fattade av enskilda aktörer medför kostnader för andra, utan att den som fattar beslutet har motiv att ta hänsyn till dessa. Det klassiska exemplet på marknadsmisslyckande till följd av negativa externa effekter är när en fabrik, samtidigt som den producerar varor, även producerar luftföroreningar som drabbar omgivningen. Det uppstår med andra ord en samhällsekonomisk kostnad, som fabrikanten i det här fallet inte tagit hänsyn till, vilket motiverar samhället att gripa in med reglering av utsläppen.

En annan brist som brukar anföras som argument för särskilda regleringar och andra offentliga ingrepp i samband med finansiella tjänster är förekomsten av informationsproblem. Informationsproblem hänger i hög grad samman med att olika aktörer på de finansiella marknaderna har olika tillgång till information, vilket brukar betecknas som att informationen är asymmetriskt fördelad. Konsumenter av finansiella tjänster har exempelvis ofta ett betydande informationsunderläge gentemot dem som tillhandahåller de finansiella tjänsterna. Finansiella produkter är ofta komplexa och kan innehålla risker som är svåra att förstå.

Det är dock viktigt att framhålla att enbart förekomsten av informationsasymmetrier inte är ett tillräckligt villkor för reglering. Att det finns skillnader i information är i själva verket en viktig drivkraft bakom finansiell handel. Värdepappersmarknaderna spelar en viktig roll genom att suga upp information från många olika aktörer och att omvandla denna till så rättvisande marknadspriser som möjligt. Informationen i denna destillerade form är ytterst värdefull för förmågan att fatta rationella ekonomiska beslut och är därför viktig för resursallokeringen i ekonomin. Många mer specialiserade finansiella verksamheter syftar i grunden just till att hantera informationsasymmetrier. Ovan har nämnts bankernas och emissionsgaranternas roll när det gäller att överbrygga det informationsgap som finns mellan låntagaren/emittenten och spararen/investeraren. Det går alltså inte att hävda att asymmetrisk information generellt motiverar reglering. Man måste se närmare på

informationsproblemens karaktär och de brister i marknadens funktion som gör att den inte förmår överbrygga dessa.

Kombinationen av externa effekter och informationsproblem i den finansiella sektorn brukar främst motivera reglering utifrån tre samhällsintressen: systemskyddsintresset, konsumentskyddsintresset och effektivitetsintresset.

5.3.2. Systemskyddsintresset

Det tydligaste motivet bakom reglering av den finansiella sektorn i allmänhet är systemskyddsintresset. Detta hänger samman med att vissa verksamheter i den finansiella sektorn är förknippade med betydande systemrisk. Systemrisk är risken för att det ska uppstå en allvarligare störning i någon del av finansiella systemet som med ett eventuellt självförstärkande krisförlopp fortplantar sig till övriga delar av systemet så att någon av dess grundläggande funktioner hotas. En sådan systemkris, som leder till ett sammanbrott av någon det finansiella systemets vitala funktioner, kan vara ytterst kostsam för samhället och ha betydande och långvariga återverkningar i resten av ekonomin. Farhågor för sådana systemkriser är mycket speciella för den finansiella sektorn och har få direkta motsvarigheter inom andra samhällsområden. Detta hänger samman med två förhållanden: dels att vissa funktioner i det finansiella systemet är särskilt känsliga för störningar och har inneboende tendenser till smittoeffekter, dvs. att störningar som uppstår i ett institut lätt fortplantar sig till andra institut, dels att smittoeffekterna skapar kostnader för samhället som är för stora för att bäras av en enskild aktör, det föreligger med andra ord negativa externa effekter.

De mest bekymmersamma – och mest välanalyserade – systemriskerna hittar vi i banksektorn, och berör framför allt de största bankernas roll i betalningssystemet. Det klassiska exemplet på systemrisk föreligger när finansiella problem i en bank leder till en uttagsanstormning (”bank run”) som i sin tur underminerar förtroendet för hela banksystemet. På ett dominoliknande sätt kan alltså problem (eller enbart misstanken om problem) som ursprungligen berör endast en bank leda till att hela banksystemet kollapsar, varvid framför allt betalningsförmedlingsfunktionen, men även till viss del kapitalförmedlingsfunktionen i ekonomin riskerar kollaps. Se exempelvis Banklagskommitténs betänkande

(SOU 1998:160) för en utförligare redogörelse för systemriskerna i banksektorn.

De systemrisker som är förknippade med värdepappershandeln är sannolikt något mindre allvarliga än de som berör banksektorn, men ökar i betydelse i takt med att värdepappersmarknadernas betydelse ökar. Systemriskerna på värdepappersmarknaderna härrör dels från dessa marknaders betydelse för clearing- och avvecklingsfunktionerna, dels från bankernas behov av likviditet på värdepappersmarknaderna. Det finns alltså en indirekt koppling mellan systemriskerna i värdepappershandeln och de systemrisker som berördes ovan i förhållande till banksektorn.

Värdepappershandeln är förknippad med en speciell form av externa effekter, nämligen nätverkseffekter (ibland även kallade ”nätverksexternaliteter”). I takt med att fler handlare får tillgång till en viss marknad eller ett visst handelssystem, ökar nyttan för alla som deltar på marknaden eller i handelssystemet. Aktörer som handlar i systemet kommer inte i sina egna företagsekonomiska kalkyler att ta i beaktande den nytta av ökad likviditet som påförs övriga aktörer i systemet. Det finns med andra ord positiva externa effekter förknippade med likviditet. En följd av detta är att ett gott orderflöde i ett system lockar till sig ytterligare orderflöden; likviditet attraherar likviditet.

Myntet har dock en baksida. Om likviditeten av någon anledning sjunker i någon del av marknaden, finns risken att likviditeten mycket snabbt dras undan från marknaden som helhet. Det finns alltså en betydande risk att marknaden torkar ut på ett mycket drastiskt sätt om det uppstår en kris i någon del av marknaden. Detta var i stort vad som hände vid börskraschen 1987. När likviditeten behövs som bäst, finns alltså risk att den blir som svårast att finna.

Banker blir allt mer beroende av värdepappersmarknaderna, både för sin finansiering och för sin riskhantering. Den andel av de svenska bankernas utlåning som måstes finansieras via marknadsupplåning ligger sedan mitten av 1990-talet kring ca 50 procent, jämfört med ca 30 procent under 1970-talet.

1

Detta ökade mark-

nadsberoende innebär att störningar som leder till likviditetsproblem på värdepappersmarknaderna kan få allt allvarligare kon-

1

Förändringen inleddes i början av 1980-talet då avregleringen av finansmarknaden ledde till

att utlåningen, framförallt till hushållssektorn, började växa betydligt snabbare än inlåningen. En ytterligare förklaring till inlåningens långsammare tillväxt var att konkurrensen om hushållens sparande från andra sparformer ökade under denna period, i takt med att aktie- och fondsparandet slog igenom på bred front.

sekvenser för bankernas förmåga att refinansiera sig. Hur allvarlig en likviditetskris på värdepappersmarknaderna är för en enskild bank beror i stor utsträckning på vilka finansieringsalternativ den har. Om finansieringsmöjligheterna utanför värdepappersmarknaden är få, ökar sårbarheten. Känsligheten ökar också i takt med att bankerna blir allt aktivare i sina värdepappersrelaterade verksamheter. En försäljning av tillgångar för att täcka ett akut finansieringsbehov kan dels ha drastiskt negativa effekter på värdet av andra tillgångar, dels försvåras av en allmän likviditetskris. En likviditetskris kan alltså påverka banksystemet som helhet antingen genom att drabba alla banker på bred front, eller genom att smitta sprids från en bank till en annan. Risken för smittoeffekter förstärks också genom det ökade ömsesidiga beroendet mellan olika värdepappersmarknader. Bankernas ökade beroende av likviditet på värdepappersmarknaderna i kombination med de externa effekter som gör att likviditeten snabbt kan försvinna utgör en systemrisk som inte bör nonchaleras.

En annan källa till systemrisker i värdepappershandeln är kopplingen till clearing och avveckling av finansiella transaktioner. Om exempelvis en säljare av ett värdepapper av någon anledning inte kan leverera enligt avtal, kan detta leda till leveransproblem även i andra transaktioner. När leveransproblemen drabbar alla säljarens motparter kan det alltså uppstå dominoeffekter som hotar stabiliteten i avvecklingssystemet som helhet. De nettningsförfaranden som brukar användas i de flesta avvecklingssystem innebär att behovet av säkerheter (panter) minskar och därmed också kostnaderna för transaktionerna. Samtidigt innebär nettningen att många transaktioner blir beroende av varandra för att kunna genomföras, varför problem med att leverera ett värdepapper kan fortplantas i systemet på ett potentiellt förödande sätt. Värdepappersavvecklingen är i hög grad integrerad med betalningssystemet och den övervägande delen av det dagliga flödet i betalningssystemet härrör från värdepappersmarknaderna. Därför kan störningar i värdepappersavvecklingen påverka stabiliteten i betalningssystemet som helhet.

Clearing- och avvecklingsorganisationer är också i ökande grad integrerade med de organiserade värdepappersmarknaderna. Liksom värdepappershandeln kännetecknas clearing och avveckling av betydande skalfördelar och har många egenskaper som påminner om naturliga monopol. På nationell nivå finns ofta en betydande koncentration av dessa verksamheter. Integrationen och det bättre

utnyttjandet av skalfördelar effektiviserar funktionaliteten i riskhantering och betalningsväsende. Samtidigt leder koncentrationen till större känslighet för operativa störningar och ökat beroende av allt färre systemleverantörer. Det ökade behovet av att kontrollera de operativa riskerna kräver i sin tur stora kostnader, vilket snarast förstärker koncentrationstendenserna. Risken för spridningseffekter om någon part i avvecklingssystemet får problem samt risken för operativa störningar är alltså källor till systemrisker. En enskild aktör är inte villig att ensam ta på sig de samhälleliga kostnader som följer av dessa risker. Det finns således negativa externa effekter.

Policyimplikationerna av systemriskerna i värdepappershandeln kan vara av lite olika art. När det gäller de systemrisker som är förknippade med marknadslikviditet förefaller exempelvis direkt lagstiftning vara ett mindre användbart medel. Likviditeten i marknaden kan knappast ökas med tvångsmedel. Införandet av benchmarkobligationer på vissa marknader är exempel på statliga ingrepp som syftar till att höja likviditeten. Syftet med detta är dock snarare att förbättra marknadseffektiviteten än att minska systemriskerna. Möjligen ger de systemrisker som är förknippade med marknadslikviditet argument för att, analogt med centralbankers lender-oflast-resort-funktion i banksystemet, införa en market-maker-oflast-resort-funktion för att förhindra en total kollaps när värdepappersmarknaden utsätts för stora påfrestningar. En sådan diskussion faller dock långt utanför utredningens uppdrag.

De systemrisker som härrör från värdepappershandelns roll i clearing och avveckling kan som sagt vara betydande. Dessa härrör i sin tur dels från de kedjeeffekter som kan uppstå i samband med avvecklingsproblem, dels från de operativa risker som finns i de alltmer koncentrerade och integrerade systemen. Systemriskerna motiverar i första hand reglering och tillsyn som inriktas på stabiliteten hos de företag som verkar i dessa avvecklings- och betalningssystem (”prudential regulation and supervision”). Sådan stabilitetsreglering och -tillsyn handlar framför allt om att se till att dessa företag har organisation, kapitalstyrka och system för riskhantering som gör dem motståndskraftiga mot problem av dessa slag. Det finns också andra sätt att minska riskerna i betalnings- och avvecklingssystemen. I betalningssystemet tillhandahåller exempelvis Riksbanken faciliteter för tillfälliga krediter. Man kan hypotetiskt föreställa sig att det skapas liknande arrangemang i värdepappersledet för särskilda värdepapperslån.

5.3.3. Konsumentskyddsintresset

Vid sidan av systemskyddsmotivet brukar ofta konsumentskyddsintresset anges som ett viktigt motiv för särreglering av den finansiella sektorn. Behovet av särskilt konsumentskydd på det finansiella området brukar härledas ur huvudsakligen två förhållanden, dels att finansiella tjänster spelar en så betydande roll i individuella hushålls ekonomi, dels förekomsten av olika informationsproblem. Som redan framhållits har konsumenter ofta ett betydande informationsunderläge gentemot dem som tillhandahåller de finansiella tjänsterna. Vidare är finansiella produkter ofta komplexa och kan innehålla risker som är svåra att förstå.

Skyddet av kunderna på de finansiella marknaderna har också viss relevans för systemrisker och effektivitet. Om investerare inte känner sig trygga i förvissningen om ett rimligt kundskydd, finns det risk att de flyr marknaderna, vilket kan få negativa återverkningar för såväl stabiliteten som effektiviteten in i det finansiella systemet.

I diskussionen av behovet av konsumentskydd på det finansiella området kan man ibland få intrycket att det räcker med att information är asymmetriskt fördelad mellan tillhandahållaren av den finansiella tjänsten och kunden för att detta i sig ska motivera någon form av reglering. Som redan angetts spelar finansiella företag emellertid ofta en viktig roll för att hantera just förekomsten av asymmetrisk information. För att bedöma behovet av konsumentskydd, måste man se närmare på de specifika informationsproblemens karaktär och också undersöka de eventuella bristerna i marknadens förmåga att hantera dessa informationsproblem. Rena marknadsmisslyckanden som motiverar konsumentskydd kan ofta vara svåra att påvisa.

Att finansiella tjänster, inte minst de tjänster som tillhandahålls via värdepappersmarknaderna, har kommit att spela en allt mer betydande roll i individuella hushålls ekonomi, hänger bland annat samman med den demografiska utvecklingen och behovet av kompletterande privat pensionssparande, men också av ett ökat utbud av sparformer som tjänar som alternativ till traditionellt banksparande. Sett på längre sikt är den mest spektakulära demografiska trenden att vi lever allt längre. 1950 var 10 procent av befolkningen 65 år eller äldre. I dag är den andelen 17 procent och 2035 kommer det att vara 23 procent, enligt SCB:s prognoser. Sparandet i ekonomin behöver anpassas för att klara försörjningen

av den växande andelen pensionärer. De kollektiva socialförsäkringssystemen genomgår för närvarande en utveckling som understryker behovet av privat kompletteringssparande. Det finns en viss osäkerhet om vilka förväntningar och behov som välfärdstaten ska och kan uppfylla. Den ursprungliga delegeringen av sparandet från individen till samhället har även på andra sätt delegerats tillbaka till individen. Exempelvis har det inom ramen för delar av pensionssystemet introducerats individuella val som gör individen ansvarig för sparandets förvaltning. Det här gäller såväl tjänstepensioner som det statliga pensionssystemet.

Dessa förändringar stimulerar efterfrågan på sparande och kanaliserar också delar av det tidigare kollektiva sparandet till sparandemarknaden, framför allt till ett växande utbud av olika former av fond- och pensionssparande. Utvecklingen har hittills inneburit ett stort inflöde av kapital till värdepappersmarknaderna. Hushållen har därmed blivit allt mer beroende av utvecklingen på dessa marknader. I takt med att utvecklingen på värdepappersmarknaderna försämrats något på senare år, har också effektiviteten och integriteten hos många av de intermediärer som tillhandahåller viktiga finansiella tjänster, som tillgångsförvaltning, rådgivning och mäklartjänster, kommit allt mer i fokus.

För konsumenternas del är det grundläggande problemet med det ökade beroendet av värdepappersrelaterade sparformer framför allt att de medel som sätts in i dessa sparformer inte blir tillgängliga förrän kanske mycket långt in i framtiden, då det är för sent att byta sparstrategi. Utan reglering skulle spararen kunna förlora hela det sparade beloppet om förvaltaren gick i konkurs. Om samhället dessutom förväntas garantera att dess medborgare uppnår en viss minimilevnadsstandard, finns det risk för att förvaltarna av sparmedlen blir mer riskbenägna, dvs. mindre försiktiga med spararnas medel än vad som vore optimalt. Samhällets skyddsnät kan alltså bidra till att det uppstår en s.k. moral hazard-problematik. Detta stärker motiven för reglering och övervakning av tillgångsförvaltarna. Här kan det vara på sin plats att framhålla att den långsiktiga förvaltningen av sparmedel är tämligen väsensskild från den ofta kortsiktiga värdepappershandel som berörs av MiFID. Den senare är inte förknippad med samma moral hazard-problem och ger inte heller upphov till skyddsmotiv av samma art som det långsiktiga sparandet. Detta utesluter emellertid inte att det kan uppstå problem inom andra finansiella tjänstegrenar som motiverar konsumentskydd av något slag.

I MiFID, liksom ofta i andra sammanhang då kundskyddet på värdepappersmarknaderna kommer på tal, aktualiseras begreppet ”bästa utförande” (”best execution”). Bästa utförande är tänkt att vara ett mått på hur väl investerarnas handelsorder utförs. Begreppet är särskilt relevant vid utvärdering av hur väl exempelvis en mäklare, som agerar på sina kunders uppdrag, presterar i verkställandet av sina kunders order. Priset är vanligen den viktigaste komponenten i bedömningen av ”bästa utförande”. Det kan dock finnas många andra aspekter av en handelstransaktion som är väl så viktiga för en kund, exempelvis snabbheten i utförandet, möjligheten till prisförbättringar, sannolikheten för att transaktionen genomförs överhuvud taget, möjligheten att bibehålla sin anonymitet, alternativkostnader, affärens påverkan på hela prisbilden, möjligheten att genomföra affären till minsta möjliga avgifter osv.

Frågan om ”bästa utförande” är problematisk av flera skäl. För det första kan olika investerare ha olika preferenser i fråga om utförande. En enskild definition som omfattar allas preferenser är därför knappast möjlig. För det andra, eftersom de som handlar ofta utvärderar utförandet i förhållande till en rad olika kriterier, varav en del kan vara ömsesidigt uteslutande, krävs någon form av rangordning av dessa kriterier. En metod för detta kan vara svår att få fram. För det tredje kan det finnas betydande svårigheter att över huvud taget mäta många aspekter av bästa utförande. För det fjärde, för att bedöma bästa utförande krävs inte bara mått på lämpliga aspekter av utförandet av den aktuella transaktionen, det krävs dessutom jämförelser med alla alternativa möjligheter att utföra samma transaktion som rimligen fanns tillgängliga vid den aktuella tidpunkten. Detta är heller ingen enkel sak att få fram.

En annan fråga som kommit att aktualiseras i samband med diskussioner om konsumentskydd på det finansiella området är förekomsten av intressekonflikter. Förutom den klassiska principal-agent-problematiken, dvs. svårigheten för beställaren av den finansiella tjänsten att övervaka och bedöma prestationerna hos den som tillhandahåller tjänsten, kan det också finnas underliggande intressekonflikter som de finansiella företagens kunder kan vara ovetande om. Intressekonflikterna är framför allt en konsekvens av att vissa finansiella intermediärer är verksamma på många olika områden. Att vara verksam på flera områden innebär ofta fördelar ur marknadsföringssynpunkt och effektivitetssynpunkt, då skalfördelarna kan vara betydande, men kan samtidigt ge

upphov till frestelser att otillbörligt exploatera kundernas informationsunderläge.

När det gäller intressekonflikter av detta slag kan det vara värdefullt att göra en distinktion mellan konflikter i ”grossistledet”, med i huvudsak professionella aktörer, och konflikter i ”detaljistledet”, där många icke-professionella kunder som hushåll och småföretag befinner sig. Distinktionen har sin betydelse för behovet av kundskydd dels på grund av de skillnader som finns vad gäller informations- och transaktionskostnader, dels på grund av de olikheter i sårbarhet för konfliktexploatering som finns mellan de båda kategorierna. De intressekonflikter som är förknippade med finansiella detaljisttjänster är sannolikt allvarligare än intressekonflikter på de finansiella grossistmarknaderna.

Ett tydligt exempel på intressekonflikt som kan drabba ickeprofessionella kunder uppstår när ett institut agerar rådgivare samtidigt som det saluför diverse egna finansiella produkter. Frestelsen att i rådgivningen främja de egna produkterna kan därvid vara påtaglig. En variant av detta är om det förekommer försäljningsprovisioner eller liknande som skapar incitament att marknadsföra andra företags produkter, trots att de är högt prissatta och trots att det finns för kunden mer fördelaktiga produkter. De incitamentsstrukturer som ligger bakom bankernas försäljnings- och marknadsföringsprocesser är sällan transparanta för kunden. Ett annat exempel på intressekonflikt är om ett finansiellt företag frestas att försumma eller senarelägga en kunds köp- eller säljinstruktioner om detta skulle ge företaget fördelar i handeln i det egna värdepapperslagret.

På den finansiella sektorns grossistmarknader verkar i första hand professionella aktörer, dvs. företag och sofistikerade institutionella investerare. Informations- och konkurrensförhållanden på grossistmarknaderna är i regel sådana att de intressekonflikter som uppstår på dessa marknader ofta är av mindre allvarlig art. Alla deltagare är införstådda med spelets regler. Trots detta kan allvarligare typer av intressekonflikter uppstå. Ett finansiellt företag kan exempelvis ha ett intresse i en transaktion i vilken företaget också agerar som rådgivare, långivare eller garant av nyemissioner och börsintroduktioner (s.k. underwriter) för en kund. Detta kan hypotetiskt skapa incitament att gynna det egna vinstintresset framför klientens intressen i affären. Värdepappersföretag som är involverade i börsintroduktioner kan också frestas att tilldela teckningsrätter till personer i kundföretag som de underförstått vill

ha uppdrag av. Detta innebär i vissa fall en otillbörlig överföring av förmögenhet från investerarna och i andra fall en orättvisa i förhållande till presumtiva investerare.

Finansiella företag kan även exploatera institutionella kunder eller företagskunder genom att genomföra handel i eget lager innan kundens transaktionsorder utförs. På så sätt kan marknadspriset påverkas till nackdel för kunden.

Ett finansiellt företag kan ha också affärsförhållanden med två eller flera klienter som själva står i konflikt med varandra. Exempelvis kan ett företag ombes att representera obligationsinnehavarna i ett krisdrabbat företag och samtidigt erbjudas att representera potentiella uppköpare av företaget.

Det kan också uppstå intressekonflikter mellan grossist- och detaljistverksamheter. Dessa konflikter karakteriseras av lite annorlunda informationsasymmetrier. En klassisk intressekonflikt finns mellan ett finansiellt företags roll som anskaffare av kapital på de finansiella marknaderna åt sina grossistkunder och dess roll att tillhandahålla lämpliga investeringar åt sina detaljistkunder. Eftersom huvuddelen av ett företags intäkter ofta kommer från kapitalanskaffningsverksamheten kan intressekonflikten leda till ett missgynnande av detaljistkunderna.

Det finns även en rad inneboende konflikter i analytikerrollen. Analytiker som arbetar för finansiella företag med många verksamheter kan ha på sig flera olika hattar och blir lätt föremål för ett antal intressekonflikter. I sådana företag kan analytikern få i uppdrag att a) tillhandahålla objektiv information till investerare, både direkt och via detaljistmäklare och företagets försäljningsorganisation; b) bistå i utgivnings- och distributionsprocessen för värdepapper i anskaffningen av kapital till klienter; c) bistå med analysstöd i rådgivningsverksamhet med koppling till corporate financeaktiviteter; d) ge stöd i diverse lednings- och äganderättsfrågor i företaget. Dessa olika roller kan vara helt oförenliga med varandra och kan ge upphov till betydande principal-agent-problem på flera nivåer.

Förekomsten av intressekonflikter har ofta motiverat lagstiftning. Intressekonflikter var exempelvis ett av motiven bakom den stränga åtskillnad mellan affärsbankverksamhet och investmentbankverksamhet som infördes i USA på 1930-talet (1933 års Glass-Steagal Act) och som gällde fram till relativt nyligen. Denna åtskillnad av verksamheter har emellertid sannolikt inneburit

mycket stora effektivitetsförluster och hämmat utvecklingen av den amerikanska banksektorn i decennier.

Ett ofta mer tilltalande medel för att förbättra konsumentskyddet är att förbättra genomlysningen – transparensen – i handeln med värdepapper och i relaterade tjänster. God genomlysning gynnar i allmänhet detaljistkunderna. Transparens i övermått kan dock vara mindre förmånligt för professionella aktörer, som inte alltid vill avslöja sina transaktioner eller positioner. Givet de professionella aktörernas betydelse för värdepappersmarknadernas funktion kan ett överdrivet konsumentskydd verka skadligt på effektiviteten. Några olika aspekter på genomlysning diskuteras i avsnitt 3.4.

5.3.4. Effektivitetsintresset

Som tidigare berörts spelar de finansiella marknaderna en viktig roll för att uppnå en effektiv allokering av kapital och risk i ekonomin. Det innebär att kapitalet kommer till sin mest produktiva användning och att finansiella risker kommer att bäras av dem som är villiga att göra det till den lägsta ersättningen. Att regleringen utformas så att de finansiella marknaderna bidrar till denna allokeringseffektivitet på bästa sätt är alltså ett viktigt mål i sig. Egentligen framstår effektivitet i vid mening som ett överordnat mål. Ett finansiellt system som är instabilt och där konsumenter dessutom regelmässigt förleds ingå oförmånliga avtal kan knappast sägas fullgöra sina grundläggande uppgifter – att förmedla kapital, hantera och omfördela risker samt förmedla betalningar – på ett samhällsekonomiskt effektivt sätt. I det här delavsnittet diskuteras dock effektiviteten på de finansiella marknaderna utifrån ett lite snävare perspektiv. Aspekter på effektivitet i denna lite snävare mening är exempelvis informationseffektivitet, likviditet, systemeffektivitet och dynamisk effektivitet.

Effektiva priser – informationseffektivitet

Effektiva priser uppnås om marknaderna är informationseffektiva. Informationseffektiva marknader innebär att priserna reflekterar all tillgänglig relevant information om värdepapprets fundamentala värde. Det innebär att priserna hela tiden blir bärare av information

som alla kan lita på. Därmed underlättas investerarnas möjligheter att göra förnuftiga placeringar, och kapitalallokeringen kan bli effektivare. Typiskt sett anländer de som handlar på en marknad med ofullständig information om fundamenta. De har också olika motiv för att handla; en del kanske bara behöver likvida medel, en del har kanske gjort omfattande analyser som gör att de tror sig ha ett informationsförsprång, en del kan ha helt andra motiv. I själva verket är det en förutsättning för att handel över huvud taget ska äga rum att det finns olika slags aktörer med olika information och olika motiv för att handla. Hur snabbt ny information omsätts i marknadspriser är ett mått på marknadens informationseffektivitet.

Likviditet

En viktig aspekt av effektiviteten på värdepappersmarknaderna är dess likviditet. Likviditet är ett begrepp som inte låter sig beskrivas alldeles enkelt. I dess mest basala betydelse har det att göra med hur snabbt, billigt och enkelt en tillgång kan omsättas med minimal effekt på priset, dvs. hur lätt det är att kliva ur en position utan att förlora alltför mycket på affären. Likviditet kan dock betraktas utifrån en rad olika dimensioner:

Omedelbarhet (immediacy) avser hur snabbt en marknadsaktör kan effektuera ett handelsbeslut och hitta en motpart. Valutamarknaden, som i princip är öppen dygnet runt alla dagar om året, kännetecknas av en mycket hög grad av omedelbarhet. En auktionsmarknad, där handel äger rum kanske bara en gång varannan vecka, har i jämförelse en mycket låg grad av omedelbarhet.

Marknadens bredd mäter kostnaden för att först köpa minsta tillåtna kvantitet och sedan direkt sälja samma post. I princip är detta skillnaden mellan köp- och säljkursen. Ibland inkluderas även andra transaktionskostnader i form av courtage och andra avgifter.

Djupet på en marknad beskriver hur mycket en aktör kan köpa eller sälja utan att förändra priset. Ofta görs en distinktion mellan orderdjup och marknadsdjup. Orderdjup avser volymen på en order med samma pris (eller ibland volymen på en mäklares prisnotering), medan marknadsdjup avser den totala volymen av alla order med samma pris.

Återhämtningsförmåga (resilience) beskriver hur snabbt marknaden återhämtar sig efter en temporär likviditetschock. För att underlätta förståelsen av begreppet kan man ta hjälp av två olika

begrepp, ”informerade handlare” och ”oinformerade handlare”, som brukar användas i teoretiska studier av marknadslikviditet. Informerade handlare är marknadsdeltagare som har kunskap om det framtida värdet av ett värdepapper, medan oinformerade handlare är aktörer som saknar särskild kunskap om värdepapprets framtida värde. En informerad handlare förväntas lägga order endast om han kan antas ha överlägsen information i den aktuella affären. Oinformerade aktörer handlar exempelvis av likviditetsskäl. Utförande av order från oinformerade handlare innebär en lägre risk för en intermediär som också handlar i eget lager än utförande av en order från en informerad aktör. Detta beror på att priset på värdepappret sannolikt kommer att röra sig i en riktning som gynnar den informerade aktören. När en informerad aktör handlar, kan alltså intermediären förväntas förlora på affären. När någon köper en tillgång vet säljaren inte alltid om köparen är av det informerade slaget, dvs. har ny information om tillgången, eller inte. Om volymen inte är helt försumbar kan därför själva köpet leda till att säljaren höjer priset. Resultatet blir att det observerade priset stiger. Om det visade sig vara en oinformerad aktör som köpte tillgången är det fundamentala värdet i grunden oförändrat, varför priset så småningom borde återgå till den ursprungliga jämvikten. Återhämtningsförmågan är ett mått på hur snabbt denna återgång sker.

En marknad som kännetecknas av en hög grad av omedelbarhet, liten bredd, stort djup samt hög återhämtningsförmåga brukar betraktas som likvid. En marknad som är likvid med avseende på dessa egenskaper är i regel eftersträvansvärd, eftersom priserna på en sådan marknad kan förväntas ha ett stort informationsvärde.

De olika dimensionerna av likviditet som beskrivits ovan kan emellertid ofta stå i konflikt med varandra. Exempelvis kan en marknad som utformas som ett periodiskt auktionsförfarande vara fördelaktigt i fråga om bredd, djup och återhämtningsförmåga, men samtidigt ofördelaktigt genom att ge en mycket låg grad av omedelbarhet. På motsvarande sätt kan en marknad som utformas som ett kontinuerligt handelssystem visserligen ge upphov till god omedelbarhet, men samtidigt vara ofördelaktigt i fråga om bredd, djup och återhämtningsförmåga.

Oavsett hur man väljer att karakterisera likviditeten på en marknad, kan det konstateras att orderflöden ofta attraherar andra orderflöden; likviditet attraherar likviditet. Om en marknadsplats har hög likviditet i en tillgång är det troligt att många vill handla

där eftersom man då har bäst förutsättningar att få handla till de mest rättvisande priserna. Om en marknadsplats har en likvid handel i en tillgång, drar den ofta till sig handel även i andra tillgångar, eftersom andra företag vill att även deras instrument ska handlas på en marknadsplats där många aktörer redan finns. Handeln med finansiella instrument kännetecknas av s.k. nätverksexternaliteter som upphov till betydande naturliga koncentrationstendenser.

Systemeffektivitet

En helt annan aspekt av effektivitet rör s.k. systemeffektivitet. Den hänger i stor utsträckning samman med möjligheterna att utnyttja skalfördelar. Detta kan exempelvis ske genom s.k. vertikal integration av alla leden i en värdepapperstransaktion från initieringen av handeln till dess betalning och leverans äger rum, dvs. tidpunkten då hela transaktionen slutgiltigt avvecklas. Den tekniska utvecklingen har möjliggjort en ökad automatisering av leden i denna värdekedja. Genom automatisering kan transaktionskostnaderna på värdepappersmarknaderna sänkas. Denna vertikala integration förutsätter ett samarbete och ibland rent av ett samgående av de olika leden av den finansiella infrastrukturen.

Parallellt med utvecklingen mot vertikal integration har internationaliseringen av kapitalmarknaderna och harmoniseringen av lagar och regler inom EU lett till ett ökat tryck på att konsolidera verksamheterna även över nationsgränserna. I många fall har det tidigare funnits legala barriärer mot en internationell konsolidering. När nu barriärerna successivt tas bort ökar konkurrenstrycket på de existerande nationella infrastrukturföretagen. Samtidigt förstärks incitamenten till samarbete och sammanslagning exempelvis mellan börser i olika länder och mellan clearing- och avvecklingsorganisationer i olika länder. Det finns med andra ord tendenser även till horisontell integration. Denna horisontella integration är också ett sätt att nå större effektivitet genom att utnyttja skalfördelar.

Dynamisk effektivitet

Som vi funnit ovan skapar önskemålen om likviditet i handeln och systemeffektivitet tendenser till centralisering och konsolidering av handeln med finansiella instrument. Det hänger samman med de nätverkseffekter och de skalfördelar som är förknippade med värdepappershandel. Dessa koncentrationstendenser kan emellertid uppstå på bekostnad av effektivitet i mer dynamisk mening. Med ökad konsolidering och centralisering ökar risken för monopoltendenser. Dessa inbegriper bland annat inträdeshinder för nya aktörer och konkurrerande handelssystem. Det kan på sikt också leda till monopolprissättning. Därmed är det inte säkert att de rationaliseringsvinster som uppnås med exempelvis vertikal och horisontell integration kommer slutkunderna till del. För att uppnå dynamisk effektivitet är det viktigt att det förekommer konkurrens om olika sätt att tillhandahålla handel med finansiella instrument. Det är också viktigt att den reglering som styr dessa verksamheter inte blir så rigid och detaljerad att den hämmar utvecklingen på området. Regelverket bör vara så flexibelt att det kan ta hänsyn till innovationer på området; det är viktigt att lämnar rum för nya sätt att organisera handeln med finansiella instrument, nya finansiella produkter och nya aktörer på marknaden.

5.4. Behovet av ett harmoniserat regelverk

5.4.1. Vinster av ökad integration

De europeiska finansmarknaderna har länge kännetecknats av betydande nationella skillnader. Det har i varje enskilt land i stor utsträckning utvecklats speciella regler, institutioner och praxis för finansiell verksamhet. Att det uppkommit nationella särarter i utvecklingen av finansiell handel och i utbudet av finansiella tjänster är naturligt och speglar närmast den ekonomiska utveckling och de speciella behov som uppstått i respektive land.

Även om denna ordning fram till nyligen i stort sett har fungerat väl – sett ur ett nationellt perspektiv – har nackdelarna med finansmarknadernas olikartade utformning kommit att framträda allt tydligare i takt med att Europas ekonomier i övrigt blivit mer integrerade. Skillnader i reglering, konventioner och tillsynsansatser har inneburit betydande hinder för ett effektivt gränsöverskridande utbud av finansiella tjänster. Därmed har det också

blivit uppenbart att Europas ekonomier riskerar att gå miste om en rad potentiella effektivitetsvinster, som skulle kunna vara till fördel för tillväxten i regionen.

I princip skulle en mer integrerad marknad för finansiella tjänster bland annat ge bättre förutsättningar för konkurrens över gränserna och bättre möjligheter att utnyttja skalfördelar och synergier. Ökad konkurrens torde i sin tur leda till bredare urval av investerings- och finansieringstjänster och effektivare prissättning av dessa tjänster. Därmed skulle exempelvis expanderande små och medelstora företag förväntas få bättre tillgång till riskkapital och lägre finansieringskostnader, på samma sätt som en mer utvecklad och integrerad marknad för företagsobligationer lett till lägre kapitalkostnader för större företag. Även konsumenter gynnas av lägre lånekostnader och tillgång till ett bredare sortiment av finansiella tjänster. Dessutom skulle såväl företag som hushåll ges bättre möjligheter till riskspridning. Bättre utnyttjande av skalfördelar torde också ge billigare och säkrare sätt att genomföra betalningar för varor och tjänster.

Alla dessa effektivitetsvinster kan förväntas accelerera tillväxten och bidra till ökad sysselsättning i Europa. Exakt hur stora välfärdsvinsterna skulle vara av en mer integrerad europeisk finanssektor är givetvis svårt att beräkna. Försök att uppskatta effekterna av ökad finansiell integration på realekonomin har emellertid gjorts i några uppmärksammade studier.

Guiso, Jappelli, Padua och Pagano publicerade i juni 2004 en studie av relationen mellan finansiell integration och tillväxt. Studien visade bland annat att europeiska tillverkningsföretag skulle kunna öka tillväxten med 0,6

  • procentenheter om året om de hade samma tillgång till finansieringstjänster som sina amerikanska motsvarigheter.

2

En studie av konsultföretaget London Economics från slutet av 2002 fokuserade på effektivitetsvinsterna av djupare och mer likvida värdepappersmarknader i EU15-länderna. En slutsats var att ökad integration kunde förväntas leda till en långsiktig ökning i real BNP-nivå med omkring 1,1 procentenheter och 0,5 procentenhet högre sysselsättning i EU15.

3

2

Guiso Luigi, Tullio Jappelli, Mario Padula och Marco Pagano, ”Financial Market Inte-

gration and Economic growth in the EU”, Centre for Economic Policy Research, CEPR Discussion Paper Series No. 4395, June 2004.

3

Quantification of the Macro-Economic Impact of Integration of EU Financial Markets:

Final Report to The European Commission

  • Directorate-General for the Internal Market,

London Economics, November 2002.

Ökad integration kan också ha positiva effekter på stabiliteten i det finansiella systemet. Exempelvis kan mer integrerade finansiella marknader bidra till att chocker i det finansiella systemet absorberas bättre. De kan också bidra till att de finansiella företagens möjligheter till hantering och diversifiering av risker förbättras. Å andra sidan kan ökad gränsöverskridande verksamhet leda till att finansiella problem lättare sprids mellan länder.

Det är också framför allt mot bakgrund av dessa potentiella effektivitetsvinster som MiFID ska ses. Allt sedan slutet av 1990har finansiell integration varit ett prioriterat policyområde i EU. För att få fart på integrationsprocessen sjösattes i maj 1999 en ambitiös handlingsplan för finansiella tjänster (Financial Services Action Plan). Handlingsplanen gick ut på att under perioden 2000

  • genomföra 42 åtgärder, varav direktivet om marknader för finansiella instrument var en, för att på så sätt öka harmoniseringen av regelverken och därmed förbättra förutsättningarna för gränsöverskridande konkurrens.

5.4.2. Problem i harmoniseringen

Harmonisering innebär med nödvändighet kompromisser. Kompromissarbetet innebär en jämkning av en mängd olika nationella ståndpunkter, som dessvärre inte alltid är helt förenliga sinsemellan. De gemensamma direktiven liknar därför till viss del ofta lapptäcken av regler med olika ursprung och syften. Därmed är direktiven heller inte alltid helt lättolkade och motiven till vissa bestämmelser kan ibland vara svåra att förstå.

Ett annat resultat av kompromissandet är att direktiven ofta har en tendens att bli tämligen omfattande och detaljerade, eftersom det tycks vara lättare att nå kompromisser genom att lägga till paragrafer än att dra ifrån då en slutlig text ska göras upp. En alltför hög detaljeringsgrad riskerar att leda till reglering som inte är tillräckligt flexibel. Ett gemensamt regelverk som är utformat så att den cementerar strukturer snarare än ökar möjligheterna till förändring och anpassning riskerar att på sikt leda till minskad snarare än ökad effektivitet, dvs. motverka målet om effektivitet dynamisk i dynamisk mening.

Ett helt annat problem är att graden av harmonisering i praktiken kanske inte blir så hög som det var tänkt. Strävan att få med nationellt avpassade särlösningar förekommer på alla nivåer och i

alla led i processen. Även efter det att ett gemensamt direktiv har antagits kan det finnas tendenser till s.k. goldplating på nationell nivå, dvs. att lägga till en rad nationella bestämmelser ovanpå det gemensamma regel verket. Både goldplating och försummelser i genomförandet av de gemensamma reglerna bidrar ytterligare till att slutresultatet inte alltid blir den harmonisering som var avsedd från början. I sämsta fall kan det också leda till att nya inträdesbarriärer uppstår.

5.4.3. Motstridiga mål

Redogörelserna ovan ger vid handen att utformningen av ett regelverk för värdepappersmarknaderna med nödvändighet måste innefatta ett stort antal avvägningar mellan delvis motstridiga mål. Sammanfattningsvis vill man idealt sett ha ett regelverk som på en och samma gång minimerar systemriskerna, ger ett adekvat kundskydd, underlättar gränsöverskridande kapitalrörelser, möjliggör effektiv handel och avveckling av värdepapper över gränserna, möjliggör utnyttjande av skalfördelar, uppmuntrar innovationer, uppmuntrar till ökad konkurrens samt har förmåga att snabbt anpassa sig till förändringar. Att detta inte är någon enkel uppgift är uppenbart. Effekterna av enskilda regleringsåtgärder är i många fall svårbedömda och kan ibland inte utläsas förrän långt i efterhand om ens någonsin.

En speciell målkonflikt som aktualiseras i samband med MiFID rör frågan om effektivitet i mera kortsiktig mening och effektivitet i mer dynamisk och långsiktig mening. Konkret handlar frågan i hög grad om vilka principer för genomlysning som ska gälla för värdepappershandel i allmänhet och vid systematisk internhandel i synnerhet. I följande avsnitt görs ett försök att på ett principiellt plan redogöra för denna målkonflikt.

5.5. Fragmentering, internalisering och genomlysning

5.5.1. Inledning

Som tidigare angetts har värdepappersmarknader en naturlig tendens till konsolidering. Trycket på detta kommer både från utbudssidan genom kravet att utnyttja skalfördelar och från efterfrågesidan genom förekomsten av de nätverksexternaliteter som är

förknippade med likviditet. På samma gång kan vi observera uppkomsten av nya och konkurrerande handelssystem, vilket leder till en fragmentering av marknaderna.

Fragmentering innebär ökad konkurrens, vilket kan bidra till effektiviteten i dynamisk mening, medan konsolidering kan bidra till minskade transaktionskostnader och eventuellt större likviditet. Överfört till MiFID-sammanhang kan man säga att systematiska internhandlare och MTF:er bidrar till fragmenteringen av värdepappersmarknaderna och därmed till konkurrensen.

En av de kontroversiellare frågorna i MiFID rör oron för att kraven på genomlysning före handeln ska underminera möjligheten att fungera som systematisk internhandlare. Frågor för utredningen är således om detta är en välgrundad oro, och i så fall om detta föranleder några åtgärder i utformningen och tillämpningen av regelverket, i den mån det ges utrymme för detta. För att skapa en bättre bas för en sådan bedömning görs i resten av det här avsnittet ett försök att ge en översiktlig bild av specifika frågor som diskuterats kring fragmentering, internalisering och genomlysning och resultaten av en del av den forskning som gjorts på området.

4

5.5.2. Fragmentering

Fragmentering är det begrepp som används om utbudet av varor eller tjänster på en marknad är uppdelat mellan flera olika källor. Konkurrens förutsätter per definition mer än en utbudskälla. I fråga om värdepappersmarknaderna uppträder fragmentering när inte alla order som rör ett visst värdepapper interagerar i en och samma handelsmekanism. Det finns i dag en bred konsensus bland ekonomer om det fördelaktiga med konkurrens mellan börser och andra typer av marknadsdeltagare i handeln med ett visst värdepapper. Samtidigt kan det finnas betydande fördelar med konsolidering. Det som försvårar en kostnads- och intäktsanalys av fragmentering är att konkurrens mellan order kan fungera bäst på en konsoliderad marknad där alla order kan interagera med varandra, medan konkurrens mellan olika marknader, som börser, handelssystem och OTC-handel – och alla de fördelar som sådan konkurrens medför – implicerar fragmenterade marknader. De två

4

Avsnitten 5.5.2

  • bygger huvudsakligen på en sammanställning som gjorts av Ruben

Lee (2002), ”Capital Markets that Benefit Investors: A Survey of the Evidence on Fragmentation, Internalisation and Market Transparency”, Oxford Finance Group, 2002.

formerna av konkurrens förefaller alltså inte vara helt kompatibla med varandra.

Nedan redogörs för ett antal sinsemellan nära sammanhängande spörsmål som uppkommit i diskussionen om huruvida alla order i ett visst värdepapper bör konsolideras i ett enskilt handelssystem, eller om orderflöden ska tillåtas fragmenteras till konkurrerande system.

Konkurrens mellan börser och andra typer av handelssystem

Fördelen med konkurrens är att den bidrar till att hålla nere priserna på de tjänster som börser och andra handelssystem erbjuder, som transaktioner, clearingtjänster, noteringstjänster etc. Den skapar också incitament till innovationer och rationaliseringar, exempelvis automatisering av handelssystemen och handel i olika slags tillgångar.

Säljare av värdepapper går dit där de tror sig kunna få högst pris och köpare går dit där de tror sig kunna få lägst pris. Det innebär att de sannolikt kommer att sammanstråla där skillnaden mellan köp- och säljkurs är som minst, dvs. där likviditeten är som störst. Orderflöden attraherar alltså orderflöden, vilket innebär att handel i ett visst instrument sannolikt kommer att koncentreras till en enskild handelsmekanism, eller åtminstone till ett fåtal konkurrerande system. Om däremot handeln av någon anledning fragmenteras mellan flera olika marknadsplatser, kan det befaras att spridningen av orderflöden leder till minskad sannolikhet för utförande i varje system, vilket i sin tur kan leda till försämrad likviditet och eventuellt till ökad volatilitet, dvs. större kurssvängningar.

5

Andra

analyser av konkurrens mellan handelssystem kommer fram till att samexistens mellan olika handelssystem kan vara optimalt om handlare har olika behov och önskemål, och om varje handelssystem uppfyller en viss investerarkategoris preferenser. Andra teorier kommer fram till att konkurrens inte alltid är förmånligt och att den kan leda till såväl sämre som bättre likviditet.

Ett antal empiriska studier av konkurrens mellan nationella marknadsplatser har gjorts, speciellt i spåren av införandet av ”The Big Bang” i London på 1980-talet.

6

Detta var en period som

5

Mendelson, Haim. ”Consolidation, Fragmentation and Market Performance”. Journal of

Financial and Quantitative Analysis, vol. 22, no. 2 (6/1987).

6

Se t.ex. Anderson & Tychon (1993), Demarchi & Foucault (1998), Di Noia (1998),

Friedrichs & Tonks (2001), m.fl.

kännetecknades av intensiv omvandling och förnyelse av de olika börssystemen och som innebar stora förändringar i fråga om såväl marknadens struktur och tjänsteutbud som handelsteknik. Till de dynamiska effekterna av konkurrens hör marknadens förmåga att handla större volymer i rådande spreadar, att länka handeln mellan olika marknader samt att skapa nya marknadsplatser.

Många studier av effekterna mellan olika handelssystem har också utförts i USA.

7

En stor del av dessa pekar på att ökad kon-

kurrens mellan olika handelssystem bland annat leder till minskade spreadar mellan köp- och säljkurser.

Skilda preferenser hos olika handlare

Förekomsten av olika handelssystem med distinkta marknadsstrukturer ger investerare ökade valmöjligheter. Olika typer av handelssystem kan ha olika förtjänster. Transaktionskostnaderna för dem som efterfrågar omedelbarhet i utförandet av order kan exempelvis vara betydligt högre än för dem som har större tålamod i sina transaktioner.

8

Stora kostnadsbesparingar kan också uppnås i auto-

matiserade handelssystem jämfört med traditionella intermediärintensiva marknader.

9

Mångfalden av preferenser hos investerarna och förekomsten av flera marknadsplatser har även satt ljus på frågan om innebörden av begreppet ”bästa utförande”, som berördes i avsnittet om konsumentskyddsintresset (avsnitt 5.3.3). I nyare forskning hävdas att begreppet ”bästa pris” inte är väldefinierat i ett sammanhang där flera handelssystem samexisterar, och ett försök att införa regler om ”bästa utförande” som ett konsumentskyddsmedel kan underminera konkurrensen mellan handelssystem, vilket i sin tur kan vara negativt för konsumenten.

10

Konkurrens mellan handlare

Konkurrens mellan värdepappershandlare håller priset nere på de tjänster de erbjuder, ger incitament till produktutveckling och kan också bidra till att minska marknadsdominansen hos de aktörer

7

Se t.ex. Cohen & Conroy (1990), Demsetz (1968), Tinic (1972), Mayhew (2002).

8

Keim & Madhaven (1997).

9

Se t.ex. Conrad, Johnson & Wahal (2001), Domowitz (2001).

10

Blume (2002), Macey & O’Hara (1997).

som sätter priserna på marknaden, vilket leder till bättre förhållanden i fråga om utförande av order.

11

Prisprioritet

En egenskap i värdepappershandeln som ofta anses vara önskvärd är förmågan att upprätthålla prisprioritet. Prisprioritet innebär att de högsta köpbuden och de lägsta säljbuden utförs före alla andra order. Avsaknad av prisprioritet kan leda till en minskning i snabbheten och precisionen varigenom information om ett företag inkorporeras i priset på dess aktier och en minskning av kvaliteten i prisbildningsprocessen på marknaden. Även om det kan vara svårare att uppnå prisprioritet på en marknad med flera konkurrerande handelssystem än på en centraliserad marknad, har marknadsaktörerna själva incitament att försäkra sig om att de erhåller de bästa priserna, varför prisprioritet ändå kan uppnås.

Tidiga empiriska studier har pekat på att NYSE (New York Stock Exchange) erbjuder bättre priser än vad som erbjuds i konkurrerande handelssystem.

12

Dessa resultat har använts för att

hävda att order som utförs utanför NYSE inte uppnår ”bästa utförande” i fråga om bästa tillgängliga priser. Det finns ett relativt utbrett bruk att betala slutkunder för att lägga sina order, eller att betala mäklare för att utföra vissa order på en bestämd handelsplats. Denna företeelse brukar på engelska benämnas ”preferencing”. Ofta rör det sig om att på något sätt gallra ut order under en viss storlek. Eftersom dessa mindre order sannolikt kommer från huvudsakligen oinformerade aktörer, som handlar av likviditetsmotiv eller liknande, innebär dessa ”oinformerade order” en lägre risk för den intermediär som driver marknadsplatsen (och som också förutsätts handla i eget lager). Genom att styra sådana lågriskorder till en och samma marknadsplats, medan högriskorder från informerade aktörer styrs undan från denna, kommer intermediären som driver marknadsplatsen systematiskt att minska sina risker i de egna positionerna. De oinformerade aktörerna och mäklarna som styr dessa order till denna marknadsplats kompenseras genom att betalas med kanske några cent per order. Spreadarna mellan köp- och säljkurser skulle, på grund av de lägre

11

Se t.ex. Boehmer & Boehmer (2002).

12

Se t.ex. Angel (1994), Bessembinder & Kaufman (1997), Blume & Goldstein (1992), (1997), Hasbrouck (1995) m.fl.

riskerna, också teoretiskt kunna hållas nere i denna del av handeln. Sådan preferencing, som styr undan order från oinformerade handlare med låg risk från den primära handelsplatsen, har kritiserats för att bara lämna kvar de mer högriskbetonade orderflödena från informerade aktörer. Detta har setts som en form av ”creamskimming”, som riskerar att underminera prisbildningsprocessen (se också avsnitt 5.5.3 om internalisering).

13

Sekundära prioriteter

Efter prisprioritet är en annan ofta önskvärd egenskap i värdepappershandeln förmågan att upprätthålla tidsprioritet, dvs. att av två identiska order utförs den först som också inkommit först. Tidsprioritet ger marknadsaktörer incitament att vara tidigt ute med att lägga limitorder i ett handelssystem. Genom att göra detta ökar nämligen sannolikheten för att deras order kommer att utföras. Tidsprioritet är svårt att uppnå i en värld av konkurrerande handelssystem. Det har ibland hävdats att avsaknaden av fungerande tidsprioritet kan leda till vidgade spreadar mellan köp- och säljkurser och även minska sannolikheten för att lagda limitorder utförs. De möjligheter som utvecklingen av automatiseringen av handeln innebär kan emellertid medföra att behovet av tidsprioriteringsregler blir mindre viktigt. Detta beror på att investeraren kan uppnå liknande resultat genom att kontinuerligt bevaka marknaden och skicka i väg en marknadsorder direkt och med automatik då priset på det aktuella värdepappret närmar sig den limit han annars hade lagt ordern med. En sådan strategi har också andra fördelar. Att lägga en limitorder innebär nämligen en risk i form av att andra investerare samtidigt ges en möjlighet – en gratis option – att handla mot limitordern om priserna rör sig emot dem. Denna risk minimeras genom möjligheten att med samma resultat lägga marknadsorder i stället för limitorder.

13

Se t.ex. Harris (1995), Chordia & Subrahmanyam (1995), Lin, Sanger & Both (1995), Easley, Kiefer & O’Hara (1996), Battalio (1997).

Konsolidering av information

Konsolidering av information innebär att kursnoteringar och annan handelsinformation om handeln i ett visst värdepapper finns lättillgänglig från en och samma källa.

14

Det hävdas ibland att konsoli-

dering av sådan information är lättare att uppnå på en konsoliderad marknad. Det finns dock flera exempel på privata lösningar som innebär konsolidering av information från flera olika marknader.

Genomlysning anses ofta spela en nyckelroll i konsolidering av marknader, genom att bidra till en prisutjämning mellan olika marknadsplatser. Detta underlättar för arbitragörer att handla när det uppstår tillfälliga felprisättningar på vissa marknadsplatser men inte på andra. Åsikten att full transparens krävs för att uppnå prisutjämning mellan handelssystem delas emellertid inte av alla.

15

Vissa börstjänsters karaktär av ”kollektiv vara”

Vissa funktioner som organiserade marknadsplatser fyller har egenskaper som gör att de kan liknas vid något som i ekonomisk teori benämns ”kollektiva varor” eller ”public goods”, dvs. varor eller i det här fallet snarare tjänster, som kommer alla till nytta, men som en enskild aktör inte nödvändigtvis har tillräckliga incitament att ensam finansiera produktionen av. Till de allmänna nyttigheter som produceras av börser hör exempelvis marknadsövervakning, självreglering och kvalitetsstämpling (”certifiering”) av värdepapper. De höga kostnader som är förenade med att producera dessa nyttigheter kan innebära att de inte kommer att tillhandhållas i samma utsträckning om det förekommer ett flertal olika system för handel i ett och samma värdepapper. Det kan också vara enklare att dela regleringskostnaderna på ett rättvist sätt mellan aktörerna i ett konsoliderat system. Det finns dock exempel på regleringar som framgångsrikt löst problemen med att säkerställa både adekvat reglering av handeln på flera marknadsplatser och adekvat finansiering av regleringen.

14

Harris (2002).

15

Galetovic & Zurita (2002).

5.5.3. Internalisering

Eftersom internalisering, dvs. matchning och utförande av order mot de egna handelspositionerna snarare än mot börsens orderböcker, är en form av fragmentering, kommer många av de spörsmål som diskuterats ovan att upprepas här. Tidiga studier av internalisering pekade på framför allt två slags kostnader för internalisering. För det första har det hävdats att internalisering kan vara skadlig för prisbildningsprocessen, eftersom internaliseringen innebär att inte alla order som berör ett visst värdepapper kan konkurrera med varandra i en och samma orderbok. Sådan fragmentering har befarats kunna leda till ökade spreadar mellan köp- och säljkurser samt större prisvolatilitet.

16

För det andra,

skulle internalisering kunna leda till att oinformerade order med låg risk styrs bort från den primära handelsplatsen så att enbart de informerade orderna med hög risk blir kvar. Detta skulle i sin tur kunna leda till att handlarna ansätter större spreadar på den primära handelsplatsen för att skydda sig mot att exploateras av investerare med bättre information. Om de avledda, oinformerade orderna med låg risk utförs till priser som är tagna från den primära marknadsplatsen, skulle även dessa kunna bli utförda till sämre priser än om de hade handlats på den primära marknadsplatsen.

17

I senare forskning har framför allt två huvudsakliga fördelar med internalisering noterats. För det första kan internalisering innebära att den primära eller centrala marknadsplatsen utsätts för konkurrens av alternativa handelsplatser, varigenom prisbildningen på värdepappren förbättras. För det andra skulle det ge marknadsdeltagarna större valmöjligheter ifråga om var de vill utföra sina order, jämfört med att enbart ha en enda marknadsplats att vända sig till. För vissa kategorier av investerare kan denna valfrihet ha ett stor värde. Exempelvis skulle möjligheten att utföra order via systematiska internhandlare kunna göra att (oinformerade) detaljistkunder kan erhålla bättre priser och lägre transaktionskostnader än om de var hänvisade till att utföra order via den centrala marknadsplatsen. Om handlarna konkurrerar om detaljistorder kommer de att ansätta mindre spreadar för dessa oinformerade lågriskorder än vad som skulle bli fallet på en konsoliderad marknad. Detta förutsätter

16

Cohen, Maier, Schwartz & Whitcomb (1982).

17

Easley, Kiefer & O’Hara (1996).

dock att handlarna inte behöver skydda sig mot att bli exploaterade av bättre informerade investerare.

18

I avsnittet om fragmentering framgår att en stor del av det tidiga empiriska arbetet om internalisering (i stort sett enbart från USA) kommit fram till att den primära marknadsplatsen (i det här fallet NYSE) i regel erbjuder bättre priser än de priser som är tillgängliga på alternativa handelsplatser. Ett antal senare studier av internalisering har närmare undersökt effekterna av bruket av ”preferencing”, som berörts tidigare. Dessa studier betonar dock snarast fördelarna med internalisering och ifrågasätter både huruvida priserna faktiskt är bättre på NYSE och om utförandet generellt är bättre där. I dessa studier har man inte kunnat påvisa några skadliga effekter av internalisering och ”preferencing”, vare sig på utförandet av marknadsorder eller på utförandet av limitorder. Resultaten indikerar snarare positiva effekter. Ett exempel är att marknadsorder som utförs via ”preferencing” på regionala börser tenderar att handlas till mer förmånliga villkor i förhållande till NYSE än marknadsorder som lagts på regionala börser utan ”preferencing”. Ett annat exempel är att limitorder har större sannolikhet att bli utförda på regionala börser än på NYSE. Konsolidering leder alltså inte nödvändigtvis till högre effektivitet ens i det kortare perspektivet.

19

Resultaten av undersökningar om internalisering leder till kostnadskonkurrens eller till det ”adverse selection-problem” som berördes ovan (dvs. att handlaren ansätter större spreadar för att skydda sig mot att förlora pengar då han handlar med bättre informerade investerare) är motstridiga. Nyare studier av hur internalisering fungerar tar hänsyn till både de priser som investerare möter och de avgifter de måste betala för att få sina order utförda. Slutsatserna om effekterna av internalisering är komplicerade. Ett resultat är att betalning för orderflöden kan leda till både en förbättring i kvaliteten i utförandet, vilket är konsistent med kostnadskonkurrens, och en ökning i andelen informerade aktörer på den primära marknadsplatsen, vilket är konsistent med ”creamskimming”.

18

Harris (2002).

19

Se t.ex. Battalio, Greene & Jennings (1997), Battalio, Jennings & Selway (2000), Peterson & Sirri (2002).

Det finns visst empiriskt stöd för att internalisering kan leda till bättre utförande än på den primära handelsplatsen framför allt om hänsyn tas till andra faktorer än enbart priset.

20

En speciell form av internalisering brukar med en amerikansk term benämnas ”the upstairs market”. På denna marknad söker mäklare motparter utanför börsen framför allt till stora institutionella order. Fördelen med en sådan upstairs-marknad är att mäklarna här kan utföra stora transaktioner utan att fullt ut exponera denna handel för resten av marknaden, ”downstairs”.

21

Empiriska studier från en rad olika sammanhang visar på fördelar med upstairs trading. På NYSE verkar denna handel framför allt tillämpas av investerare som trovärdigt kan signalera att transaktionerna är motiverade av likviditetsskäl och inte av tillgång till bättre information. Denna marknad möjliggör således handel som annars inte skulle äga rum ”downstairs”.

22

I Australien förfaller

handel utanför börsen framför allt gynna de handlare som har möjlighet att växla mellan olika handelsplatser, varigenom deras handelskostnader kan minska.

23

I Kanada tillhandahåller upstairs-

marknaden på Torontobörsen ett instrument för att skilja ut order från investerare med bättre information, och att genomföra likviditetsmotiverade order till lägre kostnader än på den ordinarie börsen.

24

5.5.4. Genomlysning

Effekterna av genomlysning på värdepappersmarknaderna och aktörerna på dessa marknader är komplexa och motstridiga.

Nästan alla studier på området visar att bättre genomlysning leder till ökad snabbhet och precision varigenom ny information om ett företag inkorporeras i aktiepriset. Genomlysning bidrar till att handlare kan välja det system som ger de bästa prisnoteringarna. Härigenom möjliggörs arbitrage mellan olika system. Dessutom säkerställs en fungerande prisprioritet, och prisbildningsprocessen förbättras. Detta anses ofta dessutom leda till förbättrat ”bästa utförande”.

20

Battalio, Hatch & Jennings (2000).

21

Se t.ex. Burdett & O’Hara (1987), Seppi (1990).

22

Madhavan & Cheng (1997).

23

Madhavan & Swan (2001).

24

Smith, Turnbull & White (2001).

Det finns emellertid ett växande antal studier som hävdar att ökad transparens också kan ha ett antal negativa återverkningar på marknadens funktionssätt. Alla investerare är inte villiga att exponera sina order offentligt, eftersom detta kan innebära stora risker för dem. Ökad transparens kan minska deras villighet att delta på marknaden och har i olika sammanhang visat sig leda till försämringar i marknadslikviditeten.

Handlare som är mer välinformerade än andra kommer sannolikt att föredra handelssystem med mindre genomlysning före handeln (pre-trade transparency), så att de kan behålla sina intentioner hemliga. Oinformerade aktörer kommer å andra sidan att föredra mer genomlysning. Ingen enskild transparensregim kommer således att vara den bästa för alla.

Ökad transparens skulle också kunna leda till större spreadar mellan köp- och säljkurser, eftersom marknadsgaranter får svagare incitament att betala för att fånga den information som handel med en informerad aktör ger. Å andra sidan skulle spreadarna kunna minska på grund av att information om transaktionerna når alla marknadsdeltagare, eller för att handlarna blir medvetna om varandras positioner och därmed kommer att konkurrera hårdare.

Genomlysning skulle å ena sidan kunna ha en stabiliserande inverkan på spekulation genom att absorbera obalanser mellan orderflödena i köp- och säljorder och därmed minska volatiliteten. Å andra sidan kan den leda till en förstärkning av marknadsdeltagarnas strategiska beteende gentemot varandra, med stigande volatilitet som en högst tänkbar följd.

Graden av genomlysning på en marknad påverkar hur handelssystemen konkurrerar med varandra. Många hävdar att handelssystemen bör inneha äganderätten till den information som skapas i dessa system. Samma personer hävdar också att de under de flesta omständigheter har fullgoda incitament att avgöra vilken grad av transparens som är den mest lämpliga för deras handelssystem.

5.5.5. Preliminära slutsatser

Att dra entydiga slutsatser i fråga om fragmentering, internalisering och transparens är inte lätt. Mycket tyder på att effektiviteten åtminstone i det korta perspektivet gynnas på en konsoliderad marknad där alla order kan interagera med varandra. Däremot tycks effektiviteten i dynamisk mening gynnas av konkurrens mellan

olika marknader, vilket implicerar fragmentering. En del forskning pekar på att fragmentering i vissa avseenden kan vara förmånligt även i det kortare perspektivet. Givet betydelsen av att det finns många olika slags aktörer med olika preferenser och olika motiv för att handla, bör regelverket sannolikt inte utformas så att det motverkar samexistens av konkurrerande system. De svårigheter som är förknippade med att skapa en uppsättning genomlysningsregler som är optimal för alla som handlar på värdepappersmarknaderna talar för att det bör lämnas stort utrymme för marknaderna själva att utforma dessa regler.

5.6. Referenser

Anderson, Ronald W. & Pierre Tychon. Competition among

European Financial Markets: The Case of Cross-Listed Belgian Equities. IRES Discussion Paper No. 9314 (4/1993), Revue de la Banque (1993). Angel, Jim. Who Gets Price Improvement on the NYSE? Working

paper, Georgetown University (1994). Battalio, Robert H. Third Market Broker-Dealers: Cost Competitors

or Cream Skimmers? Journal of Finance, Vol. 52, No. 1, s. 241

  • (2/1997).

Battalio, Robert H., Jason Greene & Robert Jennings. Do

Competing Specialists and Preferencing Dealers affect Market Quality? Review of Financial Studies, Vol. 10, No. 4, s. 969

(10/1997). Battalio, Robert H., Brian Hatch & Robert Jennings. Dimensions of

Best Execution for Market Orders: Assessing Differences between the NYSE and the Nasdaq Third Market. Georgia State University, University of Cincinnati, Kelley School of Business Indiana University (3/2000). Battalio, Robert H., Robert Jennings, & James P. Selway III. The

Relationship between Marketmaking Revenue, Payment for Order Flow, and Trading Costs for Market Orders. Georgia State University, University of Cincinnati, Kelley School of Business Indiana University, Goldman Sachs (2/2000). Bessembinder, Hendrik & Herbert M. Kaufman. A Cross-Exchange

Comparison of Execution Costs and Information Flow for the NYSE-Listed Stocks. Journal of Financial Economics, Vol. 46, No. 3, s. 293

  • (12/1997).

Biais, Bruno. Price Formation and Equilibrium Liquidity in

Fragmented and Centralised Markets. Journal of Finance, Vol. 48, s. 157

  • (1993).

Blume, Marshall E. The Structure of the US Equity Markets.

Working Paper 6-02, Rodney White Center for Financial Research, Wharton, University of Pennsylvania (2002). Blume, Marshall E. & Michael A. Goldstein. Differences in

Execution Prices among the NYSE, the Regionals, and the NASD. Working Paper 4-92, Rodney White Center for Financial Research, Wharton, University of Pennsylvania (1992). Blume, Marshall E. & Michael A. Goldstein. On the Integration of

the US Equity Markets. Rodney L. White Center for Financial Research Working Paper No. 1-95 (1995). Blume, Marshall E. & Michael A. Goldstein. Quotes, Order Flow,

and Price Discovery. Journal of Finance, Vol. 52, No. 1, s. 221

  • (3/1997).

Boehmer, Beatrice & Ekkehart Boehmer. Trading your Neighbor’s

ETFs: Competition or Fragmentation? Terry College of Business, University of Georgia & NYSE (11/6/2002). Burdett, Kenneth & Maureen O’Hara. Building Blocks: An

Introduction to Block Trading. Journal of Banking and Finance, Vol. 11, s. 193

  • (1987).

Chordia, Tarun & Avanidhar Subrahmanyam. Market Making, the

Tick Size, and Payment-for-Order Flow: Theory and Evidence. Journal of Business, Vol. 68, No. 4, s. 543

  • (10/1995).

Cohen, Kalman, Steven F. J. Maier, Robert A. Schwartz, & David

K. Whitcomb. An Analysis of the Economic Justification for Consolidation in a Secondary Security Market. Journal of Banking and Finance Vol. 6, No. 1, s. 117

  • (3/1982).

Conrad, Jennifer, Kevin Johnson, & Sunil Wahal. Alternative

Trading Systems. Working Paper, Kenan-Flagler Business School, University of North Carolina at Chapel Hill, Aronson Partners, Goizueta Business School, Emory University (5/2001). Demarchi, Marianne & Thierry Foucault. Equity Trading Systems

in Europe: A Survey of Recent Changes. Working Paper, SBF-Bourse de Paris, HEC and CEPR (2/1998). Demsetz, H. The Cost of Transacting. Quarterly Journal of

Economics, Vol. 82, s. 33

  • (1968).

Di Noia, Carmine. Competition and Integration among Stock

Exchanges in Europe: Network Effects, Implicit Mergers and Remote Access. Wharton, Financial Institutions Center, 98-03 (4/1/1998). Domowitz, Ian. Liquidity, Transaction Costs, and Reintermediation

in Electronic Markets. Working Paper (4/2001). Drudi, Francesco & Massimo Massa. Price Manipulation in Parallel

Markets with Different Transparency. European Central Bank and INSEAD, Department of Finance (1/2002). Easley, David, Nicholas M. Kiefer & Maureen O’Hara. Cream-

Skimming or Profit Sharing? The Curious Role of Purchased Order Flow. Journal of Finance, Vol. 51, No. 3, s. 811

(7/1996). Easley David, Nicholas M. Kiefer, Maureen O’Hara & J.B.

Paperman. Liquidity, Information and Infrequently Traded Stocks. Journal of Finance, Vol. 51, No. 4, 1405

  • (9/1996).

Easley David & Maureen O’Hara. Price, Trade Size and

Information in Securities’ Markets. Journal of Financial Economics, Vol. 19, s. 69

  • (1987).

European Asset Management Association. Best Execution:

Executing Transactions on Securities Markets on Behalf of Investors. Collection of Essays (6/2002). Financial Services Authority (FSA). Best Execution. Discussion

Paper (6/2001). Friederich, Sylvain & Ian Tonks. Competition between European

Equity Markets: Evidence from Dually-Traded French Stocks. Working Paper, FMG, London School of Economics & Université de Paris

  • I, Financial Markets Group, LSE &

University of Bristol (3/7/2001). Galetovic, Alexander & Felipe Zurita. Liquidity and the Simple IO

of Stock Exchanges. Working Paper, Centro de Economía Aplicada (CEA), Universidad de Chile, & Instituto de Economía, Ponticia Universidad Católica de Chile (3/2002). Grossman, Sanford J. The Informational Role of Upstairs and

Downstairs Trading. Journal of Business, Vol. 65, s. 509

(1992). Harris, Lawrence E. Consolidation, Fragmentation, Segmentation

and Regulation. Financial Markets, Institutions and Instruments, Vol. 2, No. 5, s. 1

  • (12/1993). Omtryckt i Robert

A. Schwartz, (red.). Global Equity Markets: Technological,

Competitive and Regulatory Challenges. Irwin Professional Publishing Chicago, IL (1995). Harris, Lawrence E. The Economics of Best Execution. Working

Paper, University of Southern California (9/3/1996). Harris, Lawrence E. Trading and Exchanges: Market Microstructure

for Practitioners. Oxford University Press, New York (10/2002). Hasbrouck Joel. Trade and Quote Transparency: Principles and

Prospects for the Year 2000 (1995). Omtryckt i Robert A. Schwartz (red.). Global Equity Markets: Technological, Competitive, And Regulatory Challenges. Irwin Professional Publishing Chicago, IL (1995). Keim, Donald B. & Ananth Madhavan. Transactions Costs and

Investment Style: An Inter-Exchange Analysis of Institutional Equity Trades. Journal of Financial Economics, Vol. 46, No. 3, s. 265

  • (12/1997).

Lin, S., G. Sanger & G. Booth. Trade Size and Components of the

Bid-Ask Spread. Review of Financial Studies, Vol. 8, No. 4, s. 1153

  • (10/1995).

Macey, Jonathan R. and Maureen O’Hara. The Law and Economics

of Best Execution. Journal of Financial Intermediation, Vol. 6, No. 3, s. 188

  • (7/1997).

Macey, Jonathan R. and Maureen O’Hara. Regulating Exchanges

and Alternative Trading Systems:A Law and Economics Perspective. Journal of Legal Studies, Vol. 28, s. 17

  • (1/1999).

Madhavan, Ananth. Consolidation, Fragmentation, and the

Disclosure of Trading Information. Review of Financial Studies, Vol. 8, No. 3, s. 579

  • (1995).

Madhavan, Ananth & Minder Cheng. In Search of Liquidity: Block

Trades in the Upstairs and Downstairs Markets. Review of Financial Studies, Vol. 10, No. 1, s. 175

  • (1/1997).

Madhavan, Ananth, David Porter & Daniel Weaver. Should

Securities Markets be Transparent? Marshall School of Business, USC at LA, College of Business and

Economics, University of Wisconsin, Zicklin School of Business, Baruch College (15/10/2001). Mayhew, Stewart. Competition, Market Structure, and Bid-Ask

Spreads in Stock Option Markets. Journal of Finance, Vol. 57, No. 2, s. 931

  • (4/2002).

Mendelson, Haim. Consolidation, Fragmentation, and Market

Performance. Journal of Financial and Quantitative Analysis, Vol. 22, No. 2, s. 189

  • (6/1987).

Mulherin J.H. Market Transparency: Pros, Cons and Property Rights.

Journal of Applied Corporate Finance, Vol. 5, No. 4 (Winter 1993). Naik, Narayan Y., Anthony Neuberger & S. Viswanathan. Trade

Disclosure Regulation in Markets with Negotiated Trades. Review of Financial Studies, Vol. 12, No. 4, s. 873

  • (7/1999).

Peterson, Mark A. & Erik R. Sirri. Order Preferencing and Market

Quality on U.S. Equity Exchanges. Working Paper, Southern Illinois University & Babson College (2002). Securities and Exchange Commission. Regulation of Exchanges and

Alternative Trading Systems. Release No. 34-40760; File No. S7-12-98 (8/12/1998). Seppi, Duane J. Equilibrium Block Trading and Asymmetric

Information. Journal of Finance, Vol. 45, No. 1, s. 73

(3/1990). Smith, Brian F., D. Alasdair S. Turnbull & Robert W. White.

Upstairs Market for Principal and Agency Trades: Analysis of Adverse Information and Price Effects. Journal of Finance, Vol. 56, No. 5, s. 1723

  • (10/2001).

Stoll, Hans R. Market Fragmentation. Financial Analysts Journal,

Vol. 57, No. 4, s. 16

  • (7/8-2001).

Tinic, Seha M. The Economics of Liquidity Services. Quarterly

Journal of Economics, Vol. 86, No.1, s. 79

  • (2/1972).

6. Några allmänna utgångspunkter

6.1. Handlingsplanen för finansiella tjänster och Lamfalussymodellen

Utvecklingen av lagstiftningen på värdepappersmarknadsområdet har sedan slutet av 1990-talet varit föremål för intensifierade harmoniseringsåtgärder inom EU. Mot bakgrund av de betydande välfärdsvinster som kunnat förväntas av ökad integration av de finansiella marknaderna ansågs det finansiella regelverket behöva harmoniseras. Ett grundläggande problem var att medlemsstaternas regelverk var så olika, att gränsöverskridande utbud av finansiella tjänster inom EU försvårades. Regelverken var dessutom i många avseenden omoderna och behövde uppdateras för att spegla förändringarna i den finansiella sektorn. För att få fart på integrationsprocessen presenterade kommissionen därför i maj 1999 en handlingsplan för finansiella tjänster (Financial Services Action Plan).

1

Handlingsplanen gick ut på att under perioden 2000

  • genomföra fyrtiotvå åtgärder, varav de flesta i form av nya direktiv. Europeiska rådet och Europaparlamentet har gett sitt stöd åt handlingsplanen. Av de fyrtiotvå åtgärderna har i dag fyrtio genomförts på gemenskapsnivå. En av åtgärderna var antagandet av direktivet om marknader för finansiella instrument, som ersätter det tidigare investeringstjänstedirektivet.

Ett annat problem var att lagstiftningsprocessen inom EU ansågs vara för långsam och stelbent för att hantera de snabba förändringarna i den finansiella sektorn. För att avhjälpa detta bildades ungefär ett år efter det att handlingsplanen för finansiella tjänster beslutats en kommitté av ”vise män”, ledda av belgaren Alexandre Lamfalussy. Kommitténs uppgift var att föreslå åtgärder för att förbättra mekanismerna för anpassning av det europeiska regelverket till den snabba förändringstakten i den finansiella sektorn.

1

Europeiska kommissionens meddelande Att genomföra handlingsramen för finansmark-

naderna: En handlingsplan, KOM (1999) 232.

Visemannakommittén presenterade ett antal rekommendationer som syftade till att effektivisera lagstiftningsprocessen.

2

Rekom-

mendationerna antogs av Europeiska rådet på dess möte i Stockholm i mars 2001 och har därefter godkänts av Europaparlamentet. Den nya modellen, som kommit att kallas Lamfalussyprocessen, innebär i korthet att regelgivningen delas upp på fyra olika nivåer, där övergripande principiella bestämmelser tas på den översta nivån i hierarkin, medan regler av mer teknisk natur och bestämmelser som har att göra med det nationella genomförandet utarbetas och beslutas på lägre nivåer.

På nivå ett fastställs allmänna principer enligt det normala lagstiftningsförfarandet inom EG-rätten, dvs. genom direktiv eller förordningar som föreslås av kommissionen och antas av rådet och Europaparlamentet. I dessa rättsakter delegeras åt kommissionen att utfärda genomförandebestämmelser i vissa hänseenden.

På nivå två antar kommissionen genomförandebestämmelser för att fylla ut eller anpassa de allmänna principer som beslutats på nivå ett. Dessa bestämmelser kan vara i form av såväl förordningar som direktiv. Kommissionen biträds i detta arbete av en ny kommitté, Europeiska värdepapperskommittén (European Securities Committee, ESC), bestående av företrädare för medlemsstaterna, som även skall fungera som en föreskrivande kommitté enligt artikel 5 i 1999 års ”kommittologibeslut”.

Nivå tre omfattar ett utökat samarbete mellan medlemsstaternas tillsynsmyndigheter för värdepappersmarknaderna. Samarbetet syftar bl.a. till att de bestämmelser som beslutats på nivåerna ett och två genomförs i lagstiftningen i de olika medlemsstaterna på ett konsekvent och likvärdigt sätt. För att organisera detta samarbete har ytterligare en kommitté inrättats av kommissionen, Europeiska värdepapperstillsynskommittén (Committee of European Securities Regulators, CESR). CESR har bl.a. till uppgift att vägleda kommissionen särskilt i fråga om utarbetande av utkast till genomförandeåtgärder på värdepappersområdet. I denna kommitté återfinns företrädare för medlemsstaternas tillsynsmyndigheter på värdepappersområdet.

Slutligen skall kommissionen på nivå fyra ta ett ökat ansvar för att säkerställa att gemenskapslagstiftningen genomförs i medlemsstaterna.

2

Committee of Wise Men, Final Report of the Committee of Wise Men on the Regulation

of European Securities Markets, Bryssel, 15 februari 2001.

Modellen har hittills använts i anslutning till fyra direktiv på värdepappersområdet. Lamfalussymodellen har även genom en överenskommelse med Europaparlamentet utvidgats till bank-, försäkrings- och fondområdena. I modellen ingår en strävan efter en bättre genomlyst process och breda konsultationer med berörda parter.

6.2. Genomförandebestämmelser till MiFID

MiFID har arbetats fram med Lamfalussymodellen som utgångspunkt. Därmed har det också på ett tidigt stadium stått klart att direktivet skulle komma att kompletteras med genomförandebestämmelser på nivå två. Lamfalussymodellen som den tillämpats i förevarande fall har medfört vissa svårigheter både för denna utredning och för de andra nationella utredningar som haft till uppgift att lägga fram förslag om hur MiFID ska genomföras i nationell rätt, eftersom arbetet med genomförandebestämmelserna varit mödosamt och utgången i många avseenden oviss.

Den 20 januari 2004, dvs. redan innan MiFID officiellt antagits, ingav kommissionen en preliminär begäran till Europeiska värdepapperstillsynskommittén (CESR) om tekniska råd avseende genomförandebestämmelser på en rad avsnitt i direktivet, (det s.k. första mandatet).

3

Den 25 juni 2004 kompletterade kommissionen

denna preliminära begäran med en formell begäran om ytterligare tekniska råd från CESR, (det s.k. andra mandatet).

CESR överlämnade i slutet av januari 2005 en första uppsättning tekniska råd till kommissionen som svar på det första mandatet.

4

I

början av maj 2005 överlämnades en andra uppsättning tekniska råd i respons på det andra mandatet samt på ett antal kvarvarande frågor från det första mandatet för vilka svarstiden hade förlängts.

5

Kommissionen och Europeiska värdepapperskommittén (ESC) har med utgångspunkt från CESR:s tekniska råd i ett antal arbetsdokument arbetat fram utkast till genomförandebestämmelser, som sedan har reviderats i olika omgångar.

3

The Provisional Mandate to CESR for Technical Advice on Possible Implementing

Measures concerning the Future Directive on Financial Instruments Markets” (”first set of mandates”), Bryssel, 20 januari 2004.

4

CESR’s technical advice to the European Commission on the first set of mandates under

the Directive on Markets in Financial Instruments (MiFID).

5

CESR’s Technical Advice on Possible Implementing Measures of the Directive 2004/39/C

on Markets in Financial Instruments –1st Set of Mandates where the deadlinje was extended and 2nd Set of Mandates.

Några slutliga genomförandebestämmelser har ännu inte antagits. Kommissionen har dock lämnat förslag till två rättsakter, ett direktiv och en förordning.

6

Efter omröstning i ESC och

eventuella synpunkter från parlamentet beräknas dessa kunna antas av kommissionen under hösten 2006. Som nämnts i kapitel 1 kallas förslagen i detta betänkande för genomförandedirektivet respektive genomförandeförordningen. Att genomförandeåtgärderna ännu inte är antagna innebär en betydande osäkerhet beträffande de av utredningens förslag som direkt anknyter till genomförandeåtgärderna. I den mån ändringar i förslagen sker fram till och med omröstningen i europeiska värdepapperskommittén kommer de ändringar i utredningens bedömningar som detta föranleder att redovisas i utredningens slutbetänkande den 14 juli 2006.

Utgångspunkten för genomförandeåtgärderna har från kommissionens sida varit att åstadkomma enhetliga lösningar för att undvika att medlemsstaterna i sina nationella regelverk lägger på ytterligare bestämmelser som de facto fungerar som konkurrenshinder (s.k. goldplating). För att åstadkomma detta har kommissionen valt att så långt det har varit möjligt använda förordningsformen.

7

Förordningen blir direkt tillämplig i medlemsstaterna och

några nationella regler på de områden som täcks av förordningen behövs inte (och får inte heller införas).

När det inte har ansetts möjligt eller lämpligt med regler i förordningsform har kommissionen valt att utforma reglerna i form av ett direktiv. Detta innebär att medlemsstaterna måste införliva direktivet genom nationella regler, med risk för nationella avvikelser. Genomförandedirektivet har dock utformats så att medlemsstaterna i princip endast får införa sådana nationella regler som är nödvändiga för att införliva direktivets bestämmelser. Enligt artikel 4 i genomförandedirektivet får medlemsstaterna införa ytterligare krav på de områden som täcks av det direktivet endast i exceptionella fall när dessa krav är objektivt motiverade och står i proportion till de särskilda risker som inte beaktats fullt ut i genomförandedirektivet avseende skyddet för investerare eller marknadens integritet. Därutöver krävs att de särskilda hot som ska åtgärdas antingen är av stor betydelse för den aktuella med-

6

Kommissionens förslag till genomförandeförordning, Working document ESC/9/2006-rev1,

och förslaget till genomförandedirektiv, Working document ESC/8/2006-rev1.

7

Se kommissionens ”background notes” till förslagen 2006-02-06 på kommissionens

hemsida. http://europa.eu.int/comm/internal market/securities/isd/mifid2 en.htm

lemsstatens marknadsstruktur eller har uppstått eller uppenbarats efter det att direktivet blev tillämpligt.

6.3. Behöriga myndigheter

Förslag: Finansinspektionen och Bolagsverket utses till behöriga myndigheter i MiFID:s mening.

Artikel 48 i MiFID föreskriver att varje medlemsstat skall utse de behöriga myndigheter som skall fullgöra var och en av de uppgifter som föreskrivs i de olika bestämmelserna i MiFID. Varje medlemsstat skall därefter informera kommissionen och de övriga medlemsstaterna om identiteten på de behöriga myndigheterna. De behöriga myndigheter som utses skall vara offentliga myndigheter.

Finansinspektionen är den myndighet i Sverige som i dag auktoriserar och har tillsyn över företag som bedriver värdepappersrörelse och marknadsplatser för finansiella instrument. Finansinspektionen har också ett internationellt kontaktnät med andra tillsynsmyndigheter vilket är av stor betydelse för att tillsynsmyndigheterna skall kunna samarbeta och bistå varandra med det informationsutbyte som föreskrivs i artikel 49. Mot den bakgrunden ter det sig naturligt att Finansinspektionen i huvudsak blir den behöriga myndigheten enligt MiFID.

Utredningen har i avsnitt 8.2 föreslagit att värdepappersinstituten ansvarar för att de anknutna ombuden registreras hos Bolagsverket (jfr artikel 23.3 i MiFID). Detta medför att även Bolagsverket i denna del kommer att bli behörig myndighet i MiFID:s mening.

6.4. Möjligheter att delegera vissa uppgifter till annan än den behöriga myndigheten

Bedömning: De möjligheter som MiFID ger att tillåta delegation av uppgifter till annat organ än sådant som utsetts till behörig myndighet bör inte utnyttjas.

Direktivet ger i några specifika fall möjligheter att delegera vissa uppgifter, främst av administrativ, förberedande eller sidoordnad karaktär, till andra organ än de myndigheter som utsetts till be-

höriga myndigheter. Eventuell delegering av uppgifter får emellertid inte innefatta offentlig myndighetsutövning eller befogenhet att göra skönsmässiga bedömningar.

Enligt utredningens bedömning skulle det från svensk synpunkt ha varit en betydande fördel om utrymmet för delegation hade varit större. Bl.a. skulle det i så fall ha funnits möjlighet att delegera vissa uppgifter rörande övervakning och sanktioner från Finansinspektionen till börs eller annan marknadsplats, vilket skulle har lett till klarare ansvarsförhållanden och mindre risk för dubbelarbete. På de speciella områden där delegation är tillåten är däremot behovet av delegation av uppgifter från Finansinspektionen litet. De möjligheter som direktivet ger till sådan delegation bör därför inte utnyttjas.

6.5. En ny lag

Förslag: De nya bestämmelserna som följer av MiFID genomförs huvudsakligen i en ny lag som ersätter lagen om värdepappersrörelse och börs- och clearinglagen. Huvuddelen av genomförandedirektivets bestämmelser genomförs genom föreskrifter. Detsamma gäller för de delar av genomförandeförordningen där medlemsstaterna har rätt att införa kompletterande regler.

Utredningen föreslår att huvuddelen av bestämmelserna i MiFID genomförs i lag. Genomförandeförordningen blir direkt gällande såsom lag i medlemsstaterna. Flertalet av förordningens bestämmelser riktar sig direkt till företagen, se t.ex. reglerna om dokumentation och kraven för att ta upp finansiella instrument till handel på en reglerad marknad. Dessa bestämmelser blir således omedelbart gällande för företagen och ska inte kompletteras av någon nationell reglering. I andra delar innehåller förordningen definitioner och definitionsliknade bestämmelser, t.ex. om utgångspunkter för bedömningen av vilka aktier som är likvida. Inte heller dessa bestämmelser ska följas upp med någon nationell reglering. Men förordningens bestämmelser i dessa delar avgör hur bestämmelser och begrepp i den svenska lagen ska tolkas. Slutligen ger genomförandeförordningen utrymme för nationell reglering i vissa frågor om dokumentation, transaktionsrapportering och upp-

skjuten publicering av stora transaktioner. Utredningen föreslår att regeringen eller den myndighet regeringen bestämmer, med vissa förbehåll, ges föreskriftsrätt på dessa områden.

8

Genomförande-

direktivet bör, med några få undantag,

9

genomföras i form av före-

skrifter. Enligt utredningens mening är genomförandedirektivets mycket snäva förutsättningar för en avvikande nationell reglering för närvarande inte uppfyllda.

10

Föreskrifterna får därför inte

innebära några, i förhållande till genomförandedirektivet, nya eller utvidgade krav på de områden som täcks av direktivet. När det slutligen gäller områden som varken täcks av genomförandeförordningen eller genomförandedirektivet är utredningens utgångspunkt att undvika nya regler som går längre än miniminivån i MiFID, se avsnitt 6.7 nedan. På några av dessa områden föreslår dock utredningen att regeringen eller den myndighet regeringen bestämmer ges föreskriftsrätt, se t.ex. om information om budpriser och avslutskurser avseende vissa finansiella instrument i avsnitt 10.4.2 och om emittenters offentliggörande av information i avsnitt 13.2.

När utredningen i betänkandet går igenom de olika bestämmelserna i MiFID respektive de två rättsakterna med genomförandebestämmelser ställs dessa mot den nuvarande regleringen i framför allt lagen om värdepappersrörelse och börs- och clearinglagen. Det är naturligt att de av MiFID påkallade bestämmelserna i så stor utsträckning som möjligt samlas i en och samma lag. Utredningen föreslår därför att en ny lag införs som ersätter lagen om värdepappersrörelse och börs- och clearinglagen. Lagen, som lämpligen bör betecknas lagen om värdepappersmarknaden, bör delas in i avdelningar för bl.a. värdepappersrörelse, reglerad marknad och clearingverksamhet för att på så sätt förenkla framtida anpassningar av regelverket som kommer att bli nödvändiga, bl.a. genom det fortsatta arbete som pågår inom EU på det finansiella området.

8

Se reglerna om dokumentation avsnitt 8.1.3, transaktionsrapportering i avsnitt 11.3.2 och

om uppskjutet offentliggörande i avsnitt 10.4.2.

9

Se t.ex. avsnitt 7.2.4 där utredningen föreslår att genomförandedirektivets bestämmelser

om godtagbara motparter tas in direkt i lagen.

10

Se artikel 4 i genomförandedirektivet.

6.6. Terminologi

Förslag: De nya begrepp och termer som införs i samband med de nya bestämmelserna bör så nära som möjligt ansluta sig till de begrepp och termer som används i MiFID.

I MiFID införs en rad facktermer och begrepp, exempelvis MTF, godtagbara motparter och systematisk internhandlare, som tidigare inte förekommit i svensk lagstiftning. Utredningen har därmed ställts inför valet mellan att anpassa vissa begrepp och termer i enlighet med ett språkbruk som ligger närmare svensk lagstiftningstradition eller att följa den terminologi som används i MiFID.

Eftersom MiFID kompletteras med bl.a. en direkt tillämplig genomförandeförordning, som innehåller hänvisningar till många av de begrepp som används i MiFID, och det skulle vara synnerligen opraktiskt att i svensk lagstiftning avvika alltför mycket från dessa begrepp, har utredningen i flertalet fall valt att tämligen nära ansluta sig till MiFID:s terminologi, även om denna inte alltid kan anses idealisk ur svensk språklig synvinkel. Därvid har utredningen också beaktat att åtminstone flertalet andra medlemsländer förefaller att ha valt att så långt möjligt ansluta sig till MiFID:s terminologi.

6.7. Förhållande mellan nationell reglering och gemenskapsregler

Förslag: De nya bestämmelserna bör inte utan starka skäl gå längre än MiFID:s minimibestämmelser.

Ett viktigt syfte bakom det nya gemensamma regelverket är att uppnå en harmonisering som underlättar gränsöverskridande verksamhet inom EU. Ett mer harmoniserat finansiellt regelverk bidrar till effektiviteten i den finansiella sektorn både i den mån det undanröjer bestämmelser som annars skulle fungera som direkta eller indirekta hinder mot konkurrens över gränserna och i den mån det minskar gränsöverskridande instituts administrativa börda av att hantera flera sinsemellan olikartade regelverk för en och samma verksamhet när denna bedrivs i flera länder. En viktig förutsättning för att uppnå detta är emellertid att medlemsstaternas

nationella regelverk inte lägger på ytterligare bestämmelser utöver det gemensamma regelverket som de facto fungerar som konkurrenshinder (goldplating) eller innehåller andra särbestämmelser som inte är påkallade av starka motiv. En utgångspunkt för utredningen har därför varit att undvika att i förslagen till nya lagbestämmelser gå längre än MiFID:s minimiregler försåvitt det inte föreligger starka skäl för detta.

6.8. Samordning inom Norden

Det är självfallet angeläget att det nationella genomförandet av de nya bestämmelserna blir så enhetligt som möjligt i de olika medlemsstaterna. För svensk del är samordningen inom Norden av särskild betydelse, inte minst eftersom exempelvis aktiemarknaden och den finansiella elmarknaden gått mot en alltmer nordisk eller nordisk-baltisk integration. Vidare betraktar många värdepappersinstitut i dag Norden som helhet som sin hemmamarknad. I strävan att så långt som möjligt uppnå nordisk samsyn i fråga om genomförandet av MiFID har utredningen vid ett flertal tillfällen haft överläggningar med företrädare för motsvarande kommittéer i de övriga nordiska länderna. Även om det kan anföras goda skäl för att utvidga samordningen till en större krets av länder har detta inte befunnits praktiskt genomförbart inom ramen för utredningens uppdrag.

7. Tillämpningsområde

7.1. Finansiella instrument

7.1.1. Inledning

Begreppet finansiellt instrument är av stor betydelse vid tillämpningen av olika regler på värdepappersområdet. Reglerna om marknadsmissbruk, värdepappersrörelse, börs- och clearing, prospekt osv. knyter alla an till begreppet. De flesta av regelverken utgår från den definition av begreppet som finns i 1 kap. 1 § handelslagen.

1

I definitionen av begreppet finansiella instrument ingår begreppet fondpapper, som definieras i samma paragraf.

Vad som är ett finansiellt instrument är också avgörande för MiFID:s tillämpningsområde. Det är när vissa tjänster och verksamheter avser sådana instrument som de kräver tillstånd. I MiFID finns en definition av begreppet i artikel 4.1.17. I artikel 4.1.18 finns även en definition av vilka finansiella instrument som är överlåtbara värdepapper. De nuvarande svenska definitionerna av finansiella instrument och fondpapper och MiFID:s definitioner stämmer inte helt överens. Behovet av en anpassning av den svenska definitionen till MiFID:s följer kanske inte i första hand av genomförandet av MiFID i sig utan snarare av att en mängd direktiv som ska genomföras, eller redan har genomförts, i Sverige utgår från MiFID:s definitioner av finansiella instrument och överlåtbara värdepapper.

2

Även om definitionerna i den svenska lagen

1

Se t.ex. 1 § 3 lagen (2005:377) om straff för marknadsmissbruk vid handel med finansiella

instrument, 1 kap. 4 § 9 börs- och clearinglagen, 2 § 6 lagen (1999:158) om investerarskydd och 1 § 1lagen (2000:1087) om anmälningsskyldighet för vissa innehav av finansiella instrument). I 1 kap. 1 § 6 lagen (2004:46) om investeringsfonder finns dock en egen definition av begreppet. Det beror på att den nuvarande svenska definitionen av finansiella instrument är något för vid i förhållande till de begränsningar som finns i det direktiv som lagen bygger på, se prop. 2002/03:150, s. 197 (i specialmotiveringen till definitionen anges dock att den i sak motsvarar definitionen i handelslagen, se a prop., s. 295).

2

Marknadsmissbruksdirektivet (2003/6/EG), prospektdirektivet (2003/71/EG), öppenhets-

direktivet (2004/109/EG) och direktivet om uppköpserbjudande (2004/25/EG).

respektive MiFID skiljer sig åt i flera avseenden är många av skillnaderna mer av språklig karaktär än skillnader i sak. För att försöka utröna vilka sakliga skillnader som finns inleds detta avsnitt med en beskrivning av definitionerna i sig. Därefter följer utredningens överväganden med en jämförelse av några olika moment i definitionerna och förslag till ändringar.

7.1.2. De svenska definitionerna i förhållande till MiFID:s

Med finansiellt instrument avses enligt 1 kap. 1 § handelslagen fondpapper och annan rättighet eller förpliktelse som är avsedd för handel på värdepappersmarknaden. Fondpapper definieras i samma paragraf som aktie och obligation samt sådana andra delägarrätter eller fordringsrätter som är utgivna för allmän omsättning, fondandel och depåbevis.

Enligt MiFID är finansiella instrument

  • överlåtbara värdepapper,
  • penningmarknadsinstrument,
  • andelar i företag för kollektiva investeringar (vilket för svensk del innebär fondandelar),
  • derivatkontrakt som avser värdepapper, valutor, räntor, avkastningar, andra derivatinstrument, finansiella index eller finansiella mått,
  • derivatkontrakt som avser råvaror, som måste avvecklas kontant eller kan avvecklas kontant på en av parternas begäran (på grund av ett annat skäl än utebliven betalning eller någon annan händelse som leder till kontraktets upphörande),
  • derivatkontrakt som avser råvaror som kan avvecklas fysiskt förutsatt att de handlas på en reglerad marknad eller en MTF,
  • derivatkontrakt som avser råvaror, som kan avvecklas fysiskt men inte omfattas av föregående punkt och som inte är för kommersiella ändamål, som anses ha egenskaper som andra derivat till finansiella instrument, med utgångspunkt från bland annat om clearing och avveckling sker via erkända avvecklingsorganisationer, eller om de är föremål för regelmässiga marginalsäkerhetskrav,
  • derivatinstrument för överföring av kreditrisk,
  • finansiella kontrakt avseende prisdifferenser,

derivatkontrakt som avser klimatvariationer, fraktavgifter, utsläppsrätter eller inflationstakten eller någon annan officiell ekonomisk statistik, som måste avvecklas kontant eller kan avvecklas kontant på en av parternas begäran (på grund av ett annat skäl än utebliven betalning eller någon annan händelse som leder till kontraktets upphörande), samt andra derivatkontrakt som avser tillgångar, rättigheter, skyldigheter, index och mått (men som inte omfattas av föregående punkter), som anses ha egenskaper som andra derivat till finansiella instrument, med utgångspunkt från bland annat om det handlas på en reglerad marknad eller en MTF, om clearing och avveckling sker via erkända avvecklingsorganisationer, eller om de är föremål för regelmässiga marginalsäkerhetskrav.

Även begreppen överlåtbara värdepapper och ”penningmarknadsinstrument” definieras i MiFID. Överlåtbara värdepapper är enligt artikel 4.1.18 värdepapper (utom betalningsmedel) som kan bli föremål för handel på kapitalmarknaden (are negotiable on the capital market). Som exempel på sådana anges därefter följande värdepapper :

a) aktier och andra värdepapper som motsvarar andelar i aktie-

bolag, bolag med personligt ansvar eller andra enheter samt depåbevis för aktier,

b) obligationer eller andra skuldförbindelser, inklusive depåbevis

för sådana värdepapper,

c) alla andra värdepapper som ger rätt att förvärva eller sälja

sådana överlåtbara värdepapper eller som resulterar i en kontantavveckling som beräknas utifrån noteringar för överlåtbara värdepapper, valutor, räntor eller avkastningar, råvaror, eller andra index eller mått.

Att märka är att penningmarknadsinstrument enligt artikel 4.1.19 ska ses som sådana kategorier av instrument som normalt omsätts på penningmarknaden. Som exempel anges här statsskuldväxlar, inlåningsbevis och företagscertifikat, med undantag av betalningsmedel.

7.1.3. Överväganden och förslag

Förslag: Den svenska definitionen av begreppet finansiella instrument ändras så att den överensstämmer med MiFID. Definitioner av överlåtbara värdepapper, fondandelar, penningmarknadsinstrument och vissa derivatinstrument införs för att den svenska definitionen av finansiella instrument ska överensstämma med MiFID.

Inledning

I Sverige har lagstiftaren avsiktligen avstått från att införa en specificerad definition av finansiella instrument. Termen fondpapper är i sig begränsad till några utpekade värdepapper men slutledet av definitionen av finansiella instrument – ”annan rättighet eller förpliktelse avsedd för handel på värdepappersmarknaden” – lämnar öppet för att även framtida nyskapelser på området ska kunna inrymmas i begreppet finansiella instrument. Syftet med denna öppna definition har varit skapa utrymme och legala ramar för nytillkommande former av värdepappershandel. Genom att det allmänna behållit möjligheten att påverka utformningen av nya instrument har förutsättningar skapats för trygghet i handeln även med nya instrument.

3

Även MiFID:s definition av finansiella instrument är till viss del öppen. Avsnitt C i bilaga I till direktivet innehåller visserligen en uppräkning av de olika instrument som ska betraktas som finansiella instrument. Men åtminstone en av de uppräknade instrumenttyperna, överlåtbara värdepapper (punkten 1), är i sig definierad på ett öppet sätt. Överlåtbara värdepapper är enligt artikel 4.1.18 sådana värdepapper ”som kan bli föremål för handel på kapitalmarknaden”. Därefter ges i artikeln en rad exempel på sådana värdepapper. I ISD var definitionen uppbyggd på ett annat sätt – uppräkningen av olika värdepapper var inte exempel utan det var de uppräknade värdepapperen och inga andra som var ”överlåtbara värdepapper”. Eftersom definitionen ändrats så att uppräkningen numera föregås av ”t.ex.” i den svenska versionen och ”such as” i den engelska, utgår utredningen från att det är fråga om en medveten övergång till en mer öppen definition.

3

Se prop. 1990/91:142, s. 91.

Vilka instrument som avses med definitionerna i punkterna 2–10 i avdelning C i bilaga 1 till MiFID framgår relativt tydligt av definitionerna själva – dessa instrument behandlas i egna avsnitt nedan. Först behandlas vilka instrument som bör anses ingå i gruppen överlåtbara värdepapper.

Överlåtbara värdepapper

De begrepp som är centrala i MiFID:s definition av överlåtbara värdepapper är ”överlåtbara”, ”värdepapper”, ”handel” och ”kapitalmarknaden”. Motsvarande begrepp återfinns även i den svenska definitionen av finansiella instrument och har varit föremål för förklaringar och tolkningar i både lagförarbeten och doktrin.

4

Kravet på överlåtbarhet måste innebära att de rättigheter som är förknippade med innehavet av papperet ska kunna överföras till någon annan. Det innebär att derivatinstrument som handlas på det sättet att den som t.ex. har köpt en option endast kan gå ur sin position genom att ingå ett motsatt optionskontrakt med en central motpart inte är överlåtbara värdepapper. Rättigheter (och förpliktelser) enligt sådana derivatkontrakt kan inte överföras till en annan part. Det sagda innebär att de standardiserade derivatinstrument som handlas enligt Stockholmsbörsens derivatregelverk inte är överlåtbara värdepapper medan andra derivatinstrument, t.ex. warranter som är överlåtbara kan vara överlåtbara värdepapper om de övriga kraven på ett överlåtbart värdepapper är uppfyllda.

5

Med begreppet värdepapper avses i svensk rätt – även om meningarna i doktrinen är något delade – s.k. presentations- eller legitimationspapper som karakteriseras av att den enligt papperet förpliktade inte får fullgöra sin prestation till någon annan än den som kan förete papperet.

6

En annan sida av samma sak kan sägas

vara att ett värdepapper ska vara negotiabelt, dvs. den som förvärvat det i god tro ska i princip inte kunna drabbas av sådan invändningar som hade kunnat riktas mot överlåtaren, något som brukar anses vara en förutsättning för att ett instrument ska lämpa sig för handel. Med nutida elektroniska värdepapper får begrepp som

4

Se t.ex. prop. 1990/91:142, s. 85 ff., bilaga 4 ”Är utsläppsrätter finansiella instrument?” i

betänkandet SOU 2004:62 och Beckman m. fl. Lagarna på värdepappersområdet, s. 99 ff.

5

Samma bedömning har gjorts i förarbetena till prospektreglerna i handelslagen, se prop.

2004/05:158, s. 67.

6

Se bilaga 4 ”Är utsläppsrätter finansiella instrument?” i betänkandet SOU 2004:62, s. 364 f.

och där angiven litteratur.

besittning och företeende av papper översättas med registrering om registreringen enligt lag får samma rättsverkningar som innehav av ett löpande papper.

7

Eftersom kravet på besittning/registrering har

betydelse för förhållandet till tredje man kan sådana instrument som kontoförs elektroniskt enbart med stöd av en avtalsreglering inte anses vara överlåtbara värdepapper, om inte registreringssystemet har utformats på det sättet att registreringar av överlåtelser får sakrättslig verkan enligt allmänna civilrättsliga principer.

När det i artikel 4.1.18 förutsätts att finansiella instrument ”are negotiable on the capital market” torde detta inte bara få ses som att instrumentet ska vara negotiabelt utan att det ska kunna vara föremål för handel. Detta innebär någonting annat och mera än enbart det förhållandet att värdepapperen kan överlåtas. Det svenska begreppet handel avser enligt förarbetena till den nuvarande definitionen allmän omsättning. Om förvärv av en rättighet kräver tillstånd eller godkännande kan rättigheten inte anses vara föremål för handel. Kommanditbolagsandelar och tillstånd att sända lokalradio är båda rättigheter men det krävs tillstånd av någon annan än säljaren för att få förvärva dem. Även om dessa rättigheter i och för sig kan överlåtas kan de inte anses vara föremål för handel. Aktier i privata aktiebolag får inte spridas till allmänheten. Sådana aktier får inte heller bli föremål för handel på en svensk eller utländsk börs eller någon annan organiserad marknadsplats.

8

Denna begränsning i omsättningen av sådana aktier innebär

dock inte i sig att aktier i privata bolag inte ska anses kunna vara föremål för allmän omsättning. Om dock bolaget har en hembudsklausul, eller ett förköps- eller samtyckesförbehåll i bolagsordningen torde det normalt innebära att aktierna inte kan bli föremål för allmän omsättning.

Enligt utredningens uppfattning motsvarar MiFID:s begrepp ”kapitalmarknaden” det svenska begreppet ”värdepappersmarknaden”. I svensk rätt avses med värdepappersmarknaden handel på börs eller annan organiserad marknadsplats eller genom någon som yrkesmässigt bedriver värdepappersrörelse enligt lagen om värdepappersrörelse. Definitionen härrör från insiderlagstiftningen men har ansetts vara vägledande för annan reglering på värdepappersområdet.

9

Detta leder dock i viss mån till ett cirkelresonemang –

om ett instrument handlas på värdepappersmarknaden kan det vara

7

Se lagen (1998:1479) om kontoföring av finansiella instrument.

8

1 kap.7 och 8 §§aktiebolagslagen (2005:551).

9

Se prop. 1990/91:142, s. 85 ff. och 141 ff.

ett överlåtbart värdepapper och om det är ett sådant papper kan det handlas på värdepappersmarknaden. Men i kravet på handel på värdepappersmarknaden torde också kunna läsas in att det ska vara fråga om en sådan omsättning att, åtminstone i princip, var och en kan förvärva instrumentet som en finansiell placering. Oberoende av vilka andra rättigheter förvärvaren har fått genom sitt innehav av instrumentet – t.ex. en rätt att släppa ut koldioxid (utsläppsrätter) eller en rätt att rösta på bolagsstämman (aktier) – måste instrumentet och handeln vara utformade så att en förvärvare också – åtminstone i teorin – kan omsätta rättigheten i reda pengar. Både kraven på att det ska vara fråga om ”värdepapper” och ”handel på värdepappersmarknaden” medför att t.ex. råvaror faller utanför begreppet överlåtbara värdepapper. Även om spotmarknaden för t.ex. el i flera avseenden kan likna handeln med värdepapper på en reglerad marknad är det elektrisk kraft i sig som handlas.

MiFID:s definition av överlåtbara värdepapper motsvarar således – förutom överlåtbara derivatinstrument – i stora delar det svenska begreppet fondpapper. Bl.a. aktier och andra delägarrätter, depåbevis och obligationer omfattas av begreppet överlåtbara värdepapper. Detta framgår även av de uppräknade exemplen i arti- kel 4.1.18.

Vissa av dagens fondpapper – fondandelar och penningmarknadsinstrument som t.ex. statsskuldväxlar – har dock fått egna definitioner i MiFID. Samtidigt kan dessa instrument uppfylla kraven på ”överlåtbara värdepapper”. Frågan är om de är delmängder av den övergripande kategorin överlåtbara värdepapper eller om det faktum att de fått egna definitioner innebär att de är undantagna från begreppet överlåtbara värdepapper. Vissa bestämmelser i MiFID och kommissionens genomförandeåtgärder synes utgå från att de instrument som fått egna definitioner inte ingår i begreppet överlåtbara värdepapper. Det frivilliga undantaget från direktivet i artikel 3 är t.ex. tillämpligt på sådana personer som inte utför andra investeringstjänster än mottagande och vidarebefordran av order avseende överlåtbara värdepapper och fondandelar. Vidare ställs olika – och oförenliga – krav för att överlåtbara värdepapper, respektive fondandelar, ska få tas upp till handel på en reglerad marknad.

10

Å den andra sidan går det knappast att dra någon skarp

gräns mellan t.ex. vissa penningmarknadsinstrument och överlåtbara värdepapper. Enligt utredningens mening måste definitionerna

10

Se artiklarna 35 och 36 i genomförandeförordningen.

överlappa varandra i viss mån och ett visst instrument kan samtidigt vara både ett penningmarknadsinstrument eller en fondandel och ett överlåtbart värdepapper. I den mån regler för olika instrumentkategorier, t.ex. reglerna om upptagande till handel, skiljer sig åt bör den specialreglering som uttryckligen tar sikte på penningmarknadsinstrument eller fondandelar tillämpas före den allmänna reglering som avser överlåtbara värdepapper.

Även några av de instrument som i dagens svenska definition är finansiella instrument därför att de är en ”annan rättighet eller förpliktelse avsedd för värdepappersmarknaden” är överlåtbara värdepapper enligt MiFID. Så förhåller det sig t.ex. med warranter och andra derivatinstrument som kan överlåtas, se ovan.

11

Även ut-

släppsrätter och elcertifikat är med MiFID:s definition överlåtbara värdepapper. En utsläppsrätt enligt lagen (2004:1199) om handel med utsläppsrätter innebär en rätt att frigöra ett ton koldioxid i atmosfären. Tilldelningen av utsläppsrätter sker till den som driver viss verksamhet (t.ex. förbränningsanläggning, oljeraffinaderi m.m.) och har tillstånd att släppa ut koldioxid. Efter tilldelningen kan utsläppsrätten fritt omsättas på marknaden. Tillståndsgivningen sköts av länsstyrelserna och tilldelningen av Naturvårdsverket. En utsläppsrätt kan således beskrivas som ett myndighetstillstånd som kan överlåtas. Enligt förarbetena till lagen om handel med utsläppsrätter ska utsläppsrätter anses vara finansiella instrument enligt den definition som i dag finns i 1 kap. 1 § handelslagen eftersom de är rättigheter som är avsedda för fri omsättning på värdepappersmarknaden.

12

Vid bedömningen hänvisas till att också elcertifikat enligt

lagen (2003:113) om elcertifikat är finansiella instrument. I förarbetena till lagen om elcertifikat angavs att elcertifikat är finansiella instrument eftersom de är bärare av en rättighet och är avsedda att fritt omsättas på en marknad. Både utsläppsrätter och elcertifikat är finansiella instrument för att de omfattas av den del av den svenska definitionen som lyder: ”…annan rättighet eller förpliktelse som är avsedd för handel på värdepappersmarknaden”. Eftersom instrumenten också är överlåtbara är de, i konsekvens med utredningens tolkning av definitionen, överlåtbara värdepapper i MiFID:s mening.

11

En uppdelning av optioner i överlåtbara och icke överlåtbara instrument baserad enbart på hur handeln i instrumentet organiseras är dock knappast lämplig i alla sammanhang – när det gäller t.ex. kraven på riskinformation till icke-professionella kunder är frågan om en option är överlåtbar inte det avgörande. Kravet bör vara detsamma om kundens risk att förlora sina pengar är densamma vid en placering i en överlåtbar option som i en icke överlåtbar.

12

Prop. 2004/05:18, s. 38 ff.

Begreppet fondpapper finns inte i MiFID och bör enligt utredningens mening inte ingå i definitionen av finansiella instrument i lagen om värdepappersmarknaden. En definition av överlåtbara värdepapper – utformad som i MiFID – bör istället införas. Uttrycket fondpapper används visserligen på olika håll i både lagar och t.ex. enskilda institutioners placeringsbestämmelser och liknande. I t.ex. handelslagen och marknadsmissbrukslagen bör definitionerna av finansiella instrument och fondpapper ersättas med hänvisningar till definitionen av finansiella instrument i den nya lagen om värdepappersmarknaden. I andra lagar, t.ex. lagen om investeringsfonder, finns en uttrycklig definition av begreppet fondpapper, som skiljer sig från handelslagens definition. I dessa fall utgör det inte något problem att begreppet försvinner ur handelslagen. I andra lagar och föreskrifter där begreppet förekommer utan någon egen definition bör det ersättas med en beskrivning av de finansiella instrument som avses. När begreppet använts i t.ex. avtal, placeringsinstruktioner och fondbestämmelser bör begreppet till dess parterna bestämmer något annat anses ha den betydelse det hade före lagändringen.

Utredningen förutsätter att en ny definition av begreppet finansiella instrument måste bli föremål för en direktivkonform tolkning. Till detta och en del andra frågor rörande definitionen återkommer utredningen i författningskommentaren.

Fondandelar och penningmarknadsinstrument

Termen ”andelar i företag för kollektiva investeringar” i den svenska versionen av MiFID kan ge intryck av att omfatta mer än investeringsfonder, t.ex. aktier i ett onoterat riskkapitalbolag. Både den svenska och engelska versionen (units in collective investment undertaking) knyter dock an till den terminologi som används i UCITS-direktivet (85/611/EEG) för att beskriva det som i Sverige benämns investeringsfonder. Termen är etablerad inom EG-rätten och man kan utgå från att betydelsen är densamma i MiFID dvs.: med andelar i företag för kollektiva investeringar avses andelar i investeringsfonder. Begreppet är dock inte begränsat till sådana fonder som omfattas av UCITS-direktivet – om detta varit meningen måste man utgå från att det skulle ha angetts i direktivtexten. Även sådana fonder som enligt lagen om investeringsfonder kallas specialfonder omfattas. I dessa fall förutsätts inte överlåtbarhet.

När det gäller penningmarknadsinstrument finns det en svensk legaldefinition i 1 kap. 1 § 18 i lagen om investeringsfonder. Den definitionen gäller dock investeringsfonder och utgår från artikel 1.9 i UCITS-direktivet som inte stämmer överens med MiFID:s definition av penningmarknadsinstrument i artikel 4.1.19. En förutsättning för att en företeelse ska vara ett penningmarknadsinstrument enligt MiFID är att det är fråga om ett instrument. Det gör att s.k. deposits som handlas på penningmarknaden inte är sådana penningmarknadsinstrument som avses med direktivet. En deposit är inte något instrument – det går inte att ha en deposit registrerad på ett avstämningskonto hos VPC, en depå eller något annat system för kontoföring av finansiella instrument. Det är istället fråga om inlåning – närmare bankkonton än finansiella instrument.

För att åstadkomma en definition av finansiella instrument som överensstämmer med MiFID och samtidigt skilja ut fondandelar och penningmarknadsinstrument från begreppet överlåtbara värdepapper bör särskilda definitioner av både fondandelar och penningmarknadsinstrument införas i lagen. Som utredningen konstaterat ovan kommer definitionerna dock att överlappa varandra i viss mån. Fondandelar och penningmarknadsinstrument kan också samtidigt vara överlåtbara värdepapper.

Derivatinstrument

De derivatinstrument som inte är överlåtbara ryms inom definitionerna i punkterna 4–10 under avsnitt C i bilaga 1 till direktivet. Här återfinns dels derivat med värdepapper och andra finansiella tillgångar som underliggande tillgångar (punkterna 4, 8 och 9) men också derivatinstrument med helt andra underliggande tillgångar som råvaror, utsläppsrätter och klimatvariationer (punkterna 5, 6, 7 och 10). Enligt utredningens uppfattning går det att återanvända termen ”annan rättighet eller förpliktelse avsedd för handel på värdepappersmarknaden” med en något modifierad betydelse för att fånga in samtliga dessa instrument i definitionen av finansiella instrument. Ordet kapitalmarknaden bör dock användas i stället för värdepappersmarknaden för att dels markera den ändrade betydelsen och för att använda samma begrepp som i definitionen av överlåtbara värdepapper. I sak betyder dock begreppen detsamma.

Instrument som hör till kategorin derivatinstrument som har andra finansiella instrument som underliggande tillgångar och som

handlas på en reglerad marknad eller genom ett värdepappersinstitut omfattas av det svenska begreppet ”annan rättighet eller förpliktelse avsedd för handel på värdepappersmarknaden” i dess nuvarande betydelse. En viss osäkerhet har rått om även s.k. OTCderivat omfattas. Sådana derivatkontrakt behöver inte vara standardiserade på det sättet att ett antal utbytbara instrument samtidigt är föremål för handel. Enligt förarbetena till dagens definition är t.ex. terminskontrakt på statsskuldsväxlar där parterna bestämt kontraktsbeloppen efter förhandling och dessa således kan variera från det ena kontraktet till det andra inte finansiella instrument, även om kontrakten är standardiserade i alla andra avseenden än beträffande kontraktsbeloppet. I den mån ett värdepappersinstitut medverkar vid ingåendet av derivatkontraktet – som motpart eller genom att sammanföra kontraktsparterna – bör dock sådana kontrakt med en direktivskonform tolkning av begreppet ”annan rättighet…” anses vara finansiella instrument.

För att de derivatinstrument som har råvaror m.m. som underliggande tillgång ställer MiFID krav på att instrumenten kan kontantavräknas eller att handel eller clearing motsvarar eller liknar den handel och clearing som sker för derivatinstrument med värdepapper som underliggande tillgång. Enligt utredningens mening kan även dessa krav inrymmas under begreppet ”rättighet eller förpliktelse avsedd för handel på värdepappersmarknaden”. När instrumenten kan kontantavräknas eller handeln/avvecklingen i hög grad liknar handeln med derivat med finansiella instrument som underliggande tillgång kan man säga att instrumenten inte längre enbart är till för att säkra leveranser eller betalningar för råvaror m.m. utan de kan även användas som finansiella placeringar. Begreppet ”annan rättighet eller förpliktelse avsedd för handel på värdepappersmarknaden” i denna nya betydelse ska tolkas direktivkonformt och vid tveksamhet om en viss rättighet är ett finansiellt instrument eller inte ska tolkningen utgå från uppräkningen av derivatinstrument i MiFID samt från de förtydliganden som gjorts i artiklarna 38 och 39 i genomförandeförordningen.

13

13

I artikel 38 i förordningen anges förutsättningarna för att sådana råvaruderivat som avses i punkten 7 under avsnitt C i bilaga 1 till MiFID ska anses ha egenskaper motsvarande finansiella derivatinstrument. De råvaruderivat som avses är sådana som kan avvecklas fysiskt men inte handlas på en reglerad marknad eller MTF. I artikel 39 anges förutsättningarna för att sådana derivatinstrument som avses i punkten 10 under avsnitt C i bilaga 1 till MiFID (t.ex. derivatinstrument med klimatvariationer som underliggande tillgång) ska anses ha egenskaper motsvarande finansiella derivatinstrument. Eftersom många av de företag som handlar med de instrument som avses i artiklarna 38 och 39 i genomförandeförordningen faller utanför direktivets tillämpningsområde på grund av undantagsreglerna i MiFID, se

7.2. Olika kundkategorier

7.2.1. Professionella och icke-professionella investerare

I MiFID finns en uppdelning av kunderna i professionella och ickeprofessionella kunder, se bilaga II till MiFID. Direktivets skyddsregler för investerare (t.ex. informationsutbyte, lämplighetsbedömningar osv.) är olika högt ställda beroende på vilken kategori kunden tillhör. Skyddet är mer omfattande för icke-professionella än för professionella kunder. Skillnaderna framgår inte av huvuddirektivet men väl av kommissionens genomförandebestämmelser. Dessutom följer av artikel 24 i direktivet att några av de professionella kunderna är jämbördiga motparter (eligeble counterparties i den engelska versionen) och då ska investerarskyddsreglerna i artiklarna 19 (informationsutbyte och lämplighetsbedömningar), 21 (bästa orderutförande) och 22.1 (orderhantering i övrigt) under vissa förutsättningar inte tillämpas alls.

Förutom för tillämpningen av skyddsreglerna har kategoriseringen av kunderna också betydelse för tillämpningen av reglerna om systematiska internhandlare i artikel 27.

Kunder som är professionella med automatik

Professionella kunder är enligt MiFID

1. Enheter som är underkastade auktorisation och reglering för att få arbeta på de finansiella marknaderna:

a) Kreditinstitut.

b) Värdepappersföretag.

c) Andra auktoriserade eller reglerade finansinstitut.

d) Försäkringsföretag.

e) System för kollektiva investeringar och deras förvaltningsbolag.

f) Pensionsfonder och deras förvaltningsbolag.

g) Råvaruhandlare och råvaruderivathandlare.

h) Lokala företag (locals i den engelska versionen av direktivet, ett

uttryck som syftar på sådana företag som omfattas av undantaget i artikel 2.1 l, se avsnitt 9.4 nedan).

i) Andra institutionella placerare.

avsnitt 7.5, behöver dessa företag inte göra någon bedömning av huruvida de instrument de handlar med är finansiella instrument eller inte, se skäl 22 i ingressen till genomförandeförordningen.

2. Stora företag som på bolagsnivå uppfyller två av följande storlekskrav: – Total balansomslutning: 20 000 000 euro – Nettoomsättning: 40 000 000 euro – Tillgångar (eget kapital): 2 000 000 euro

3. Nationella och regionala regeringar, offentliga organ för förvaltning av statsskulden, centralbanker, internationella och överstatliga institutioner som Världsbanken, IMF, ECB, EIB och liknande internationella organisationer.

4. Andra institutionella investerare vars huvudverksamhet är att investera i finansiella instrument, inklusive företag som ägnar sig åt värdepapperisering av tillgångar eller andra finansiella transaktioner.

En kund som hör till någon av ovanstående kategorier betraktas som professionell med automatik men värdepappersföretaget måste meddela kunden att företaget, på grundval av den information som företaget har tillgång till, betraktar kunden som professionell. Detta måste värdepappersföretaget informera om inför tillhandahållande av en tjänst. Det är tillräckligt om informationen lämnas en gång när företaget börjar tillhandahålla tjänsten. En professionell kund kan begära att bli behandlad som icke-professionell generellt, vid utförandet av någon viss tjänst eller vid utförandet av någon viss tjänst avseende vissa särskilda instrument eller produkter. För att kunden ska behandlas som icke-professionell krävs dock att värdepappersföretaget samtycker till det och detta ska framgå av avtalsvillkoren mellan kunden och värdepappersföretaget. Ett värdepappersföretag ska informera kunden om att denne kan begära en ändring av avtalsvillkoren för att få den högre skyddsnivån.

Kunder som kan begära att bli behandlade som professionella kunder

En mellankategori av kunder kan själva begära att bli behandlade som professionella kunder. För att ett värdepappersföretag ska kunna behandla en av dessa kunder som professionell måste vissa kriterier vara uppfyllda och vissa förfaranden följas.

Enligt avsnitt II bilaga II till MiFID ska kategoriseringen som professionell kund grundas på en adekvat bedömning från värdepappersföretagets sida av kundens expertis, erfarenhet och kunskaper som ger tillräcklig grund för att anta att kunden med tanke på de planerade transaktionernas och tjänsternas karaktär är i stånd att fatta sina egna investeringsbeslut och förstå de ifrågavarande riskerna.

Vid denna bedömning bör minst två av följande kriterier vara uppfyllda:

  • Kunden har på marknaden i fråga utfört i genomsnitt minst tio transaktioner av betydande storlek per kvartal under de föregående fyra kvartalen.
  • Värdet av kundens portfölj av finansiella instrument, definierad som kontantdepositioner och innehav av finansiella instrument, överstiger 500 000 euro.

Kunden arbetar, eller har arbetat, minst ett år inom finanssektorn i en befattning som kräver kunskap om

transaktionerna

eller tjänsterna i fråga.

För att kunder som uppfyller kriterierna ska få avstå sitt skydd som icke-professionella kunder måste följande förfarande följas

  • Kunderna måste skriftligen meddela värdepappersföretaget att de önskar behandlas som professionella kunder, antingen allmänt eller i fråga om en särskild investeringstjänst eller transaktion eller en viss typ av transaktion eller produkt.
  • Värdepappersföretaget måste ge dem en tydlig skriftlig varning om vilken rätt till skydd och ersättning till investerare som de kan förlora.
  • Kunderna måste i ett från avtalet skilt dokument skriftligen förklara att de är medvetna om följderna av att detta skydd förloras.

Icke-professionella kunder

Kunder som inte är professionella enligt något av alternativen ovan är icke-professionella kunder och för dem gäller bl.a. de mer långtgående skyddsreglerna i genomförandebestämmelserna och bestämmelsen i artikel 27 om att en systematisk internhandlare enligt

huvudregeln är skyldig att utföra en order till det pris som gällde då ordern mottogs (se avsnitt 10.2.3).

7.2.2. Godtagbara motparter

Vissa professionella kunder är enligt artikel 24 i MiFID s.k. jämbördiga motparter. I den engelska versionen av direktivet kallas dessa eligible counterparties och i den svenska versionen godtagbara motparter. Begreppet godtagbara motparter leder dock enligt utredningens uppfattning tanken fel och i det följande används det mer adekvata begreppet jämbördiga motparter. Enligt artikel 24 ska investerarskyddsreglerna i artiklarna 19, 21 och 22.1 inte tillämpas alls när värdepappersföretagen gör transaktioner med jämbördiga motparter.

Det finns två kategorier av jämbördiga motparter. För det första ska enligt artikel 24.2 följande kunder anses som jämbördiga motparter:

  • värdepappersföretag,
  • kreditinstitut,
  • försäkringsföretag,
  • fondföretag och deras förvaltningsbolag,
  • pensionsfonder och deras förvaltningsbolag,
  • övriga finansiella institut som auktoriserats eller reglerats enligt gemenskapslagstiftningen eller en medlemsstats nationella lagstiftning,
  • företag som är undantagna enligt artikel 2.1 k och l,
  • nationella regeringar och därmed sammanhängande organ, inklusive offentliga organ som har hand om statsskuld,
  • centralbanker och
  • överstatliga organisationer.

Dessa enheter motsvarar professionella kunder enligt punkterna 1 och 3 i avsnitt I i bilaga II till MiFID. För dessa motparter ska skyddsreglerna inte tillämpas om de inte begär det, se artikel 24.2 andra stycket. En sådan begäran kan ske generellt eller för en enskild affär.

Därutöver får medlemsstaterna enligt artikel 24.3, som jämbördiga motparter erkänna andra företag (även i tredje land, arti- kel 24.4 andra stycket) som uppfyller i förväg bestämda proportionerliga krav. Dessa krav motsvarar enligt artikel 50.1 första

stycket i genomförandedirektivet kunder som är professionella enligt punkterna 1, 2 och 3 i avsnitt I i bilaga II till MiFID. Enligt utredningens uppfattning omfattas dock samtliga kunder som är professionella enligt punkterna 1 och 3 i avsnitt I i bilaga II till MiFID redan av uppräkningen i artikel 24.2. Den enda nya kategori som därutöver tillkommer genom artikel 50.1 första stycket är stora företag enligt punkten 2 i avsnitt I i bilaga II till MiFID. Dvs. företag som uppfyller två av följande kriterier;

  • Total balansomslutning: 20 000 000 euro
  • Nettoomsättning: 40 000 000 euro
  • Tillgångar (eget kapital): 2 000 000 euro

Som jämbördiga motparter kan medlemsstaterna också erkänna sådana professionella kunder som kan vara ”frivilligt professionella” enligt avsnitt II i bilaga II till MiFID. I artikel 50.1 andra stycket i genomförandeförordningen anges att medlemsstaterna kan erkänna sådana ”undertakings” som anges i nämnda bilaga. I bilagan sägs dock inget om ”undertakings” vilket kan tolkas som att förutsättningarna för att klassificera en kund som jämbördig motpart är snävare än för att klassificera någon som professionell. Ordalydelsen kan dock inte tolkas som att endast juridiska personer skulle kunna vara jämbördiga motparter utan även fysiska personer kan vara jämbördiga motparter om kriterierna är uppfyllda.

För att ett värdepappersföretag ska få behandla dessa motparter som jämbördiga krävs att värdepappersföretaget inhämtar ett uttryckligt godkännande från motparten.

7.2.3. Sammanfattning

Skyddsbestämmelserna i artiklarna 19, 21 och 22.1 är tillämpliga både på professionella och icke-professionella kunder. Men kraven i genomförande bestämmelserna kommer att vara olika långtgående för de olika kundkategorierna.

14

Artikel 24 innebär dock att vissa professionella kunder – de som också är jämbördiga motparter – under vissa förutsättningar undantas från skyddsreglerna helt och hållet. Förutsättningarna för detta är dock olika beroende på vem motparten är. För jämbördiga

14

Se artiklarna 19.10 c och 21.6 a.

motparter enligt artikel 24.2 – vissa tillståndspliktiga företag m.fl. – är utgångspunkten att skyddsreglerna inte gäller om inte motparten begär det. För jämbördiga motparter enligt artikel 24.3 – frivilligt professionella – är det tvärtom. Skyddsreglerna gäller om parterna inte uttryckligen kommer överens om att de inte ska gälla.

7.2.4. Överväganden och förslag

Förslag: Definitionen av professionella kunder hänvisar till bilaga II i MiFID.

Vissa av kundskyddsreglerna ska inte tillämpas på sådana professionella investerare som antingen

a) inte begärt att skyddsreglerna ska tillämpas (professionella

investerare enligt punkterna 1 eller 3 i avsnitt I i bilaga II till MiFID), eller

b) uttryckligen har accepterat att skyddsreglerna inte ska tilläm-

pas (professionella investerare enligt punkten 2 i avsnitt II i bilaga II till MiFID).

Inledning

MiFID:s kundkategorier professionella och icke-professionella (samt jämbördiga motparter) skiljer sig från de svenska begreppen konsumenter och näringsidkare. Många näringsidkare kommer att betraktas som icke-professionella kunder, t.ex. små och medelstora företag som inte bedriver verksamhet inom den finansiella sektorn. Samtidigt kommer vissa konsumenter att frivilligt kunna begära att betraktas som professionella kunder. Detta utgör inte något problem i förhållande till de lagar som utredningen föreslår ska ersättas med en ny lag om värdepappersmarknaden (lagen om värdepappersrörelse och börs- och clearinglagen) men väl i förhållande till den nuvarande utformningen av lagen (2003:862) om finan- siell rådgivning till konsumenter (rådgivningslagen). Förhållandet mellan MiFID och rådgivningslagen behandlas i avsnitt 12.2.2. Fondkommissionsutredningen har föreslagit att vissa av kommissionslagens skyddsregler för kommittenter ska vara tvingande, dels till förmån för konsumenter, dels till förmån för andra än konsumenter till viss del. Problemet med undantaget från skydds-

reglerna för professionella kunder och jämbördiga motparter har dock tagits om hand i Fondkommissionsutredningens lagförslag.

Utformningen av definitionerna och reglerna

De olika nivåerna på skyddsbestämmelser för professionella och icke-professionella kunder kommer visserligen inte att framgå av den föreslagna lagen men väl av genomförandebestämmelserna – som till viss del är i förordningsform. Enligt utredningens uppfattning bör definitionen av professionella kunder därför finnas i den svenska lagen så att de olika skyddsnivåerna i genomförandebestämmelserna sedan ska kunna tillämpas på rätt kundkategorier. Dessutom föreslår utredningen att bestämmelserna om att avsluta kunders order mot fasta bud (artikel 27) ska genomföras genom bestämmelser i lagen. Eftersom denna skyldighet gäller order från icke-professionella investerare kräver en sådan lösning att definitionen finns i lagen.

Sättet att definiera professionella investerare i MiFID är väldigt ordrikt och definitionen innehåller förutom en uppräkning av olika typer av företag och kriterier också en beskrivning av olika förfaranden och åtgärder som ska vidtas. Definitionen passar därför dåligt i en traditionell svensk definitionsparagraf. Utredningen föreslår därför att en definition i lagen hänvisar direkt till bilaga II till MiFID.

Förutom jämbördiga motparter enligt artikel 24.2 kan som nämnts ovan medlemsstaterna enligt artikel 24.3 i direktivet även godkänna andra företag m.m. som jämbördiga motparter. Denna möjlighet kommer att utnyttjas i vart fall i de övriga nordiska länderna, se t.ex. det norska förslaget, NOU 2006:3 s. 87. För att de svenska företagen ska kunna konkurrera på lika villkor i EES bör möjligheten utnyttjas även i svensk rätt.

Bestämmelserna om jämbördiga motparter bör tas in i lagen, med hänvisningar till den relevanta delar av den nämnda bilagan, som anger hur de olika motpartskategorierna påkallar respektive avsäger sig, tillämpningen av skyddsreglerna.

Begreppet konsumenter i förhållande till begreppet professionella kunder

Som framgått ovan innebär kategoriseringen av kunder i professionella och icke-professionella kunder en nyhet i svensk rätt. Eftersom begreppen inte överensstämmer med de svenska begreppen konsumenter och näringsidkare skulle detta kunna leda till en del problem vid tillämpningen av de lagar och andra föreskrifter där de senare begreppen används.

15

Varken konsumentköplagen

(1990:932) eller konsumenttjänstlagen (1985:716) blir visserligen tillämpliga på det område som täcks av MiFID.

16

Däremot är

många andra lagar på konsumentskyddsområdet tillämpliga, t.ex. rådgivningslagen, distans- och hemförsäljningslagen (2005:59), konsumentkreditlagen (1992:830) och lagen (1994:1512) om avtalsvillkor i konsumentförhållanden. Flera av de tillämpliga konsumentskyddslagarna bygger för övrigt på, eller har anpassats till, EG-direktiv. De problem som skulle kunna uppstå består främst i att vissa kunder som är professionella (eller till och med jämbördiga motparter) i MiFID:s mening även skulle kunna vara konsumenter enligt konsumentskyddslagstiftningen.

17

Enligt ut-

redningens uppfattning är det inte rimligt att en kund som enligt MiFID är professionell och därmed omfattas av begränsade skyddsregler, samtidigt ska omfattas av konsumentskyddsreglerna i t.ex. konsumentkreditlagen eller distans- och hemförsäljningslagen. Det kan inte heller uteslutas att en sådan tillämpning av konsumentskyddslagstiftningen i vissa fall skulle strida mot MiFID. Även om konsumentskyddslagstiftningen i fråga bygger på EGdirektiv bör MiFID:s regler, i egenskap av specialreglering, ha företräde. Professionella kunders ianspråkstagande av värdepappersinstitutens tjänster bör anses vara av yrkesmässig karaktär och därför bör kunderna inte betraktas som konsumenter vid en

15

Som utredningen har uppfattat det innebär dessa nya kundkategorier även en nyhet inom EG-rätten. Där har det sedan länge funnits ett etablerat konsumentbegrepp som används även på det finansiella området, se t.ex. konsumentkreditdirektivet, 87/102/EG (se även kommissionens förslag till nytt konsumentkreditdirektiv COM (2002) 443 final), och direktivet om distansförsäljning av finansiella tjänster, 2002/65/EG. Det bör även noteras att konsumentbegreppet också används i artikel 53 i MiFID. Kategoriseringen professionella och icke-professionella kunder har inom EG-rätten, såvitt utredningen känner till, endast funnits i CESR:s rekommendationer för tolkningen av vissa artiklar i ISD.

16

Se 1 § konsumentköplagen och 1 § konsumenttjänstlagen.

17

Att vissa näringsidkare betraktas som icke-professionella i MiFID:s mening bör i sig inte innebära något problem vid tillämpningen av konusmentskyddsreglerna – en näringsidkare kan inte betraktas som konsument oavsett om han är professionell eller inte i MiFD:s mening.

tillämpning av konsumentskyddslagtsiftningen på de tjänster som omfattas av MiFID.

18

7.3. Värdepappersrörelse

7.3.1. Investeringstjänster

Reglerna i MiFID och svensk rätt

Den tillståndspliktiga verksamhet som värdepappersinstituten bedriver – värdepappersrörelsen – är i dag definierad som en eller flera verksamheter enligt 1 kap. 3 § första stycket lagen om värdepappersrörelse. Verksamheterna är:

1. handel med finansiella instrument för annans räkning i eget

namn,

2. förmedling av kontakt mellan köpare och säljare av finansiella

instrument eller i annat fall medverkan vid transaktioner avseende sådana instrument,

3. handel med finansiella instrument för egen räkning,

4. förvaltning av någon annans finansiella instrument,

5. garantigivning eller annan medverkan vid emissioner av fond-

papper eller erbjudanden om köp eller försäljning av finansiella instrument som är riktade till en öppen krets.

Definitionerna av de olika verksamheterna härrör i några fall, t.ex. avseende kommissionsverksamheten, från beskrivningar i 1979 års fondkommissionslag. Bestämmelserna fick sin nuvarande utformning 1991 i lagen om värdepappersrörelse. Vid denna tidpunkt fanns det ett förslag till ISD från kommissionen som man tog hänsyn till vid utformningen av de svenska reglerna.

19

När ISD

några år senare skulle genomföras i Sverige ansågs definitionen av vad som utgjorde investeringstjänster enligt ISD i huvudsak överensstämma med det tillståndspliktiga området i lagen om värdepappersrörelse och någon ändring av reglerna från 1991 gjordes inte.

20

18

Se om konsumentbegreppet vid finansiella tjänster i Allmänna reklamationsnämndens avgöranden 2001-11-13 i ärende nr. 2001-3188 och 2001-08-14 i ärende nr. 2001-1724. Se även Swahn och Wendleby, Lagen om finansiell rådgivning till konsumenter, en kommentar, s. 47 ff.

19

COM (89) 629, se prop. 1990/91:142, s. 72.

20

Se prop. 1994/95:50, s. 89.

Investeringstjänsterna i MiFID definieras i stort sett som i ISD men två nya verksamheter har tillkommit, investeringsrådgivning och drift av MTF. Investeringstjänsterna enligt MiFID är:

1. mottagande och vidarebefordran av order beträffande ett eller

flera finansiella instrument,

2. utförande av order på kunders uppdrag,

3. handel för egen räkning,

4. portföljförvaltning,

5. investeringsrådgivning,

6. garantiverksamhet för finansiella instrument eller placering av

finansiella instrument på grundval av ett fast åtagande,

7. placering av finansiella instrument utan fast åtagande och

8. drift av MTF.

Överväganden och förslag

Förslag: Katalogen över de verksamheter som utgör tillståndspliktig värdepappersrörelse ändras så att varje tillståndspliktig verksamhet överensstämmer med en investeringstjänst enligt MiFID.

Inledning

Även om det vid genomförandet av minimidirektivet ISD var tillräckligt att konstatera att de tillståndspliktiga områdena i direktivet och lagen överensstämde går det inte att resonera på samma sätt i dag. Sundhets- och uppförandereglerna i ISD, artiklarna 10 och 11, är allmänt hållna minimiregler som avser investeringstjänster i allmänhet. Motsvarande regler i MiFID, artiklarna 13 och 18–23, är i stället detaljerade och ställer specifika krav på vissa verksamheter. Det innebär att det inte längre räcker att konstatera att de tillståndspliktiga områdena i huvudsak överensstämmer med varandra. För att kunna genomföra direktivet måste de olika verksamheterna anpassas så att de var och en för sig överensstämmer med investeringstjänsterna så som de definieras i MiFID.

Utföra order

Tjänsten ”utförande av order på kunders uppdrag” definieras i MiFID som ”att köpa eller sälja ett eller flera finansiella instrument för kunders räkning” eller i den engelska versionen ”acting to conclude agreements to buy or sell one or more financial instruments on behalf of clients”.

21

Att köpa eller sälja för kunders

räkning omfattar verksamheten ”handel med finansiella instrument i eget namn för annans räkning” i 1 kap. 3 § 1 lagen om värdepappersrörelse. Tjänsten enligt MiFID, särskilt med utgångspunkt från den engelska versionen, omfattar dock fler förfaranden än som ryms i det svenska kommissionsbegreppet. Något krav på att transaktionen ska ske i eget namn för annans räkning finns inte i MiFID. Ett lämpligt kriterium för att avgöra om en tjänst ska anses vara ”utförande av order” är i stället om värdepappersföretaget handlägger transaktionen ända fram till avslutet.

Med en sådan utgångspunkt omfattas både utförande av order i kommission och utförande på annat sätt. Ett exempel på sådana transaktioner i kommission som omfattas är börsmedlemmarnas genomförande av kundorder avseende aktier på Stockholmsbörsen. När medlemmarna handlar för sina kunders räkning handlar de i eget namn. I börsens handelssystem, SAXESS, sker avsluten medlemmarna emellan och part har ingen kännedom om för vems räkning motparten handlar.

När det gäller handeln med standardiserade derivatinstrument på Stockholmsbörsen är det mer tveksamt om handeln kan sägas ske i kommission. Handeln sker över handels- och clearingkonton som förs av Stockholmsbörsen. Kontona är unika för varje enskild slutkund. Stockholmsbörsens hantering av derivathandeln går till så att Stockholmsbörsen går in som motpart i alla derivatkontrakt – den som köper eller utfärdar en option gör det således gentemot Stockholmsbörsen. Enligt derivatregelverket har slutkunden förpliktelser direkt mot Stockholmsbörsen, som också har panträtt i derivatkontrakten. Det värdepappersinstitut som kunden anlitat är inte part i det enskilda derivatkontraktet men har enligt medlemsavtalet ett visst ansvar för ”sina” kunders förpliktelser. Handeln överensstämmer trots det inte med begreppet kommission i kommissionslagen. Möjligen kan man dra en skiljelinje mellan själva handeln, avsluten, och clearingen, leverans av kontrakt och pengar och hantering av motpartsrisken. Det är i det senare ledet som avvikelserna

21

Artikel 4.1.5 i MiFID.

från kommissionsbegreppet är mest påtagliga och kanske är själva handeln åtminstone kommission i vidsträckt bemärkelse.

22

Även

om verksamheten faller utanför det svenska kommissionsbegreppet är det fråga om verksamheten utförande av kunders order enligt MiFID.

Ett särskilt problemområde är när kunders order avslutas mot värdepappersföretagets eget lager. När ett värdepappersföretag gör ett s.k. självinträde i kommissionslagens mening är utgångspunkten att värdepappersföretaget har fått ett uppdrag av en kund att genomföra en transaktion och först efter det att uppdraget tagits emot beslutat sig för att genomföra affären mot det egna lagret. I dessa fall är kommissionslagen, med dess bestämmelser om t.ex. att iaktta kundens intressen, tillämplig, och det är uppenbart att det är fråga om att utföra kundens order.

En affär mellan en kund och ett värdepappersföretag som utförs mot företagets eget lager kan dock falla utanför kommissionslagens tillämpningsområde – kunden och företaget kan redan från början komma överens om att köpet eller försäljningen ska ske mot företagets eget lager. I detta fall är det kanske inte lika självklart att det skulle vara fråga om att utföra kundens order. Här bör dock beaktas att om ett värdepappersföretag skulle kunna anses utföra enbart verksamheten handel för egen räkning i förhållande till sina kunder skulle det innebära att de kundskyddsregler som är knutna till investeringstjänsten utföra kunders order (t.ex. skyldigheten att utföra order på bästa möjliga sätt, artiklarna 21 och 22 och lämplighetsbedömningen enligt artikel 19.5) inte vore tillämpliga. En sådan lösning är inte acceptabel, särskilt inte när det gäller ickeprofessionella kunder.

Utgångspunkten bör därför även i detta fall vara den som beskrivits ovan – ett företag som hanterar kundens order fram till avslutstidpunkten utför kundens order även om avslutet genomförs mot det egna lagret och även om det inte är något kommissionsuppdrag. Ett värdepappersföretag kan således enligt utredningens mening i förhållande till en kund inte utföra enbart investeringsverksamheten handel för egen räkning, utan avslut av kunders order mot det egna lagret innebär en kombination av investeringstjänsten ”utföra kunders order” och investeringsverksamheten ”handel för egen räkning”. Av samma skäl bör ett värdepappers-

22

Se Berggren, 32:a Nordiska Juristmötet, s. 342, dens. Nya finansiella instrument – normer och aktörer, JT 1996-97 s. 571, och Levin, Om fondkommissionärs handlande utan uppdrag, SvJT 1998, s. 477 f.

företag som genomför en kunds order genom avslut mot en annan kunds order anses tillhandahålla tjänsterna ”utföra order” och ”ta emot och vidarebefordra order”.

23

Angående undantag från skydds-

reglerna för professionella kunder, se avsnitt 7.2.

En annan fråga är hur man ska se på order avseende fondandelar. Ett värdepappersinstituts köp eller försäljning för en kunds räkning av fondandelar på en börs utgör, liksom vid uppdrag avseende aktier eller andra finansiella instrument, verksamheten utföra order. Handel med fondandelar över en börs i Sverige sker dock endast i mycket liten utsträckning med några få indexfonder. Normalt sker i stället ”köp” och inlösen av fondandelar direkt mot fonden. Ett ”köp” av en fondandel innebär att ”köparen” skjuter till medel till fonden och köparen blir därigenom fondandelsägare. Någon egentlig försäljning av fondandelar förekommer i dessa fall inte utan fondandelsägaren löser in sin fondandel direkt mot fonden och får ut pengar som motsvarar värdet av fondandelen.

Det finns inget som hindrar att ett värdepappersinstitut köper eller löser in en fondandel i eget namn för en kunds räkning. En kund kan också ha sina fondandelar förvaltarregistrerade – dvs. fondandelarna registreras i andelsägarregistret som förvaltade, t.ex. av ett värdepappersinstitut, för kundens räkning.

24

I dessa fall

kommer det inte att förekomma någon direktkontakt mellan fondbolaget och andelsägaren och fondbolaget kommer inte att veta vem förvaltarens kund är. När ett värdepappersinstitut i sådana fall köper eller säljer fondandelar för kundens räkning är det också fråga om att utföra kunders order.

Det bör inte göra någon skillnad om värdepappersinstitutet genomför kundens order direkt mot fondens andelsägarregister, vilket ofta sker om uppdraget avser fonder förvaltade av fondbolag i samma koncern som värdepappersinstitutet. Uppdraget sker visserligen inte i eget namn för annans räkning men med det synsätt som anlagts ovan – att den verksamhet som leder fram till ett avslut är ”utförande av order” – bör även ett sådant genomförandet av en fondorder normalt höra dit och omfattas av samma skyddsregler som utförande av andra order.

Slutligen anser utredningen att verksamhet som går ut på att bistå kunder med att låna ut eller låna in värdepapper bör ingå i verksamheten utföra order på kunders uppdrag. I vart fall gäller detta om det är fråga om värdepapperslån i enlighet med de svenska

23

Se skäl 20 i ingressen till MiFID.

24

Se 4 kap. 12 § lagen om investeringsfonder.

standardavtalen där äganderätten till värdepapperen övergår från ”långivaren” till ”låntagaren”. Den som lånar ut sina värdepapper överlåter enligt villkoren äganderätten till värdepapperen mot betalning i from av låntagarens skyldighet dels att lämna tillbaka lika många värdepapper och att betala en ränteliknande ersättning. Ett värdepappersinstitut som förmedlar ett lån, eller själv agerar låntagare eller långivare gentemot en kund kan därför sägas utföra ett uppdrag avseende köp (inlåning) eller försäljning (utlåning) i enlighet med MiFID.s definition av tjänsten utföra order på kunders uppdrag i artikel 4.1.5.

Som framgått ovan är det långtifrån alltid som värdepappersinstitutens genomförande av kunders uppdrag innebär kommissionsuppdrag. Även om kommissionslagens bestämmelser skulle kunna sägas innebära skyddsregler i nivå med MiFID:s bestämmelser om t.ex. bästa orderutförande är kommissionslagen inte tillämplig på samtliga de uppdrag där reglerna om bästa orderutförande ska tillämpas enligt MiFID. Investeringstjänsten utföra order på kunders uppdrag bör därför införas som tillståndspliktig verksamhet i stället för 1 kap. 3 § första stycket 1 lagen om värdepappersrörelse. Genomförandet av investerarskyddsreglerna, t.ex. bästa orderutförande, kan sedan knytas till verksamheten utföra order på kunders uppdrag.

Ta emot och vidarebefordra order

Verksamheten mottagande och vidarebefordran av order skiljer sig från verksamheten utföra order för kunders uppdrag huvudsakligen på det sättet att det avslutande momentet – själva köpet eller försäljningen – genomförs av någon annan än den som tagit emot och vidarebefordrat ordern.

25

Ett värdepappersinstitut som medverkar

vid avslutet, t.ex. på börsen eller mot det egna lagret utför order på kunders uppdrag medan ett institut som inte medverkar vid avslutet tar emot och vidarebefordrar order. Det bör framhållas att definitionen inte ska läsas som att mottagande skulle vara en verksamhet och vidarebefordran en annan. Det är egentligen ”vidarebefordran” som är kärnan i verksamheten. Den som har tillstånd att genomföra kunders order behöver således inget särskilt tillstånd för att ”ta

25

Ett värdepappersföretag som förmedlar kunder till ett annat värdepappersföretag – dvs. företag 1 skickar vidare en kund till företag 2 – behöver inte tillstånd att ”ta emot och vidarebefordra order”.

emot” order. Att ta emot order ingår som en del i verksamheten genomföra order. Verksamheten täcker också sammanförande av två eller flera investerare för att få till stånd en transaktion mellan dessa,

26

t.ex. genom att sammanföra köpare och säljare. Tjänsten

har stora likheter med den svenska förmedlingsverksamheten enligt 1 kap. 3 § första stycket 2 lagen om värdepappersrörelse. Verksamheten innebär att värdepappersinstitutet sammanför köpare och säljare utan att gå in som part eller kommissionär i affären. Hit hör en del av den verksamhet som bedrivs inom en corporate financeavdelning, men också traditionell mäklarverksamhet. Verksamheten interbank broking på penningmarknaden – dvs. en bank anmäler sälj- eller köpintresse till en broker som sedan letar upp en motpart, varefter avslutet görs direkt mellan den ursprungliga banken och motparten – är ytterligare ett exempel.

Räntehandel som innebär att kunden köper eller säljer direkt mot det värdepappersinstitut som tar emot ordern kommer dock att vara verksamheterna ”utföra order” och ”egen handel”. Värdepappersinstituten kan med stöd av tillståndet enligt 1 kap. 3 § första stycket 2 lagen om värdepappersrörelse även organisera handel i aktier och andra finansiella instrument och i samband med detta även utan tillstånd enligt börs- och clearinglagen bedriva clearingverksamhet.

27

Om handeln organiseras så att andra än

värdepappersinstitutet självt kan lägga order i handelssystemet kan det dock efter genomförandet av MiFID bli fråga om verksamheten drift av MTF, se nedan.

I dag krävs tillstånd enligt 1 kap. 3 § första stycket 2 lagen om värdepappersrörelse för att förmedla värdepapperslån till kunder. Sådan verksamhet kan dock inte anses falla in under definitionen av att ta emot och vidarebefordra order enligt MiFID utan bör, som angetts ovan, omfattas av verksamheten utföra order.

Värdepappersinstituts medverkan vid köp och inlösen av andelar i investeringsfonder kommer efter genomförandet av MiFID i många fall innebära verksamheten utföra order. Om verksamheten endast består i att tillhandahålla av fondbolaget utformade blanketter till kunder och därefter skicka in dessa till fondbolaget kan det dock fortfarande vara fråga om att ta emot och vidarebefordra, snarare än att utföra order.

28

26

Se skäl 20 i MiFID.

27

1 kap. 1 § fjärde stycket lagen om börs och clearingverksamhet.

28

Se Beckman m.fl. Lagarna på värdepappersområdet, s. 141 f.

För att nå överensstämmelse med MiFID bör definitionen på förmedlingsverksamhet enligt 1 kap. 3 § 2 lagen om värdepappersrörelse bytas ut mot verksamheten ”ta emot och vidarebefordra order”.

Handel för egen räkning

Handel för egen räkning definieras i MiFID som handel i finansiella instrument med utnyttjande av eget kapital och motsvarar verksamheten handel med finansiella instrument för egen räkning i 1 kap. 3 § första stycket 3 lagen om värdepappersrörelse.

29

Med denna verksamhet avses i lagen om värdepappersrörelse institutens handel över det egna lagret. Som förut berörts kan institutet med hjälp av sitt handelslager genomföra en kundorder genom att sälja eller köpa för egen räkning. Om det är fråga om ett kommissionsuppdrag innebär en sådan affär i regel att institutet självinträder enligt 41 § kommissionslagen. Reglerna om att tillvarata kundens intressen gäller även i dessa fall och priset får enligt 42 § kommissionslagen inte vara mindre fördelaktigt för kunden än det gängse priset vid tidpunkten för kommissionärens avsändande av meddelandet om självinträde (se vidare avsnitt 12.1.3).

Tillstånd till handel för egen räkning krävs också för det institut som är en s.k. market maker – dvs. någon som åtagit sig att köpa och sälja finansiella instrument för att upprätthålla likviditeten i instrumentet – samt för den som av andra skäl, t.ex. trading, handlar för egen räkning.

30

Verksamheten egen handel torde som sagt avse detsamma i MiFID som i lagen om värdepappersrörelse och kräver därför ingen ändring i sak.

29

Artikel 4.1.6 i MiFID.

30

Enligt förarbetena avses med denna verksamhet att själva handeln är ett huvudmoment i företagets affärsidé. Normalt kommer inkomsterna från denna rörelse från skillnaderna mellan sälj- och köpkurser eller från avgifter och inte genom värdetillväxt i de finansiella instrumenten, se prop. 1990/91:142, s. 110. Ren förmögenhetsförvaltning för egen räkning, som bygger på värdeförändringar i de finansiella instrument som köps och säljs torde inte utgöra någon tillståndspliktig verksamhet och inte heller vara någon tillåten sidoverksamhet (se 3 kap. 4 § samt 4 kap. 1 och 2 §§ lagen om värdepappersrörelse).

Portföljförvaltning

Portföljförvaltning är enligt MiFID förvaltning av värdepapper på skönsmässig grund enligt uppdrag från enskilda kunder, om dessa portföljer innehåller ett eller flera finansiella instrument.

31

Av

genomförandebestämmelserna synes följa att förvaltningen normalt ska ske enligt en överenskommen placeringsstrategi.

32

Verksam-

heten innebär enbart det som i Sverige kallas diskretionär förvaltning. Kapitalförvaltning som kräver godkännande från kunden inför varje affär är således inte portföljförvaltning i MiFID:s mening.

Med verksamheten ”förvaltning av finansiella instrument som tillhör någon annan” enligt 1 kap. 3 § första stycket 4 lagen om värdepappersrörelse

33

avses både diskretionär förvaltning och sådan

förvaltning där omplaceringar får göras endast efter hörande av kunden.

34

Denna senare form av kapitalförvaltning är mycket svår

att skilja från den situationen att värdepappersinstitutet lämnar råd och utför kundens order (en kombination av någon av verksamheterna i 1 kap. 3 § första stycket 1 och 2 och sidoverksamheten ”lämna råd i finansiella frågor”). Frågan är om det är möjligt att skilja verksamheterna åt överhuvudtaget. För att utgöra förvaltning i den mening som avses i lagen om värdepappersrörelse ska dock initiativet till omplaceringen komma från institutet. Vidare har förvaltningsuppdraget en inriktning på viss varaktighet och brukar följa en i förväg bestämd strategi eller modell. Den svenska verksamheten ”förvaltning av finansiella instrument som tillhör någon annan” innefattar således fler verksamheter än MiFID:s portföljförvaltning.

Mellan verksamheten diskretionär förvaltning å den ena sidan och icke diskretionär förvaltning och handel för kunders räkning i kombination med rådgivning å den andra sidan finns en intressekonflikt. De omplaceringar som görs i den diskretionära förvalt-

31

Artikel 4.1.9 i MiFID.

32

Se kravet i artikel 36.4 i genomförandedirektivet på att lämplighetsbedömningen avseende portföljförvaltning bl.a. ska grundas på information om kundens placeringshorisont, riskprofil m.m. samt kravet i artikel 41.2 e i genomförandedirektivet på jämförelse mellan portföljens utveckling relativt ett eventuellt överenskommet benchmark.

33

Tillståndspliktig kapitalförvaltning ska inte förväxlas med institutens förvaring av finansiella instrument i depå där depåhållaren normalt åtar sig att utföra ett antal ”förvaltningsåtgärder”. De åtgärder depåhållaren åtar sig i depåavtalet, t.ex. ta emot utdelningar, bevaka emissioner, sälja teckningsrätter m.m., kräver normalt olika tillstånd enligt 1 kap. 3 § och 3 kap. 4 § lagen om värdepappersrörelse, se prop. 1990/91:142, s. 153.

34

Prop. 1990/91:142, s. 153.

ningen kan i många fall vara kurspåverkande

35

– särskilt om för-

valtaren har många kunder som följer samma placeringsstrategi. Om rådgivningskunderna fick kännedom om kommande kurspåverkande omplaceringar skulle de kunna försöka hinna före kunderna med diskretionärt förvaltade fonder (s.k. frontrunning). Även om en sådan intressekonflikt i viss mån kan hanteras genom interna regler om t.ex. handels- och rådgivningsförbud i vissa situationer, uppstår ett problem i förhållande till rådgivningskunderna. Inför en omplacering har förvaltaren gjort bedömningen att det är lämpligt att sälja eller köpa ett visst värdepapper eller vikta om portföljens innehav på ett visst sätt. Rådgivningskunderna kan med visst fog förvänta sig få ta del av de överväganden som rådgivaren gjort, särskilt om de har betalat för rådgivningen, – och det är ju inte förvaltarens bedömning i sig utan de kommande transaktionerna för de diskretionärt förvaltade portföljerna som är kurspåverkande i sådan utsträckning att det kan vara fråga om insiderinformation. Ett internt handels- eller rådgivningsförbud skulle leda till att rådgivningskunderna fick en något sämre, eller i vart fall fördröjd, rådgivning jämfört med vad de borde kunna förvänta sig. Detta dilemma skulle lösas om den diskretionära förvaltningen hölls avskild från annan verksamhet.

Intressekonflikten är än mer påtaglig för ett fondbolag som enligt 1 kap. 4 § lagen om investeringsfonder fått tillstånd att förvalta någon annans finansiella instrument. Bestämmelsen bygger på förändringar år 2002 i UCITS-direktivet.

36

Det direktivet ger med-

lemsstaterna rätt att ge fondbolag tillstånd att även bedriva verksamheten portföljförvaltning – med begreppet avses detsamma som i MiFID. I den mån ett fondbolag skulle bedriva enbart diskretionär förvaltning är de intressekonflikter som skulle kunna uppstå begränsade – det blir mest en fråga om att förvaltningen av en fond normalt skulle avse en större förmögenhetsmassa än en diskretionär förvaltning av en enskild kunds portfölj. Men om begreppet portföljförvaltning i detta sammanhang även skulle avse icke diskretionär förvaltning uppstår de intressekonflikter som beskrivits ovan – vilket ställer helt andra krav på hantering av intressekonflikter. Vid genomförandet av ändringarna i UCITSdirektivet i Sverige har, med förebild i lagen om värdepappersrörelse, dock portföljförvaltning definierats som den svenska verksamheten ”förvaltning av annans finansiella instrument” vilket

35

Prop. 1990/91:42, s 86 f.

36

Direktiv 2001/107/EG.

innebär att även icke-diskretionär förvaltning har kommit att omfattas.

37

Eftersom verksamheten ”förvaltning av någon annans finansiella instrument” enligt 1 kap. 3 § första stycket 4 också innefattar ickediskretionär förvaltning är verksamheten vidare än MiFID:s portföljförvaltning. I praktiken kommer icke-diskretionär kapitalförvaltning att bli tillståndspliktig bl. a som investeringsrådgivning enligt MiFID. Emellertid ställs olika krav på portföljförvaltning och investeringsrådgivning i genomförandedirektivet, bl.a. avseende rapportering till kunderna och MiFID:s regler om intressekonflikter kräver att verksamheten portföljförvaltning måste hanteras på ett särskilt sätt. Därför bör verksamheten ”förvaltning av någon annans finansiella instrument” bytas ut mot MiFID:s begrepp portföljförvaltning.

Ändringen bör också göras i lagen om investeringsfonder. Fondbolagen kan även få tillstånd till andra sidoverksamheter enligt 7 kap. 1 § lagen om investeringsfonder, bl.a. investeringsrådgivning. Att fondbolag kan få dessa tillstånd följer dock av UCITS-direktivet (7 kap. 1 § införlivar artikel 5.3 b i det direktivet

38

) och

påverkas inte i sig av MiFID. Enligt den ändring i UCITSdirektivet som följer av artikel 66 i MiFID ska artiklarna 2.2, 12, 13 och 19 i MiFID, dvs. kapital och organisationskrav samt uppföranderegler, tillämpas på fondbolagens portföljförvaltning och därmed sammanhängande sidotjänster. I UCITS-direktivet hänvisades tidigare till motsvarande bestämmelser i ISD. MiFID innebär ingen ändring när det gäller kapitalkravet men väl vad gäller organisationskraven och uppförandereglerna. En hänvisning till de bestämmelser i den svenska lagen som föreslås för att införliva artiklarna 13 och 19 i MiFID bör därför tas in i lagen om investeringsfonder.

Garantigivning m.m.

Verksamheterna garantigivning för finansiella instrument och ”placering av finansiella instrument på grundval av ett fast åtagande” respektive ”placering…utan fast åtagande” synes vara en redaktionell uppdelning av punkten 4 i avsnitt A i bilagan till ISD. Placering av finansiella instrument på grundval av ett fast åtagande

37

Prop. 2002/03:150, s. 146.

38

Prop. 2002/03:150, s. 324 f.

innebär att värdepappersföretaget åtagit sig att köpa de instrument som placeringen avser, dvs. en form av garantigivning. Placering utan ett fast åtagande innebär att företaget åtar sig att försöka placera instrumenten i fråga hos investerare. Men företaget har inte åtagit sig att köpa överblivna instrument. Verksamheterna faller in under den svenska verksamheten ”garantigivning och annan medverkan vid emissioner av fondpapper eller erbjudanden om köp eller försäljning av finansiella instrument riktade till en öppen krets” i 1 kap. 3 § första stycket 5 lagen om värdepappersrörelse. Dock torde den svenska verksamheten innefatta fler typer av medverkan vid emissioner och offentliga erbjudanden än just garantigivning och ”placering” (placing i den engelska versionen).

Den svenska verksamheten avser den medverkan som består i administration av publika emissioner och offentliga erbjudanden som vanligen bedrivs av institutens corporate finance-avdelningar. Även institutets biträde vid emittentens upprättande av olika prospekt omfattas. Garantigivning vid emission kan innebära att institutet gentemot utgivaren (emittenten) utlovar att emissionen kommer att tecknas fullt ut eller att institutet själv tecknar hela emissionen för vidare spridning. Övrig medverkan är t.ex. att vara emittenten behjälplig med utformande av villkor och prospekt eller att ta hand om den praktiska hanteringen av anmälningssedlar, de finansiella instrumenten och betalningen.

Den svenska definitionen torde innefatta fler typer av medverkan vid emissioner m.m. än garantigivning och placering och det tillståndspliktiga området i den svenska lagen bör därför begränsas i enlighet med MiFID. Det innebär inte att värdepappersinstituten måste ändra sin corporate finance-verksamhet utan enbart att vissa delar av verksamheten bedrivs som investeringstjänster och andra delar som sidotjänster enligt artikel 4.1.3 och avsnitt B i bilaga 1 till MiFID. Därutöver bör den nuvarande svenska verksamheten, liksom i MiFID, delas upp i två separata verksamheter, en avseende garantigivning och placering enligt ett fast åtagande och en annan som avser placering utan ett fast åtagande. En sådan uppdelning skulle, förutom att motsvara MiFID, underlätta tillämpningen av reglerna om kapitalkrav. Kapitalkravet är högre för den som ägnar sig åt garantigivning eller placering med ett fast åtagande än för den som enbart ägnar sig åt placering utan ett fast åtagande.

Drift av MTF

En MTF är enligt definitionen i artikel 4.1.15 i MiFID:

ett multilateralt system som drivs av ett värdepappersföretag eller en marknadsplatsoperatör och som sammanför ett flertal köp- och säljintressen i finansiella instrument från tredje man – inom systemet och i enlighet med icke skönsmässiga regler – så att detta leder till avslut i enlighet med bestämmelserna i avdelning II.

En första förutsättning är att systemet ska vara tillgängligt för flera – det ska vara multilateralt och sammanföra ett flertal köp- och säljintressen. Sammanförandet av köp- och säljintressen ska dessutom ske inom det multilaterala systemet så att detta sedan leder till avslut. Köpare och säljare ska således ”mötas” i systemet. Ett värdepappersinstitut kan lägga ihop köp- och säljuppdrag från flera kunder i sitt orderhanteringssystem och sedan skicka dessa vidare till en börs, dvs. ett annat system, där avslut sedan sker. Värdepappersinstitutets agerande i det fallet omfattas inte av definitionen då det inte är fråga om ett sådant sammanförande inom systemet som leder till avslut. Även om värdepappersinstitutet skulle sammanföra kundernas köp- och säljorder så att de ledde till avslut utanför börsen, eller gjorde avslut mot det egna lagret, torde inte heller en sådan verksamhet falla in under definitionen så länge systemet bara är tillgängligt för värdepappersinstitutet självt. För att systemet ska kunna anses vara multilateralt måste de som deltar i handeln – liksom de som deltar i handeln på en reglerad marknad – ha möjlighet att direkt kunna lägga order i systemet. Det behöver dock inte vara fråga om något tekniskt system. Liksom en reglerad marknad kan det vara fråga om ett system av regler och att handeln sker i systemet kan innebära att handeln sker i enlighet med marknadsplatsens regler. Det finns heller inget som hindrar att den som driver en MTF själv deltar i handeln på MTF:en. Tvärtom framgår det av artikel 14.3 att MiFID förutsätter att detta ska kunna ske.

Verksamhet enligt definitionen liknar sådan verksamhet som börser och auktoriserade marknadsplatser driver enligt 1 kap. 4 § 1 och 3 börs- och clearinglagen – ”verksamhet som syftar till att åstadkomma regelbunden handel med finansiella instrument”, för börser gäller därutöver att handeln ska ske mellan medlemmar. En sådan verksamhet är också tillståndspliktig som ”förmedling av kontakt mellan köpare och säljare av finansiella instrument eller i annat fall medverkan vid transaktioner med finansiella instrument”

enligt 1 kap. 3 § första stycket 2 lagen om värdepappersrörelse. Den som har auktorisation som börs eller marknadsplats är dock undantagen från den tillståndsplikten.

39

I den mån ett värdepappersinstitut med stöd av 1 kap. 3 § första stycket 2 lagen om värdepappersrörelse driver ett multilateralt system där köp- och säljintressen sammanförs skulle den verksamheten utgöra ”drift av en MTF”. Sådan organiserad handel där Finansinspektionens föreskrifter (FFFS 2001:5) om marknadsövervakning vid börser, auktoriserade marknadsplatser och värdepappersinstitut är tillämpliga torde åtminstone i vissa fall kunna utgöra en MTF. Enligt 2 kap. 1 § tredje stycket i föreskrifterna är de tillämpliga på sådan handel i vilken en vidare kundkrets har möjlighet att delta. Handeln ska dessutom ha en sådan omfattning och frekvens att en fortlöpande prissättning uppkommer i instrumentet. Exempel på sådan verksamhet är handeln på Nya Marknaden och annan s.k. listhandel, se avsnitt 7.4.

40

För att verksam-

heten ska utgöra en MTF krävs dock att det finns icke skönsmässiga regler för vilka som får delta i handeln. Till skillnad från föreskrifternas krav på att en prissättning ska uppkomma i handeln skulle en MTF kunna fungera så att prissättningen sker med hjälp av kurserna på t.ex. en reglerad marknad – om handeln på MTF:en sker t.ex. i aktier som är upptagna till handel på den reglerade marknaden. Kraven på transparenta och icke skönsmässiga regler måste motsvara dem som gäller för en reglerad marknad så att konkurrensen mellan dessa typer av marknadsplatser kan ske på lika villkor. Ett värdepappersföretag bör t.ex. kunna kräva att den som vill delta i handeln har depå och konto hos värdepappersföretaget för att möjliggöra en enkel och effektiv avveckling av affärerna. Men företaget ska inte skönsmässigt kunna avgöra vem som i så fall får öppna depå och konto. All verksamhet som bedrivs med stöd av 1 kap. 3 § första stycket 2 lagen om värdepappersrörelse innebär dock inte drift av en MTF. Traditionell mäklarverksamhet – att sammanföra en köpare och en säljare – faller utanför, liksom förmedling av värdepapperslån och värdepappersinstituts verksamhet avseende köp och inlösen av andelar i investeringsfonder.

39

1 kap. 3 a § tredje stycket lagen om värdepappersrörelse.

40

Just vad gäller Nya Marknaden kan man fråga sig om det är Stockholmsbörsen som skulle anses driva en MTF eller om Stockholmsbörsen driver verksamheten på uppdrag av sponsorerna. Det är Stockholmsbörsen som driver det multilaterala systemet där sammanförandet av köp- och säljintressen sker (SAXESS).

För att kunna genomföra direktivets bestämmelser om verksamheten drift av MTF i svensk rätt bör verksamheten avskiljas från förmedlingsverksamhet enligt 1 kap. 3 § första stycket 2 lagen om värdepappersrörelse. Om den verksamheten byts ut mot verksamheten ta emot och vidarebefordra order enligt utredningens förslag kan verksamheten drift av en MTF – definierad som i MiFID – göras till en egen tillståndspliktig verksamhet på vilken MiFID:s regler om handel och avslut, övervakning samt informationskrav blir tillämpliga(artiklarna 14, 26, 29, 30 och 35).

Investeringsrådgivning

Enligt artikel 4.1.4 i MiFID är investeringsrådgivning:

Tillhandahållande av personliga rekommendationer till en kund, på dennes begäran eller på värdepappersföretagets initiativ, i fråga om en eller flera transaktioner som avser finansiella instrument.

Det har diskuterats om kravet på att det ska vara fråga om en eller flera transaktioner innebär att den som enbart lämnar råd om en viss portföljfördelning (t.ex. hälften aktierelaterade och hälften ränterelaterade instrument) faller utanför definitionen.

41

I artikel 52

i genomförandedirektivet anges att det är fråga om sådana personliga rekommendationer som avses med investeringsrådgivning bl.a. om det är en rekommendation att köpa, sälja, teckna sig för, byta, lösa in eller behålla ett särskilt finansiellt instrument. I en tidigare version av bestämmelsen följde därefter satsen ”… eller en typ av finansiella instrument”. Denna del av definitionen togs efter kritik från flera medlemsstater bort. Detta kan enligt utredningens uppfattning inte tolkas på annat sätt än att investeringsrådgivning enligt MiFID inte omfattar generella råd om en viss fördelning mellan olika slags tillgångar.

42

Med tanke på att det normalt är

strategibeslut, som t.ex. fördelningen mellan olika tillgångsslag, som har störst betydelse för utfallet av investeringsverksamheten framstår det dock inte som ändamålsenligt att sådan rådgivning ska vara utesluten från det tillståndspliktiga området – särskilt inte om

41

Se CESR’s Draft Technical advice on Possible Implementing Measures of the Directive 2004/39/EC on Markets in Financial Instruments, Aspects of the definition of Investment Advice and of the general Obligation to Act Fairly, Honestly and Professionally in the Best Interest of Clients, Best Execution, Market Transparency, Second consultation paper, March 2005, s. 9–12.

42

Se skäl 72 i ingressen till genomförandedirektivet och avsnitt 8.1 i Background note till kommissionens förslag till genomförandedirektiv, 2006-02-06.

detta skulle innebära att värdepappersinstitut inte fick ägna sig åt denna typ av rådgivning. Från svensk synvinkel vore det dessutom olyckligt om en viss del av den rådgivning som bedrivs av värdepappersinstitut och som är finansiell rådgivning enligt 1 § rådgivningslagen, skulle falla utanför den nya lagen om värdepappersmarknaden. I praktiken torde dock den övervägande delen av den generella rådgivningen leda fram till mer konkreta råd om placeringar i särskilda finansiella instrument och i sådana fall bör även de inledande generella diskussionerna anses vara en del av investeringsrådgivningen.

43

Att investeringsrådgivning genom direktivet blir en tillståndspliktig kärnverksamhet innebär en viss utvidgning av tillämpningsområdet, se dock nedan om undantaget i artikel 2.1 j. Investeringsrådgivning är enligt ISD en sidotjänst. Den svenska sidoverksamheten ”lämna råd i finansiella frågor”, 3 kap. 4 § första stycket 1 lagen om värdepappersrörelse, omfattar närmast investeringsrådgivning i MiFID:s mening. Investeringsrådgivning enligt MiFID torde möjligen vara ett något snävare begrepp eftersom det kräver anknytning till specifika finansiella instrument. Merparten av denna verksamhet bedrivs i Sverige av värdepappersinstitut. Men det förekommer också att företag, som inte har tillstånd enligt vare sig lagen om värdepappersrörelse eller lagen om bank- och finansieringsrörelse, eller på annat sätt står under Finansinspektionens tillsyn, yrkesmässigt ägnar sig åt rådgivning avseende finansiella instrument (enligt 8 § lagen om finansiell rådgivning till konsumenter står rådgivare som lämnar råd till konsumenter, om de inte står under Finansinspektionens tillsyn, under Konsumentverkets tillsyn). Enligt förarbetena till lagen om finansiell rådgivning till konsumenter torde dock lagen till allra största delen träffa verksamheter som står under Finansinspektionens tillsyn.

44

MiFID:s investeringsrådgivning bör läggas till som en ny tillståndspliktig verksamhet. Verksamheten ska i sig inte omfatta någonting utöver definitionen i MiFID och genomförandebestämmelserna. Den som enbart lämnar generella råd behöver således inget tillstånd enligt lagen om värdepappersmarknaden. Sådan rådgivning kan dock komma att omfattas av rådgivningslagens bestämmelser. Ett värdepappersinstitut med tillstånd att bedriva investeringsrådgivning bör dock utan särskilt tillstånd även få lämna generella råd, t.ex. om en lämplig tillgångsfördelning i en

43

Se skäl 73 i ingressen till genomförandedirektivet.

44

Prop. 2002/03:133, s. 39.

värdepappersportfölj. De uppföranderegler som rör investeringsrådgivning, t.ex. bestämmelserna om informationsutbyte och rapportering i artikel 19, ska då tillämpas även på denna verksamhet, se skäl 72 i ingressen till genomförandedirektivet. Angående samspelet i övrigt mellan rådgivningslagen och den nya bestämmelsen i lagen om värdepappersmarknaden, se avsnitt 12.2.2 och 19.2.24.

I sammanhanget bör även de s.k. riskkapitalbolagens verksamhet beröras. Dessa företags verksamhet är ofta strukturerad så att själva investeringarna sker i en ”riskkapitalfond” Fonden är dock ingen investeringsfond enligt lagen om investeringsfonder utan kan vara ett aktie- eller kommanditbolag eller en utländsk juridisk person. De enskilda investerarna tillskjuter medel till ”fonden” för investeringarna och ett från fonden fristående aktiebolag, ”rådgivningsbolaget”, lämnar fonden underlag för beslut om lämpliga investeringar. Det skulle då kunna hävdas att rådgivningsbolaget ägnar sig åt verksamheten investeringsrådgivning.

Ett rådgivningsbolag som lämnar råd bara till en eller något fåtal juridiska personer inom ramen för en etablerad struktur bör dock inte anses tillhandahålla en tillståndpliktig investeringstjänst enbart därför att strukturen inte är en koncern i traditionell mening. Rådgivningsbolagens rådgivningsverksamhet är i och för sig yrkesmässig i andra hänseenden, skatterättsligt m.m. men bör inte anses yrkesmässig på det sätt som krävs enligt lagen om värdepappersmarknaden (jfr resonemanget i avsnitt 7.5 om undantaget från tillståndplikt för sådan egen handel som inte ingår i en verksamhet där det primära är att tillhandahålla en tjänst åt kunder).

Om rådgivningsbolaget tillhandahåller sina tjänster till andra företag utanför den egna sfären bör dock tillstånd krävas. Likaså bör verksamheten alltid anses tillståndspliktig om den riktar sig direkt till icke-professionella investerare. Genom att tillåta en viss flexibilitet för riskkapitalbolagens verksamhet är det också möjligt att undvika de handelshinder som skulle kunna uppstå om verksamheten i andra EES-länder ansågs vara tillståndspliktig. Svenska riskkapitalbolag bör därför ha möjlighet att organisera sin verksamhet så att de kan få tillstånd.

7.3.2. Sidotjänster

Reglerna i MiFID och svensk rätt

Medan de tillståndspliktiga verksamheter som beskrivits i föregående avsnitt i princip inte får bedrivas av annan än den som har tillstånd från Finansinspektionen – dvs. värdepappersinstitut – förhåller det sig annorlunda med sidoverksamheterna enligt 3 kap. 4 § lagen om värdepappersrörelse. Sådana verksamheter får i vissa fall bedrivas utan något särskilt tillstånd, t.ex. rådgivning, eller med stöd av andra tillstånd, t.ex. kreditgivning. En bank får ägna sig åt dessa verksamheter enligt sitt banktillstånd, medan ett värdepappersbolag måste ha särskilt tillstånd. Gemensamt för sidoverksamheterna är att de huvudsakligen utförs för att underlätta värdepappersrörelsen. Sidoverksamheterna är:

1. Lämna råd i finansiella frågor,

2. ta emot värdepapper för förvaring,

3. ta emot medel med redovisningsskyldighet,

4. ta emot kunders medel på konto för att underlätta värde-

pappersrörelsen,

5. lämna kunder kredit mot säkerhet för placeringar i finansiella

instrument för att underlätta värdepappersrörelsen,

6. utföra valutaväxlingstransaktioner,

7. valutahandel, och

8. övrig verksamhet

Enligt artikel 6.1 i MiFID kan ett tillstånd att utföra investeringstjänster också omfatta en eller flera av de sidotjänster som avses i avsnitt B i bilaga 1 till direktivet. Sidotjänsterna enligt MiFID är:

1. Förvaring och handhavande av finansiella instrument för kunders räkning, bland annat värdepappersförvaring och liknande tjänster, exempelvis handhavande av kontanta medel/finansiella säkerheter,

2. lämnande av kredit eller lån till en investerare för att göra det

möjligt för denne att genomföra en transaktion i ett eller flera finansiella instrument, när det företag som ger krediten eller lånet deltar i transaktionen,

3. rådgivning till företag om kapitalstruktur, företagsstrategi, och

liknande frågor samt rådgivning och tjänster vid fusioner och företagsuppköp,

4. valutatjänster om dessa har samband med investeringstjänster,

5. investerings- och finansieringsanalys samt andra former av

allmänna rekommendationer rörande handel med finansiella instrument,

6. tjänster i samband med garantigivning,

7. investeringstjänster och investeringsverksamhet samt sido-

tjänster som avser den underliggande tillgången till derivat som anges i avsnitt C – punkterna 5, 6, 7 och 10 – när dessa har samband med tillhandahållandet av investerings- eller sidotjänster.

Överväganden och förslag

Förslag: Katalogen över sidoverksamheter ändras så att varje verksamhet överensstämmer med en sidotjänst enligt MiFID. Den svenska sidotjänsten att ta emot medel på konto behålls liksom möjligheterna att få tillstånd till andra tjänster.

Inledning

Liksom för investeringstjänsterna gäller det s.k. Europapasset även sidotjänsterna. Dvs. ett tillstånd i hemlandet ger värdepappersföretaget rätt att bedriva de sidoverksamheter företaget har tillstånd till i andra medlemsstater utan krav på ytterligare tillstånd. Ett värdepappersföretag har dock inte rätt att med stöd av direktivet ägna sig åt enbart en sidoverksamhet i en annan medlemsstat. För att kunna åberopa Europapasset krävs det att företaget också ägnar sig åt någon investeringstjänst. Vissa regler och undantag i MiFID och i genomförandebestämmelserna om intressekonflikter, kundskydd osv. tar sikte även på sidotjänsterna så som de är definierade i direktivet. Liksom vad gäller investeringstjänsterna måste därför sidoverksamheterna i lagen om värdepappersrörelse ses över så att de överensstämmer med sidotjänsterna enligt MiFID.

Förvaring och handhavande av finansiella instrument för kunders räkning

Tjänsten avser enligt sin ordalydelse förvaring och handhavande av finansiella instrument för kunders räkning, bland annat värdepappersförvaring och liknande tjänster, exempelvis handhavande av kontanta medel och finansiella säkerheter. Liksom ISD omfattar verksamheten förvaring av samtliga de instrument som omfattas av direktivet. Enligt uttalanden i doktrinen avser denna verksamhet fysisk förvaring av värdepapper och torde ha ringa betydelse för dagens värdepappersmarknad med dematerialiserade instrument.

45

I

förarbetena till lagen om värdepappersrörelse nämns emellertid att ett värdepappersbolag med stöd av förvaringstillståndet kan ägna sig åt verksamhet som motsvarar bankers notariatrörelse och beskrivningen i förarbetena av den verksamheten synes utgå från att den kan avse både VPC-registrerade fondpapper och fysiska värdepapper.

46

Förarbetsuttalandet talar således för att t.ex. depå-

verksamheten som den fungerar i dag omfattas av denna sidoverksamhet. Med en sådan tolkning av den svenska sidoverksamheten förvaring av värdepapper motsvarar den del av den aktuella sidotjänsten som rör förvaring av finansiella instrument. Om depåhanteringen går utöver ren förvaring t.ex. om kunden uppdragit åt företaget att göra omplaceringar i kundens portfölj krävs dock tillstånd till investeringstjänsten portföljförvaltning. Likaså krävs tillstånd till investeringstjänsten utföra order om depåhållaren enligt avtalet med kunden genomför transaktioner för kundens räkning, t.ex. säljer erhållna teckningsrätter.

47

Den del av sidotjänsten som avser handhavande av kontanta medel motsvaras av den svenska sidoverksamheten ”ta emot medel med redovisningsskyldighet”.

Någon ändring i sak av de båda svenska sidoverksamheterna behövs inte för att genomföra direktivet. De av direktivets regler som uttryckligen tar sikte på den aktuella sidotjänsten, t.ex. organisationskraven i artikel 13.7 och 13.8 samt undantagsregeln i artikel 3, beskriver tjänsten som två verksamheter: förvaring av instrument och förvaring av medel. Detta talar för att behålla den nuvarande svenska uppdelningen av tjänsten i två verksamheter. Utredningens förslag nedan – att värdepappersbolag ska få fortsätta

45

Beckman m.fl., Lagarna på värdepappersområdet, 2002, s. 177.

46

Prop. 1990/91:142, s. 153.

47

Se p. B 2.2 b) i standardavtalet Allmänna bestämmelser för depåavtal, bank, maj 2003, på Svenska Fondhandlareföreningens hemsida, www.fondhandlarna.se /dokbas.html.

ta emot medel på konto – är ytterligare skäl för att behålla den nuvarande svenska uppdelningen. Ett värdepappersbolag som tar emot medel på konto behöver inte samtidigt tillstånd för att ta emot medel för redovisningsskyldighet med de krav på organisation som detta kan medföra (inget hindrar dock ett bolag från att ha tillstånd till båda sidotjänsterna). Ordalydelsen av förvaringsverksamheten avseende värdepapper bör dock ändras så att den avser finansiella instrument i stället för värdepapper. Det framgår då tydligare att verksamheten också avser dematerialiserade instrument.

Kreditgivning

Den kreditgivning som värdepappersbolag får syssla med måste vara avsedd att underlätta värdepappersrörelsen och krediterna måste ha en direkt anknytning till kundernas värdepappersaffärer. Kreditgivningstillståndet, enligt både den svenska lagen och ISD, gäller endast krediter för att möjliggöra transaktioner i finansiella instrument. MiFID innebär ingen ändring i dessa avseenden. Kravet i såväl ISD som MiFID, att det företag som ger krediten måste delta i den transaktion som finansieras med krediten, är dock åtminstone formellt mer inskränkande än det svenska ”för att underlätta värdepappersrörelsen”. Den svenska regeln bör därför justeras så att ordalydelsen mer motsvarar MiFID.

Den snäva definitionen av verksamheten kan komma att ställa till en del praktiska problem. Om en kund som fått kredit hos ett värdepappersbolag och därefter köpt aktier för pengarna vill byta värdepappersbolag, t.ex. genom att flytta över sina aktier och låta det nya företaget ”ta över” krediten, bör den nya krediten anses vara knuten till den transaktion som överförandet av aktierna från det ena företaget till det andra utgör. I den transaktionen har det nya företaget deltagit varför kreditgivningen bör anses omfattas av tillståndet. Det är dock inte tillåtet för ett värdepappersbolag att lämna kredit till ett bolag i samma koncern – om nu inte krediten används av det lånande bolaget till att köpa finansiella instrument genom det utlånande företaget.

Rådgivning till företag om kapitalstruktur, företagsuppköp m.m.

Tjänsten består enligt MiFID av rådgivning till företag om kapitalstruktur, företagsstrategi och liknande frågor samt rådgivning och tjänster vid fusioner och företagsuppköp. Tjänsten motsvarar den del av den svenska sidoverksamheten rådgivning i finansiella frågor som avser råd i corporate finance-frågor. Den svenska sidoverksamheten innefattar dock också investeringsrådgivning. I linje med utredningens förslag att investeringsrådgivning införs som en egen tillståndspliktig verksamhet bör den svenska sidoverksamheten ”rådgivning i finansiella frågor” tas bort. Istället bör en ny sidoverksamhet utformad som i MiFID införas i den svenska lagen.

Valutatjänster om dessa har samband med investeringstjänster

Motsvarigheten till denna tjänst finns redan i ISD. I de engelska versionerna av MiFID och ISD är ordalydelsen identisk ”foreign exchange services”. I den svenska översättningen av ISD används uttrycket ”valutatransaktioner” och i den svenska lagtexten används begreppet valutaväxlingstransaktioner. Begreppet valutatransaktioner kan rent semantiskt verka omfatta mer än valutaväxlingstransaktioner men i praktiken kan en valutatransaktion inte vara något annat än en valutaväxlingstransaktion. Ett köp eller en försäljning av en valuta med betalning i en annan valuta är lika mycket en valutaväxlingstransaktion som en valutatransaktion. Någon ändring i svensk rätt behövs därför inte.

Valutahandel

Enligt 3 kap. 4 § tredje stycket lagen om värdepappersrörelse kan ett värdepappersföretag också få tillstånd till valutahandel. Det krävs inte att denna verksamhet är ett led i värdepappersrörelsen. Regeln infördes i samband med att kraven på tillstånd från Riksbanken för valutahandel togs bort.

48

Bestämmelsen bör behållas

oförändrad.

48

Prop. 1995/96:216. I samma prop. beskrevs skillnaden mellan valutaväxlingsverksamhet och valutahandel på s. 29 som att handeln på valutamarknaden (valutahandeln) avsåg stora belopp och skedde mellan banker och andra finansiella institut samt deras kunder. Valutaväxlingsverksamhet däremot var handel med resevaluta.

Investerings- och finansieringsanalys samt andra former av allmänna rekommendationer rörande handel med finansiella instrument

Denna sidotjänst finns inte i ISD och inte heller i den svenska lagen. Förutom investerings- och finansanalys omfattas också andra former av allmänna rekommendationer rörande handel med finansiella instrument. Till skillnad från investeringsrådgivning avser denna tjänst enligt skäl 27 i ingressen till genomförandedirektivet bl.a. sådana allmänna rekommendationer som definieras i genomförandedirektivet 2003/125/EG till marknadsmissbruksdirektivet – dvs. rekommendationer som är avsedda för distributionskanaler eller allmänheten.

Tjänster i samband med garantigivning

Tjänsten finns redan i ISD – och ordalydelsen är densamma i de engelska versionerna av ISD och MiFID. Några ändringar i den svenska lagstiftningen föranleddes inte av att tjänsten fanns med som en sidotjänst redan enligt ISD. Den svenska tillståndspliktiga verksamhet som närmast motsvarar investeringstjänsten garantigivning (underwriting) är verksamhet enligt 1 kap. 3 § första stycket 5 lagen om värdepappersrörelse. Som konstaterats tidigare omfattar dock denna svenska verksamhet fler typer av medverkan vid emissioner m.m. än just garantigivning och placering. Med en sådan tolkning skulle andra tjänster i samband med garantigivning omfattas redan av tillståndet enligt 1 kap. 3 § första stycket 5 lagen om värdepappersrörelse och i så fall kan det, vid det svenska genomförandet av ISD, ha bedömts som onödigt att definiera verksamheten som en sidoverksamhet.

I konsekvens med utredningens förslag att begränsa den tillståndspliktiga corporate finance-verksamheten i enlighet med MiFID, se ovan, bör sidotjänsten ”tjänster i samband med garantigivning” införas i den svenska lagen. I praktiken kan värdepappersinstituten då fortsätta bedriva corporate finance-verksamheten som tidigare formellt dock med stöd av två tillstånd i stället för som tidigare med stöd av ett.

Investeringstjänster och investeringsverksamhet samt sidotjänster som avser de underliggande tillgångarna till vissa derivatinstrument

Denna sidotjänst finns inte i ISD och avser tjänster som motsvarar investeringstjänster, och sidotjänster, avseende den underliggande tillgången till de derivatinstrument som anges i punkterna 5, 6, 7 och 10 i avsnitt C i bilagan. Till skillnad från övriga tjänster enligt MiFID anknyter tjänsterna inte till finansiella instrument. De underliggande tillgångarna till dessa derivat kan alltså vara råvaror, utsläppsrätter m.m. En ytterligare förutsättning är dock att tjänsterna tillhandahålls i samband med vanliga investeringstjänster. Om ett företag i samband med att det tillhandahåller investeringstjänster avseende derivaten också tillhandahåller motsvarande tjänster avseende råvaran eller utsläppsrätten kan denna verksamhet definieras som en sidotjänst. Även denna tjänst bör införas som en egen sidoverksamhet i lagen.

Den svenska sidoverksamheten ”ta emot medel på konto”

För denna verksamhet krävs att bolaget har en viss kapitalstyrka, bl.a. därför att medel på konto – till skillnad från redovisningsmedel – inte är skyddade mot bolagets borgenärer vid en konkurs. För att bolaget ska kunna ta mot medel på konto måste bolaget enligt 3 kap. 4 § andra stycket lagen om värdepappersrörelse också ha tillstånd till kreditgivning.

49

Mottagande av medel på konto får

endast ske i sådan omfattning som erfordras för att på ett praktiskt sätt underlätta handeln.

50

När lagen om värdepappersrörelse skulle

anpassas till ISD uppmärksammades att ISD inte gav utrymme för möjligheten att ta emot medel på konto. I ISD, liksom i MiFID, finns en bestämmelse om att medel som tas emot för kunders räkning måste hållas avskilda från företagets egna tillgångar.

51

Detta

gäller dock inte om värdepappersföretaget är ett kreditinstitut. Värdepappersbolag med tillstånd att ta emot medel på konto definierades vid genomförandet av ISD därför som ett kreditinstitut som omfattas av bestämmelserna i lagen (1994:2004) om kapital-

49

Däremot behöver tillstånd till kreditgivning inte kombineras med tillstånd att ta emot medel på konto.

50

Prop. 1990/91:142 s. 120 och prop. 1994/95:50, s. 98 f.

51

Artikel 10 tredje strecksatsen i ISD och artikel 13.8 i MiFID .

täckning och stora exponeringar för kreditinstitut och värdepappersbolag.

52

Varken ISD eller MiFID utgör något hinder mot att i Sverige låta värdepappersbolag som också är kreditinstitut, ta emot medel på konto. Denna verksamhet kan dock inte omfattas av det s.k. Europapasset enligt MiFID. Nu liksom tidigare är det dock viktigt att värdepappersbolagen kan fortsätta ta emot medel på konto för att kunna bedriva värdepappersrörelsen effektivt.

53

Någon ändring i

dessa regler bör därför inte göras. Ett sådant bolag kan med stöd av sitt svenska tillstånd bedriva samma verksamhet i en annan medlemsstat, dock endast i den utsträckning och under de villkor det är tillåtet i Sverige. Ur den andra medlemsstatens synvinkel är bolaget i detta avseende ett kreditinstitut med av sin hemlandsauktorisation inskränkta möjligheter till kontohållning och kreditgivning.

54

Det

är således inte med stöd av hemlandsauktorisationen som värdepappersföretag utan som kreditinstitut företaget kan agera gränsöverskridande.

Andra sidoverksamheter

Ett värdepappersbolag får enligt 3 kap. 4 § fjärde stycket utöva annan verksamhet än dem som angetts tidigare i paragrafen om det finns särskilda skäl och verksamheten kan antas komma att underlätta rörelsen. Det krävs alltså inte bara särskilda skäl utan också att man ska kunna anta att verksamheten underlättar rörelsen. Bakgrunden till denna – förhållandevis stränga – reglering torde vara att man inte ansett det lämpligt att ett värdepappersbolag ska ikläda sig risker inom andra områden än sådana som kan bedömas vid tillsynen. Anledning saknas att i detta sammanhang frångå den nuvarande principen.

Tanken har varit att Finansinspektionen ska avgöra vilka verksamheter som bör tillåtas från fall till fall.

55

Som exempel på

verksamheter kan nämnas framställning av tryckalster, vara förvaringsinstitut enligt lagen om investeringsfonder, tillhandahålla bokföringstjänster åt stiftelser, idka handel med fysiska metaller, försäljning av licensrättigheter och fondadministration.

56

För att en

52

Prop. 1994/95:50, s. 97 ff. och s. 294.

53

Prop. 1994/95:50, s. 98 f.

54

Se prop. 1994/95:50, s. 100.

55

Prop. 1990/91:142, s. 122.

56

Beckman m.fl. Lagarna på värdepappersområdet, s. 179.

verksamhet ska anses vara en tillståndpliktig sidoverksamhet måste den dock vara av någon självständig betydelse. Städning, personalfunktioner m.m. är inte tillståndpliktiga sidoverksamheter utan nödvändiga förutsättningar för bolagets verksamhet.

Genom de ändringar som utredningen föreslagit avseende det tillståndpliktiga området, främst vad avser corporate finance-verksamheten, kan det inte uteslutas att värdepappersföretagen kan komma att behöva komplettera sina verksamhetsbeskrivningar med ytterligare sidotjänster. Någon ändring i lagens krav för att få tillstånd till ytterligare verksamheter behövs dock inte. I den mån det är fråga om en verksamhet som tidigare omfattas av ett huvudtillstånd eller ett tillstånd till en sidoverksamhet torde utgångspunkten vara att lagens krav är uppfyllda. Verksamheter som faller in under denna kategori ”övriga verksamheter” omfattas, liksom tidigare, inte av det s.k. Europapasset.

7.4. Reglerade marknader

7.4.1. Inledning

Definitionen av reglerad marknad i MiFID

Börs- och marknadsplatsverksamhet har tidigare endast i vissa delar reglerats på EG-nivå. Det kodifierade listningsdirektivet (2001/34/EG), som till stora delar ersatts med det nya prospektdirektivet reglerade t.ex. krav på prospekt m.m. för värdepapper som skulle inregistreras på en börs. MiFID:s krav på auktorisation, ägar- och ledningsprövning, krav på organisation m.m. innebär i det avseendet en nyhet. För svenskt vidkommande finns dock liknande krav redan i börs- och clearinglagen.

Enligt artikel 4.1.14 är en reglerad marknad:

ett multilateralt system som drivs och/eller leds av en marknadsplatsoperatör, vilket sammanför eller möjliggör sammanförandet av flera köp- och säljintressen i finansiella instrument från tredje man – inom systemet och i enlighet med dess icke skönsmässiga regler – så att detta leder till avslut i finansiella instrument upptagna till handel enligt dess regler och/eller system, samt är auktoriserat och är löpande verksamt och drivs i enlighet med bestämmelserna i avdelning III (dvs. bestämmelserna om reglerade marknader i artiklarna 36–47).

Definitionen är snarlik definitionen av MTF i artikel 4.1.15. Den enda skillnaden av någon betydelse mellan definitionerna är att en

reglerad marknad är auktoriserad och drivs i enlighet med direktivets bestämmelser om reglerade marknader (artiklarna 36– 47). MiFID:s regler om auktorisation av reglerade marknader innebär inte en tillståndsplikt, som när det gäller investeringstjänster, utan ställer i stället krav på förfarande, handels- och noteringsregler m.m. när någon auktoriseras som reglerad marknad, dvs. en sorts kvalitetsstämpel. Endast den som lever upp till dessa kvalitetskrav får benämnas reglerad marknad. Detta innebär dock inte att det är fritt fram att driva en marknadsplats för finansiella instrument så länge man inte kallar den för en reglerad marknad. Marknadsplatsverksamhet är i första hand en tillståndspliktig investeringstjänst enligt MiFID, förutsatt att den omfattas av definitionen av en MTF, se ovan. Och även om verksamheten i något avseende skulle falla utanför definitionen av en MTF torde den i vart fall innebära att två eller fler investerare sammanförs så att en transaktion kommer till stånd, vilket enligt MiFID är den tillståndspliktiga investeringstjänsten ”ta emot och vidarebefordra order”.

57

Artikel 36.1 i MiFID

Enligt artikel 36.1 i MiFID ska medlemsstaterna som reglerade marknader endast auktorisera sådana system som uppfyller kraven i artiklarna 36–47.

För varje marknadsplats ska det finas en marknadsoperatör. MiFID ger utrymme för två olika organisatoriska modeller: både att marknadsplatsen är sin egen operatör, dvs. att marknadsplatsen och operatören ryms inom en och samma juridiska person, och att operatören är en från marknadsplatsen fristående juridisk person. Sett ur operatörsföretagets synvinkel betyder det att marknadsplatsen kan förläggas inom operatörsföretagets egna ramar eller i ett separat företag, troligen ett dotterföretag till operatörsföretaget.

Om marknadsplatsoperatören och marknadsplatsen är olika personer ska medlemsstaterna fastställa hur direktivets förpliktelser ska fördelas. Om man väljer att lägga ansvaret för vissa förpliktelser på den reglerade marknaden förutsätter detta dock att marknaden är en egen juridisk person. Texten i de följande artiklarna måste enligt utredningens mening tolkas så att det står varje medlemsstat

57

Se skäl 20 i ingressen till MiFID.

fritt att välja om ansvaret för ett visst åliggande ska läggas på operatören eller marknaden – och att det oavsett om den aktuella artikeln talar om operatören eller marknadsplatsen (se dock arti- kel 36.3 första stycket).

Enligt artikel 36.1 tredje stycket ska den som driver marknadsplatsen tillhandahålla den information som den behöriga myndigheten behöver för att kunna avgöra att den reglerade marknaden uppfyller kraven för auktorisation.

7.4.2. Svenska marknadsplatsverksamheter i förhållande till MiFID

MiFID:s regler om marknadsplatsverksamhet – dvs. en verksamhet som går ut på att sammanföra köpare och säljare – kan som beskrivits i inledningen delas in i flera nivåer. I första hand gäller detta verksamhet som drivs som reglerad marknad och MTF. Också andra investeringstjänster kan dock sägas vara marknadsplatsverksamheter i vid mening. Både den som utför kunders order mot varandra (tar emot och vidarebefordrar order enligt skäl 20) och den som avslutar kundorder mot det egna lagret kan sägas sammanföra köpare och säljare.

En första fråga är hur dessa olika sätt att sammanföra köpare och säljare enligt MiFID förhåller sig till den nuvarande svenska regleringen. Som konstaterats tidigare torde mycket av den s.k. listhandeln som värdepappersinstitut bedriver utgöra drift av MTF enligt MiFID. Så torde t.ex. vara fallet med Nya Marknaden där handeln sker i ett multilateralt system (SAXESS) där köp- och säljintressen sammanförs inom systemet och leder till avslut i enlighet med de regler som gäller för systemet. På samma sätt fungerar NGM:s Nordic OTC. Handeln på dessa marknader organiseras av värdepappersinstitut med stöd av tillstånd enligt 1 kap. 3 § första stycket 2 lagen om värdepappersrörelse men det är börserna, Stockholmsbörsen och NGM, som upplåter sina handelssystem för handeln. De värdepappersinstitut som legalt sett organiserar och ansvarar för handeln kallas ”sponsorer” och man kan få intrycket att dessa listor bara är ytterligare några av börsernas listor.

58

Detta

intryck är dock felaktigt och kraven på likviditet, vinstintjäningsförmåga, kapital och information till marknaden är mycket lågt

58

Nya Marknaden presenteras dock på en egen hemsida med en egen webbadress och inte på samma hemsida som Stockholmsbörsen.

ställda på bolag upptagna till handel på dessa listor jämfört med de egentliga börslistorna.

Om dock ett värdepappersinstitut organiserar handeln så att den t.ex. sker i ett system som inte är multilateralt faller verksamheten utanför begreppet MTF. I dessa fall utgör verksamheten som sagt i vart fall att ”ta emot och vidarebefordra order”.

När det sedan gäller de svenska företeelserna börs och auktoriserad marknadsplats kan man först konstatera att det svenska begreppet börs torde överensstämma med MiFID:s begrepp reglerad marknad. På båda ställs krav på ägar- och ledningsprövning, krav på noterings- och handelsregler samt krav på kursinformation m.m. före och efter handeln. På en auktoriserad marknadsplats däremot är de svenska kraven i dessa hänseenden inte alls lika långtgående och i många fall finns det inga uttryckliga krav. Börs- och clearinglagen ställer t.ex. inga krav på vilka som ska få delta i handeln på en auktoriserad marknadsplats – annat än att den auktoriserade marknadsplatsens verksamhet ska uppfylla det allmänt hållna sundhetskravet i 7 kap. 1 § börs- och clearinglagen. Enligt MiFID ska medlemsstaterna dock ställa sådana krav på en reglerad marknad.

Handeln på räntemarknaden sker i Sverige till stor del OTC, se avsnitt 4.3. Det innebär att handeln omfattas av antingen verksamheten ta emot och vidarebefordra order, en kombination av att utföra order och egen handel enligt MiFID:s definitioner, eller på en MTF – om handeln är organiserad så att den faller in under definitionen av sådan verksamhet. Den del av handeln som sker på Stockholmsbörsen – t.ex. avseende obligationer och derivatinstrument – anses både i dag och när MiFID genomförs ske på en reglerad marknad. I den mån handeln i dessa instrument sker utanför börsen, vilket avser den större delen av omsättningen, är det således fråga om handeln utanför en reglerad marknad med finansiella instrument som är upptagna till handel på en reglerad marknad.

7.4.3. Begreppet ”reglerad marknad” i förhållande till andra direktiv

Inledning

Genomförandet av bestämmelserna om vad som är en reglerad marknad och vad det innebär att finansiella instrument är upptagna till handel kommer att få konsekvenser för tillämpningen av de bestämmelser som antagits eller ska antas för att införliva prospektdirektivet, öppenhetsdirektivet och direktivet om uppköpserbjudanden. Också marknadsmissbruksdirektivets tillämpningsområde är bestämt utifrån bestämningen upptagna till handel på en reglerad marknad. I Sverige är dock merparten av bestämmelserna i det direktivet – t.ex. förbuden mot insiderhandel och otillbörlig marknadspåverkan – även tillämpliga på värdepapper som är föremål för handel på värdepappersmarknaden även om de inte är ”upptagna till handel” i MiFID:s mening. Därutöver gäller fortfarande noteringskraven i det kodifierade listningsdirektivet för vissa värdepapper. Tillämpningsområdena för dessa andra direktiv bestäms utifrån begreppen reglerad marknad, officiell notering och upptagande till handel på en reglerad marknad. Som utgångspunkt för att kunna hitta en lämplig metod att genomföra MiFID:s regler om reglerade marknader bör de några av nämnda direktiven kort beskrivas. Beskrivningen nedan gör inte anspråk på att vara fullständig, den omfattar t.ex. varken marknadsmissbruksdirektivet eller de nya bolagsdirektiven.

Kodifierade listningsdirektivet

Det kodifierade listningsdirektivet har när det gäller prospektfrågor ändrats genom prospektdirektivet. Reglerna om utformningen av prospekt i prospektdirektivet ersatte listningsdirektivet men detta direktivs övriga krav för officiell notering gäller fortfarande.

59

Det

finns dock en viktig skillnad i tillämpningsområdena för de olika direktiven. Det gamla direktivet gäller värdepapper som upptagits till officiell notering (admitted to official listing). Det är ett snävare begrepp än att ett papper enligt prospektdirektivet har tagits upp till handel (admitted to trading). Skälen till utvidgningen av tillämp-

59

Några bestämmelser om emittenters offentliggörande av insiderinformation, artiklarna 68.1 och 81.1 har också ändrats genom marknadsmissbruksdirektivet.

ningsområdet för prospektdirektivet framgår av skäl 12 i ingressen till det direktivet:

För att investerarna ska ges ett fullgott skydd måste bestämmelserna även omfatta alla aktierelaterade och icke-aktierelaterade värdepapper som erbjuds allmänheten eller är upptagna till handel på reglerade marknader enligt definitionen i rådets direktiv 93/22/EEG av den 10 maj 1993 om investeringstjänster inom värdepappersområdet och inte endast sådana som är officiellt noterade på börser. Den breda definition av värdepapper som används i detta direktiv och som omfattar långa optioner (warrants) samt täckta långa optioner (covered warrants) och företagscertifikat är tillämplig endast för detta direktiv och påverkar inte på något sätt de olika definitioner av finansiella instrument som används i nationell lagstiftning avseende andra frågor, t.ex. beskattning. Vissa av de värdepapper som definieras i detta direktiv ger innehavaren rätt att förvärva överlåtbara värdepapper eller att erhålla ett kontantbelopp som ska fastställas med hänsyn till andra instrument, framför allt överlåtbara värdepapper, valutor, räntesatser eller ränteavkastning, råvaror eller andra index eller mått. Depåbevis och konvertibla skuldebrev, t.ex. värdepapper som är konvertibla när investeraren så önskar, omfattas av detta direktivs definition av ickeaktierelaterade värdepapper.

Det gamla direktivets krav på ett börsvärde om minst en miljon euro (artikel 43.1), spridningskravet (artikel 48), kravet på halvårsrapporter (artikel 70) m.m. gäller således endast värdepapper som ”upptagits till officiell notering” medan prospektreglerna i prospektdirektivet gäller värdepapper som ”upptagits till handel på en reglerad marknad”. Det gamla direktivets krav gäller värdepapper men ställer lite olika krav beroende på om det är fråga om aktier eller skuldebrev.

En fråga som inställer sig beträffande det kodifierade listningsdirektivet är om medlemsstaterna är skyldiga att ha nationella regler som möjliggör ”officiell notering” i enlighet med direktivet. Det är visserligen ett direktiv som enligt artikel 113 riktar sig till medlemsstaterna men någon uttrycklig bestämmelse som artikel 70 i MiFID om att medlemsstaterna senast en viss dag ska anta de lagar och författningar som krävs för att följa direktivet, finns inte. Enligt artikel 5 i det kodifierade listningsdirektivet ska medlemsstaterna se till att värdepapper inte upptas till officiell notering om inte villkoren i direktivet är uppfyllda. Detta kan man tolka så att om en medlemsstat valt att införa begreppet officiell notering måste den staten också införa noteringsregler m.m. i enlighet med direktivet. Det är dock inte säkert att man därmed motsatsvis kan

dra slutsatsen att en medlemsstat som valt att inte ha någon officiell notering inte heller behöver ställa upp krav i enlighet med direktivet. En sådan tolkning förefaller dock CESR ha gjort när man i det första utkastet till förslag till genomförandeåtgärder avseende artikel 40 i MiFID, noteringskraven, påpekade att det kodifierade listningsdirektivet tillåter medlemsstaterna att ställa upp särskilda krav för instrument som är ”officiellt noterade”. CESR skrev:

It should also be noted that the Consolidated Listing Directive remains in force to some extent – which will allow Member States to maintain an ’Official List’ with more stringent requirements applied to constituent securities than for others.

60

Det kodifierade listningsdirektivet är dock ändå ett direktiv som riktar sig till medlemsstaterna och även om en annan tolkning är möjlig bör utgångspunkten vara att medlemssaterna är skyldiga att införliva direktivet i sin nationella lagstiftning.

Prospektdirektivet

Enligt artikel 3.3 i prospektdirektivet som genomförts i Sverige genom ändringar i handelslagen ska ett prospekt offentliggöras vid varje upptagande av värdepapper till handel på en reglerad marknad (SFS 2005:833). I de lagändringar som gjorts för att genomföra prospektdirektivet infördes ingen definition av vad det innebär att ett instrument är upptaget till handel på en reglerad marknad. Men i förarbetena till lagändringarna utgick man från att både inregistrering enligt 5 kap. börs- och clearinglagen och notering enligt 6 kap. innebär att ett instrument tas upp till handel. Man konstaterade att prospektdirektivets tillämpningsområde var vidare än den tidigare lydelsen av den svenska lagen och att reglerna ska tillämpas i samtliga fall då värdepapper tas upp till handel på en reglerad marknad.

61

Med värdepapper avses i detta sammanhang i

stort sett alla former av fondpapper med undantag för fondandelar och penningmarknadsinstrument med en löptid på mindre än tolv

60

CESR´s Advice on Possible Implementing Measures of the Directive 2004/39/EC on Markets in Financial Intsruments, Consultation paper, June 2004, CESR/04-261b, s. 96.

61

Prop. 2004/05:158, s. 65.

månader. Reglerade marknader är, enligt nämnda förarbeten både börser och auktoriserade marknadsplatser.

62

Öppenhetsdirektivet

Ytterligare krav på emittenters informationslämnande följer av det s.k. öppenhetsdirektivet. Direktivet ska vara genomfört i medlemsstaterna den 20 januari 2007 och gäller bl.a. emittenter vars värdepapper är upptagna till handel på en reglerad marknad.

63

Direktivet

ställer krav på hel- och halvårsrapporter, flaggning och annan löpande information från emittenten. Liksom prospektdirektivets krav kommer dessa krav att gälla generellt för emittenter vars värdepapper är upptagna till handel på en reglerad marknad, se artikel 1 i direktivet. De värdepapper som omfattas är liksom prospektdirektivet i stort sett alla former av fondpapper med undantag för fondandelar och för penningmarknadsinstrument med en löptid på mindre än tolv månader.

Direktivet om uppköpserbjudanden

Enligt detta direktiv ska det i medlemsstaterna finnas regler om hur offentliga erbjudanden om uppköp ska gå till. Direktivet föreslås genomföras i Sverige bl.a. genom en ny lag och ändringar i handelslagen och börs- och clearinglagen (se prop. 2005/06:140). Direktivet innehåller regler om utformningen av erbjudandet, budplikt, vad målbolaget får göra osv. Sådana regler finns för närvarande i 2 kap. handelslagen och i NBK:s s.k. takeover-rekommendation.

64

Bestämmelserna i direktivet ska tillämpas på upp-

köpserbjudanden som avser värdepapper som är upptagna till handel på en reglerad marknad, se artikel 1.1 i direktivet. Direktivets tillämpningsområde är dock mindre än öppenhets- och prospektdirektiven – i direktivet om uppköpserbjudanden avses med

62

A prop. s. 65. Begreppet ”reglerad marknad” finns redan i ISD, men med en annan definition än i MiFID och ansågs även vid genomförandet av ISD omfatta både börser och auktoriserade marknadsplatser, se prop. 1994/95:50, s. 117.

63

I Finansdepartementets promemoria Informationskrav i noterade företag, m.m. (Ds 2006:6) lämnas ett förslag till genomförande av direktivet.

64

Näringslivets börskommittés regler, Offentliga erbjudanden om aktieförvärv (”takeoverreglerna”), 2003-09-01. Rekommendationen är också en del av Stockholmsbörsens och NGM:s noteringsavtal.

värdepapper endast överlåtbara värdepapper som medför rösträtt i ett bolag.

7.4.4. Överväganden och förslag

Förslag: En definition av reglerad marknad, som motsvarar MiFID:s definition, tas in i lagen om värdepappersmarknaden.

Begreppet auktoriserad marknadsplats utmönstras ur lagstiftningen.

Börs definieras som ett företag som har tillstånd att driva en eller flera reglerade marknader (en marknadsoperatör enligt MiFID).

Reglerna för reglerade marknader utformas så att de inte hindrar att en börs driver en reglerad marknad i en annan juridisk person. Samtliga de skyldigheter som åvilar en reglerad marknad ska dock åvila börsen.

En börs ska också kunna driva en MTF.

Inledning

Vid genomförandet av bestämmelserna om reglerade marknader inställer sig inledningsvis tre frågor: 1) Vilka olika typer av marknadsplatser ska vi lagstifta om i Sverige, 2) Ska lagstiftningen göra det möjligt att skilja den reglerade marknaden och operatören åt och 3) Ska uppdelningen inregistrerade och noterade värdepapper behållas. I det följande tar utredningen ställning till de första två av dessa frågor och föreslår därefter hur bestämmelserna om reglerade marknader bör utformas. Frågan om inregistrering och notering behandlas i avsnitt 13.2.

Olika typer av marknadsplatser

Som utredningen tidigare har konstaterat stämmer det svenska begreppet börs i stort sett överens med MiFID:s begrepp reglerad marknad. Vid genomförandet av MiFID bör därför de ändringar i bestämmelserna om börs och börsverksamhet göras som krävs för att nå full överensstämmelse med MiFID:s begrepp reglerad marknad, se kapitel 13. Frågan är dock hur de andra svenska marknads-

platserna – auktoriserad marknadsplats och handel organiserad av värdepappersinstitut – ska regleras i förhållande till MiFID.

Som framgått av föregående avsnitt kommer en klassificering av en marknadsplats som en ”reglerad marknad” att innebära att en stor mängd regler blir tillämplig på den som driver marknadsplatsen, på dem som deltar i handeln och på de emittenter vars instrument är upptagna till handel där. För den som driver marknadsplatsen och dem som deltar i handeln är det främst fråga om MiFID:s och marknadsmissbruksdirektivets regler och för emittenterna är det, utöver marknadsmissbruksdirektivet, prospektdirektivet, öppenhetsdirektivet och direktivet om uppköpserbjudanden.

Den massiva regleringen av företeelsen reglerad marknad innebär ett väl utvecklat investerarskydd främst genom de högt ställda kraven på de noterade bolagens informationsskyldighet. Detta i sin tur är utgångspunkten för de kapitalplacerande institutioner som i sina placeringsregler har krav på att investeringar ska ske i instrument som är upptagna till handel på en reglerad marknad, se t.ex. placeringsreglerna för värdepappersfonder i 5 kap. 3 § lagen om investeringsfonder. Ett företag som lever upp till de krav som ställs på den vars instrument är upptagna till handel på en reglerad marknad får således bättre möjligheter att attrahera riskkapital. Kraven på emittenterna kan dock vara omöjliga, eller i vart fall svåra, att leva upp till för mindre företag. För dessa företags riskkapitalförsörjning behövs därför nu liksom tidigare ett alternativ till att ha sina instrument upptagna till handel på en reglerad marknad. Begreppet reglerad marknad i ISD har ansetts omfatta både börs och auktoriserad marknadsplats. Det har medfört att kraven enligt de nämnda direktiven redan gäller, eller kommer att gälla, även för emittenter på en auktoriserad marknadsplats. Det innebär i sin tur att en auktoriserad marknadsplats inte längre är det lättare alternativ till börs som den en gång var tänkt att vara.

65

I realiteten

är således alternativet för de emittenter som inte kan leva upp till kraven i nämnda direktiv, att låta ett värdepappersinstitut organisera handel i företagets instrument. När det gäller denna handel har utredningen tidigare konstaterat att den handeln antingen sker på en MTF, eller om verksamheten inte uppfyller kraven på en MTF, det är fråga om investeringstjänsten ”ta emot och vidarebefordra order”. Till frågorna rörande MTF återkommer utred-

65

Jfr prop. 1991/92:113, s. 109 ff.

ningen strax. Vad som nu närmast bör behandlas är frågan hur företeelsen auktoriserad marknadsplats ska regleras.

För att en auktoriserad marknadsplats ska betraktas som en reglerad marknad krävs det skärpningar av några av de nuvarande reglerna, bl.a. kraven på dem som ska få handla på marknaden, noteringskraven och kraven på de noterade bolagens informationsskyldighet. Som nämnts innebär dock redan dagens reglering att prospektdirektivet, öppenhetsdirektivet och direktivet om uppköpserbjudanden är tillämpliga på de värdepapper som är noterade på en auktoriserad marknadsplats. Någon drastisk skärpning av kraven skulle det därför inte bli fråga om för att en auktoriserad marknadsplats även i fortsättningen ska anses vara en reglerad marknad. Regleringen för verksamhetsformen auktoriserad marknadsplats skulle dock med nödvändighet komma att i det stora hela sammanfalla med den MiFID-anpassade regleringen för börs. Det skulle då knappast finnas någon poäng med att behålla begreppet auktoriserad marknadsplats i sig och begreppet bör därför utmönstras ur den svenska lagstiftningen. En verksamhet som nu drivs i den formen kan beroende på inriktning fortsättas i första hand som en reglerad marknad.

När det sedan gäller MTF ger MiFID utrymme för medlemsstaterna att bestämma olika nivåer för regleringen av denna verksamhet. Man skulle kunna tänka sig att för vissa MTF:er bara föreskriva de minimikrav som följer av MiFID medan man för andra ställde högre krav på t.ex. handelsregler och de noterade bolagens skyldigheter när det gäller att tillhandahålla information och upprätta prospekt. Enligt utredningens mening är det dock inte motiverat, vare sig av investerarskyddsskäl eller för förtroendet för värdepappersmarknaden, att i den svenska lagen nu införa flera nivåer på marknadsplatsverksamhet än vad som följer av MiFID. Utredningen anser tvärtom att fler nivåer snarare kommer att skapa oklarheter om de olika begreppens innebörd och förhålllande till varandra. Utredningen förslår därför att det i lagstiftningen endast ska finnas två nivåer för marknadsplatsverksamhet, nämligen börs – där samtliga de regler som gäller för reglerade marknader är tillämpliga – och MTF – där lagen endast ställer upp vissa minimikrav.

66

På så sätt blir lagstiftningen tydlig och den av lag-

stiftningen sanktionerade kvalitetsstämpeln som begreppet reglerad

66

Vilka krav på genomlysning, emittenters informationsskyldighet m.m. som kommer att gälla för en viss MTF kommer dock att bero på bl.a. hur handeln är organiserad och vilka instrument som ska handlas i varje enskilt fall, se avsnitt 10.4.2 , 13.3 och 13.5.

marknad signalerar blir förbehållen den som lever upp till samtliga de krav som gäller på en sådan marknad. Den som driver en MTF bestämmer själv givet att man lever upp till minimireglerna i MiFID – genom utformningen av interna regler och rutiner – vilken uppfattning emittenter och investerare ska få om verksamheten.

Åtskillnad mellan reglerad marknad och operatör samt drift av MTF

De krav som följer av att ett värdepapper är upptaget till handel på en reglerad marknad skulle kunna bli ganska betungande för mindre företag som ändå behöver riskkapital från kapitalmarknaden. Sådana företag kan dock tas upp till handel på en MTF. Att endast instrument som är upptagna till handel får handlas på en reglerad marknad innebär inte att den som driver den reglerade marknaden skulle vara förhindrad att organisera handel i instrument som inte är upptagna till handel på den reglerade marknaden. Enligt artikel 5.2 får nämligen en marknadsplatsoperatör också driva en MTF. Om en medlemsstat väljer att inte skilja mellan operatören och den reglerade marknaden måste artikeln innebära att MTF:en drivs inom ramen för samma juridiska person som den reglerade marknaden eller i ett dotterbolag till denna. Den verksamheten måste dock vara tydligt avskild från den reglerade marknaden. Och offentliggörandet av kursinformation m.m. avseende de instrument som är upptagna till handel enligt artiklarna 44 och 45 i MiFID bör ske för sig, klart åtskilt från motsvarande information avseende MTF:en.

Som angetts ovan är det möjligt att genomföra artikel 36 i MiFID så att det i lagen ges utrymme för att skilja operatör och reglerad marknad åt. Exempelvis skulle då Stockholmsbörsen AB kunna vara en marknadsplatsoperatör som driver den reglerade marknaden ”Stockholmsbörsens aktiemarknad” och NGM skulle som operatör driva den reglerade marknaden ”NGM Equity”. För att kunna fördela skyldigheter mellan operatören och den reglerade marknaden torde krävas att båda är rättssubjekt som kan ha rättigheter och ikläda sig skyldigheter. I sammanhanget inställer sig dock en del frågor. Hur ordnar man t.ex. en effektiv tillsyn om operatören finns i en annan medlemsstat än den reglerade marknaden (se t.ex. artikel 43.2)? Även om den ökade flexibilitet som en

uppdelning mellan operatör och reglerad marknad ger teoretiskt skulle kunna underlätta t.ex. det nordiska börssamarbetet är det tveksamt om det skulle bli fallet i praktiken. De övriga nordiska länderna avser inte att införa möjligheten att göra en uppdelning mellan operatör och marknad. Även om den eftersträvade flexibiliteten således inte omedelbart kan uppnås bör den svenska lagen utformas så att den i och för sig inte hindrar att en operatör driver en reglerad marknad i en annan juridisk person. För att undvika problem med tillsynen bör dock huvudregeln vara att alla de skyldigheter som en reglerad marknad har enligt direktivet åvilar den operatör som driver marknaden. Den som driver en reglerad marknad ska också kunna få tillstånd att driva en MTF.

Utformningen av bestämmelserna om reglerad marknad

Dagens svenska bestämmelser om börs är utformade så att det i 1 kap. 4 § 1 i börs- och clearinglagen finns en definition av vad en börs är. Enligt definitionen är en börs ett företag som fått auktorisation enligt 2 kap. att driva verksamhet som syftar till att åstadkomma regelbunden handel med finansiella instrument mellan till verksamheten anknutna medlemmar. I 2 kap. anges förutsättningarna för auktorisation och i 4 kap. finns bestämmelser om börsens verksamhet. Regleringen innebär att det är det auktoriserade företaget i sig – ett svenskt aktiebolag eller en svensk ekonomisk förening – som är en börs. Detta blir lite märkligt i förhållande till de övriga reglerna i börs- och clearinglagen som stadgar att börsen har medlemmar (3 kap.) och att finansiella instrument får noteras och inregistreras ”vid börsen” (4 kap. 1 § och 5 kap. 1 §). Utformningen av dagens bestämmelser är en kvarleva från Stockholms Fondbörs tid då börsens rättsliga status inte var så enkel att fastslå. Då karakteriserades Fondbörsen som en privaträttslig sammanslutning som genom åren fått en alltmer offentligrättslig karaktär.

67

I det sammanhanget var det relevant att

tala om t.ex. medlemmar på börsen.

I dag fungerar de svenska börserna, Stockholmsbörsen och NGM, så att de är aktiebolag som träffar avtal med andra juridiska personer (medlemmar) om handel på en eller flera marknadsplatser som sköts av börserna. Medlemsavtalen är inte på något sätt associationsrättsliga – medlemmarna har inga andelar i börsen och

67

Se prop. 1978/79:9, s. 301 och prop. 1991/92:113, s. 71.

de har ingen beslutsfattande funktion. Avtalen är i stället rent obligationsrättsliga avtal som i princip reglerar vad som gäller när den ena parten (medlemmen) deltar i handeln i den andra partens (börsens) handelssystem samt vad som gäller vid transaktioner på börsen mellan medlemmarna. Det är vidare en mer korrekt verklighetsbeskrivning att tala om handeln på t.ex. Stockholmsbörsen som handel på flera olika handelsplatser än som handel på en börs. Så sker t.ex. handeln på marknaden för aktier i ett särskilt system enligt särskilda regler, medan handeln med standardiserade derivatinstrument sker i ett helt annat system och enligt andra regler. Börserna träffar också avtal med andra företag om att ta upp av företagen emitterade finansiella instrument till handel på marknadsplatserna. Även dessa noteringsavtal är olika för de olika marknaderna.

En reglering som är anpassad både till hur handeln på börserna nu för tiden faktiskt är organiserad och till reglerna i MiFID bör därför utgå från att en marknadsplatsoperatör kan driva flera reglerade marknader. De olika marknaderna kan drivas som flera olika system, med olika handelsregler, deltagare och noterade instrument inom samma juridiska person. Vart och ett av systemen är då att anse som en reglerad marknad och företaget bör ha tillstånd för var och en av marknaderna. Därutöver bör det också vara möjligt att den reglerade marknaden och marknadsplatsoperatören är olika juridiska personer. Utredningen föreslår därför att en definition av reglerad marknad – motsvarande MiFID:s – införs i lagen. Begreppet börs bör därefter definieras som ett företag som fått tillstånd att driva en eller flera reglerade marknader. Lagens krav på handelsregler, noteringsregler m.m., se nedan i kapitel 13, bör sedan utformas så att börsen ansvarar för att det finns handelsregler, noteringsregler, marknadsövervakning m.m. på de reglerade marknader börsen driver. En sådan reglering gör det också lättare att skilja mellan vad som är en MTF och vad som är en reglerad marknad när en börs får tillstånd att driva en MTF.

7.5. Undantag från direktivets tillämpningsområde

7.5.1. Obligatoriska undantag

I artikel 2 i MiFID undantas en rad verksamheter och företag från direktivets tillämpningsområde. Merparten av undantagen motsvarar vad som redan gäller enligt ISD. I de flesta fall motsvaras dessa gamla undantag av undantag i den svenska lagen men i några fall är det mer tveksamt i vilken mån den svenska lagen stämmer överens med direktiven. Därutöver tillkommer några nya undantag.

Undantag som redan finns i ISD

Försäkringsföretag och tjänster inom en koncern, som är undantagna enligt artikel 2.1 a och b, är i Sverige undantagna från tillståndsplikt enligt 1 kap. 1 § tredje stycket och 1 kap. 3 a § lagen om värdepappersrörelse.

I artikel 2.1 c i MiFID finns ett undantag för den som tillfälligt tillhandahåller investeringstjänster i samband med annan yrkesmässig verksamhet som regleras i lag eller annan författning eller etiska regler för verksamheten i fråga. Exempel på sådan verksamhet är boutredningsmans eller konkursförvaltares förvaltning och andra åtgärder med ett dödsbos respektive konkursbos finansiella instrument.

68

Enligt 1 kap. 1 § tredje stycket sista meningen lagen

om värdepappersrörelse är lagen inte tillämplig på förvaltning av finansiella instrument som är reglerad i annan lag. Detta undantag träffar nog många, men knappast alla de undantag som avses i direktivet.

Undantagen i artikel 2.1 e och f i MiFID avser företag som förvaltar program som syftar till delägarskap för anställda i företaget, eller andra företag i en koncern. I den mån ett företag själv hanterar optionsprogram för sina anställda kan detta komma att innebära att företaget utför investeringstjänster i direktivets mening gentemot sina, eller koncernföretagets, anställda.

Undantagen i artikel 2.1 g och h för centralbanker och liknande samt företag för kollektiva investeringar (investeringsfonder) och deras förvarings- och förvaltningsinstitut finns också de i ISD. Dessa subjekts förvaltning anses i Sverige undantagna enligt 1 kap. 1 § tredje stycket lagen om värdepappersrörelse.

68

Prop. 1990/91:142, s. 111.

Undantaget i artikel 2.1 l finns i ISD och avser den som uteslutande handlar med derivatinstrument för egen räkning samt på avistamarknaden endast i syfte att skydda positionerna på derivatmarknaden eller som handlar på uppdrag av andra medlemmar på derivatmarknaden och ställer priser för dem som garanteras av clearingmedlemmar. För att undantaget ska vara tillämpligt ska vidare clearingmedlemmar ansvara för verkställigheten av de avtal (derivatkontrakt) som företaget i fråga ingår. Vilken verksamhet undantaget egentligen syftar på är inte helt lättbegripligt men antagligen syftar det på s.k. ”locals” på t.ex. LIFFE

69

som har en

market maker-liknande funktion.

Undantagen i artikel 2.1 m och n rör verksamheter som enbart finns i Danmark, Finland och Italien och finns redan i ISD.

Nya undantag i förhållande till ISD

I artikel 2.1 d i MiFID undantas den som, utan att vara marknadsgarant (market maker) eller systematisk internhandlare, enbart handlar för egen räkning på en reglerad marknad eller en MTF. Någon motsvarighet till detta undantag finns inte i ISD.

I artikel 2.1 i finns ett undantag som rör den som enbart utför investeringstjänster rörande råvaruderivat och sådana derivatinstrument vars underliggande tillgång är klimatvariationer, utsläppsrätter, statistik osv., se punkten 10 i avsnitt C i bilaga 1 till MiFID. En ytterligare förutsättning för undantaget är att verksamheten är ett komplement till företagets eller företagsgruppens huvudsakliga verksamhet. Den huvudsakliga verksamheten ska vara något annat än investeringstjänster eller banktjänster. Exempel på företag som faller in under detta undantag är företag som handlar med elderivat osv. och som ingår i samma koncern som ett elbolag. Även den vars huvudsakliga verksamhet är handel med råvaror och/eller råvaruderivat för egen räkning ska enligt artikel 2.1 k vara undantagen från direktivets tillämpningsområde om denne inte ingår i företagsgrupp vars huvudsakliga verksamhet är att tillhandahålla investeringstjänster.

I artikel 2.1 j finns ytterligare ett nytt undantag i förhållande till ISD. Enligt artikeln ska direktivet inte tillämpas på den som tillhandahåller investeringsrådgivning inom ramen för annan profes-

69

London International Financial Futures Exchange.

sionell verksamhet under förutsättning att ingen specifik ersättning lämnas för rådgivningen.

7.5.2. Frivilligt undantag

I ISD var företag som enbart tog emot och vidarebefordrade order avseende överlåtbara värdepapper och fondandelar till vissa tillståndspliktiga företag (värdepappersföretag, fondbolag m.fl.) undantagna från direktivets tillämpningsområde. En ytterligare förutsättning för att undantaget skulle vara tillämpligt var att företaget i fråga inte fick inneha kunders medel eller värdepapper. I MiFID får, enligt artikel 3, medlemsstaterna välja att inte tillämpa direktivet på sådana företag.

7.5.3. Överväganden och förslag

Förslag: Undantagen från tillämpningsområdet i den svenska lagen justeras så att de överensstämmer med artikel 2.1 c–f och h–l. Undantaget för försäkringsmäklare i den svenska lagen behålls.

De obligatoriska undantagen

Undantagen i artikel 2.1 a, b och g avseende försäkringsföretag, tjänster inom en koncern och centralbanker m.fl. täcks av undantag i den svenska lagen och någon ändring behövs inte för att genomföra MiFID i denna del.

I förarbetena till de svenska bestämmelserna om tillståndsplikt för egen handel har uttalats att för att vara tillståndspliktig måste handeln ingå i en verksamhet där det primära är att tillhandahålla en tjänst åt företagets kunder.

70

Med denna utgångspunkt faller några

av de verksamheter som undantagits från MiFID:s tillämpningsområde utanför det tillståndpliktiga området enligt den svenska lagen. För att undantagen i artikel 2.1 d (den som, utan att vara market maker eller systematisk internhandlare, enbart handlar för egen räkning på en reglerad marknad eller MTF) och artikel 2.1 k (den som enbart handlar för egen räkning i råvaror eller råvaru-

70

Prop. 1990/91:142, s. 110.

derivat) ska vara tillämpliga ska företagen i fråga uteslutande ägna sig åt handel för egen räkning utan att verksamheten ingår i en verksamhet där det primära är att tillhandahålla en tjänst åt företagets kunder. Sådan verksamhet omfattas inte av den svenska lagens egenhandelsbegrepp och begreppet är detsamma i den nya lagen om värdepappersmarknaden så något uttryckligt undantag behövs därför inte.

Av beskrivningen av den verksamhet som är undantagen enligt artikel 2.1 l framgår uttryckligen att en del av verksamheten kan gå ut på att tillhandahålla tjänster åt andra företag. Verksamheten skulle därför vara tillståndspliktig enligt dagens svenska regler. Även om denna verksamhet inte förekommer i Sverige i dag bör lagen, i enlighet med MiFID, göra det möjligt att i bedriva verksamheten utan tillstånd. Ett undantag för denna verksamhet bör därför tas in i lagen.

När det sedan gäller de specifikt italienska och danska verksamheterna som beskrivs i artikel 2.1 m och n innebär undantagen att direktivet inte är tillämpligt på dessa verksamheter överhuvudtaget. Därmed gäller inte heller rättigheterna att tillhandahålla investeringstjänster i andra medlemsstater och det behövs inga undantag i den svenska lagen.

Av de undantag som räknas upp i MiFID är det artikel 2.1 c, h, i och j som kräver ändringar i den svenska lagen.

Man skulle kunna argumentera för att undantagen för dem som tillfälligt tillhandahåller en investeringstjänst inom ramen för en annan reglerad näringsverksamhet (artikel 2.1 c) och fondbolag (2.1 h) omfattas av det svensk undantaget för förvaltning av finansiella instrument som är reglerad i annan lag. Det är dock inte säkert att begreppet förvaltning av finansiella instrument täcker samtliga de åtgärder som t.ex. en boutredningsman eller advokat, som båda skulle omfattas av artikel 2.1 c, kan behöva vidta. Ett uttryckligt undantag motsvarande artikel 2.1 c bör därför införas. På samma sätt kan inte samtliga de åtgärder ett fondbolag vidtar i förhållande till fondandelsägarna och till den fond bolaget förvaltar sägas inrymmas inom begreppet förvaltning. I fondverksamheten som drivs av fondbolaget ingår t.ex. försäljning och inlösen av andelar i fonden, se 1 kap. 1 § 11 lagen om investeringsfonder, vilket närmast motsvaras av investeringstjänsten utföra kunders order. För att det inte ska råda någon tveksamhet om att ett fondbolag varken behöver eller kan få tillstånd att utföra investerings-

tjänster bör ett uttryckligt undantag formulerat ungefär som artikel 2.1 h införas i den svenska lagen.

Undantaget enligt 2.1 i omfattar t.ex. företag som handlar med råvaruderivat och derivatkontrakt av de slag som uppräknas i punkten 10 i avsnitt C i bilaga I till MiFID. För svenskt vidkommande torde i första hand företag som handlar med s.k. elderivat att beröras. Sådana företag har hittills i svensk rätt ansetts bedriva tillståndpliktig värdepappersrörelse(se prop. 1996/97:136 s. 108 ff). I ISD anses el- och råvaruderivat inte vara sådana finansiella instrument som omfattas av direktivet. Trots det anses dessa derivat enligt svensk rätt vara finansiella instrument enligt definitionen i handelslagen och företagen är tillståndspliktiga enligt lagen om värdepappersrörelse. Eftersom derivaten inte omfattas av ISD gäller dock inte det s.k. Europapasset för dessa företag.

I MiFID faller visserligen instrumenten i sig in under definitionen av finansiella instrument. Men å andra sidan faller företag som bedriver handeln med elderivat som ett komplement till företagets eller företagsgruppens huvudsakliga verksamhet nu under ett av MiFID:s obligatoriska undantag. Detta gäller dock endast om mottagarna till företagets investeringstjänster i nämnda derivatkontrakt uteslutande också är kunder i företagets eller företagsgruppens huvudsakliga verksamhet (förutsatt att denna huvudverksamhet inte består i att tillhandahålla investeringstjänster eller banktjänster). Om exempelvis ett elbolag, som vid sidan av att sälja el till sina kunder, även tillhandahåller investeringstjänster i elderivat till samma kunder, exempelvis i syfte att underlätta för kunderna att säkra sina elpris, så krävs inget tillstånd enligt MiFID, så länge som investeringstjänsterna inte riktas utanför kretsen av elkunder. I fall där företaget tillhandahåller investeringstjänster i elderivat till kunder som köper sin el från någon annan än företaget eller företagsgruppen, så krävs däremot tillstånd.

Möjligheten att utan särskilt tillstånd tillhandahålla investeringstjänster i råvaruderivat till befintliga råvarukunder innebär för svensk del en viss avreglering jämfört med tidigare. Att Sverige haft strängare tillståndskrav för denna typ av verksamhet än vad som föreskrevs i ISD berodde till viss del på ett förbiseende i det svenska genomförandet av ISD och tillståndskraven saknar motsvarighet i de övriga nordiska länderna. De samhällsekonomiska motiven för enhetliga regler för den nordiska elderivatmarknaden är starka. Det talar för att i den svenska lagstiftningen nära följa de övriga nordiska ländernas regler i frågan. Även om lagstiftningen

för närvarande inte är helt likartad i de övriga nordiska länderna, så ökar möjligheterna till nordisk samsyn om tillståndskraven sätts så att de motsvarar MiFID:s minimibestämmelser och inte strängare än dessa. Mot denna ansats talar de eventuella fördelar som finns ur tillsynssynpunkt av den enhetligare behandling av elderivatmarknaden som skulle bevaras av att på nationell nivå bibehålla de strängare tillståndskraven. Utredningen gör dock bedömningen att behoven av gemensamma regler på den nordiska elmarknaden väger tyngre och att behoven av att i Sverige ha strängare tillståndsregler än i övriga länder är litet, inte minst på grund av avsaknaden av konsumentskyddsmotiv, då elderivatmarknaden i första hand är en marknad för professionella aktörer. Ett undantag motsvarande artikel 2.1 i bör således tas in i den svenska lagen.

Med den utvidgning av det tillståndspliktiga området som följer av MiFID behövs ett uttryckligt undantag i den svenska lagen för att undanta verksamhet där investeringsrådgivning ingår som en del i en i övrigt icke tillståndspliktig verksamhet (artikel 2.1 j). Sådan verksamhet ska, i enlighet med direktivet, bara vara undantagen om det inte utgår ersättning för just rådgivningen.

Det frivilliga undantaget

Undantaget för försäkringsmäklare i 1 kap. 3 b § lagen om värdepappersrörelse är utformat i enlighet med det obligatoriska undantaget i ISD

71

och bör med stöd av artikel 3 i MiFID behållas.

71

Se prop. 1994/95:50, s. 96 f.

8. Tillståndskrav för svenska företag

8.1. Värdepappersföretag

8.1.1. Grundläggande krav

Tillstånd, register, säte och huvudkontor

I artikel 5 i MiFID ställs krav på att investeringstjänster ska vara tillståndspliktiga i medlemsstaterna, att medlemsstaterna ska föra register över värdepappersföretagen och att värdepappersföretag som är juridiska personer och har ett stadgeenligt säte ska ha huvudkontor i den medlemsstat där företaget har sitt säte. Ett värdepappersföretag som inte har något säte ska enligt MiFID ha sitt huvudkontor i den medlemsstat där det faktiskt bedriver sin verksamhet. Bestämmelserna motsvarar, förutom regeln om registret, dem som redan gäller enligt artikel 3.1 och 3.2 i ISD. Enligt artikel 5 i MiFID tillkommer att även en marknadsoperatör kan få tillstånd att driva en MTF, se avsnitt 7.4, samt att tillståndsgivning m.m. för tjänsten investeringsrådgivning kan delegeras av den behöriga myndigheten.

Krav på att företagen ska lämna information m.m.

I artikel 7 i MiFID ställs krav på att den behöriga myndigheten innan auktorisation beviljas ska förvissa sig om att sökanden uppfyller samtliga krav enligt de bestämmelser som antagits enligt MiFID. Vidare ska värdepappersföretaget lämna all information, inklusive en verksamhetsplan, som krävs för att den behöriga myndigheten ska kunna avgöra om kraven är uppfyllda vid tidpunkten för auktorisationen. Slutligen ska, enligt samma artikel, en sökande få svar på sin ansökan inom sex månader. Kraven motsvarar i stort sett kraven enligt ISD, även om kraven i artiklarna 3.4 och 4 i ISD i första hand är fokuserade på ägar- och ledningsprövning samt verk-

samhetsplan. Även kravet på besked inom sex månader i MiFID motsvarar kravet i ISD.

Enligt artikel 6.1 i MiFID ska det i auktorisationen av ett värdepappersföretag anges vilka investeringstjänster företaget har tillstånd till. Auktorisation får, enligt samma artikel, inte beviljas endast för att tillhandahålla s.k. sidotjänster, dvs. tjänster enligt avsnitt B i bilaga I till MiFID. Motsvarande krav finns i artikel 3.1 ISD. Enligt artikel 6.2 i MiFID ska ett företag som vill utvidga sin verksamhet, med ytterligare investeringstjänster eller sidotjänster, begära utvidgning av auktorisationen.

Lednings- och ägarprövning

I artikel 9 i MiFID ställs krav på vandel och erfarenhet avseende de personer som leder verksamheten i ett värdepappersföretag. Motsvarande krav finns i artikel 3.3 i ISD. Om en marknadsoperatör ansöker om tillstånd för att driva en MTF är ledningsprövningen avseende marknadsoperatören enligt artikel 9.1tillräcklig, förutsatt att det de personer som leder den reglerade marknadens verksamhet är desamma som de som leder MTF-verksamheten. I svensk rätt återfinns kraven på styrelsens, verkställande direktörens och dennes ställföreträdares insikter, erfarenhet och lämplighet i övrigt, i 2 kap. 1 § första stycket 4 lagen om värdepappersrörelse.

I ett värdepappersföretag ska, enligt artikel 9.4 i MiFID, ledningen bestå av minst två personer som uppfyller kraven. Direktivet ger möjlighet till undantag från denna minimiregel i vissa fall. Motsvarande regel och undantagsmöjlighet finns i artikel 3.3 i ISD. I Sverige krävs enligt 2 kap. 4 § lagen om värdepappersrörelse att ett värdepappersbolag har en styrelse med minst fem ledamöter och en verkställande direktör.

Den behöriga myndigheten ska enligt artikel 9.3 vägra auktorisation om myndigheten inte är övertygad om att värdepappersföretagets ledning har den erfarenhet och vandel som krävs. I Sverige följer ett motsvarande krav av att tillstånd att bedriva värdepappersrörelse endast får ges om bl.a. kraven på ledningen är uppfyllda. I artikel 9.3 står också att den behöriga myndigheten ska vägra auktorisation om en föreslagen ändring i ledningen skulle äventyra en sund och ansvarsfull ledning av företaget. Det blir i sådana fall snarare fråga om att återkalla en auktorisation än att inte bevilja.

Slutligen ska värdepappersföretagen, enligt artikel 9.2, underrätta den behöriga myndigheten om ändringar i företagsledningen och tillhandahålla underlag för en vandels- och erfarenhetsprövning av nya personer.

Överväganden och förslag

Förslag: Reglerna om tillstånd samt lednings- och ägarprövning förs över oförändrade till den nya lagen om värdepappersmarknaden med följande kompletteringar.

Finansinspektionen ska föra ett register över företag som fått tillstånd.

Företagen ska anmäla ändringar beträffande styrelse och verkställande direktör och regeringen eller den myndighet regeringen bestämmer får utfärda närmare föreskrifter om vilka uppgifter som ska lämnas vid ansökan om tillstånd samt vid förändringar i företagsledningen.

Lägsta antalet styrelseledamöter i ett värdepappersbolag ändras från fem till tre.

Huvudkontor, register m.m.

Kraven i artikel 5 i MiFID på tillstånd, huvudkontor och säte finns redan i svensk rätt. Några nya bestämmelser för att genomföra dessa delar av MiFID behövs därför inte. I lagen finns dock ingen uttrycklig regel om att Finansinspektionen ska föra ett register över de företag som har fått tillstånd. I ISD finns som nämnts inget krav på register över värdepappersföretag däremot finns en liknande bestämmelse om register över reglerade marknader i arti- kel 16. Artikeln noterades vid genomförandet av ISD men ledde inte till någon uttrycklig regel i lag eller förordning.

1

Enligt

utredningens mening behövs ingen lagändring för att införliva denna bestämmelse. Den befintliga bestämmelsen i 2 § 4 i förordningen (1996:596) med instruktion för Finansinspektionen om att inspektionen ska medverka i internationellt samarbete som rör inspektionens verksamhetsområde bör dock kompletteras med en

1

Se prop. 1994/95:50, s. 116.

regel om att inspektionen ska föra ett register över värdepappersföretag med tillstånd.

Kravet på företagen att lämna information

I svensk rätt följer kraven på vilka uppgifter som ska lämnas av den som söker tillstånd av 2 kap. lagen om värdepappersrörelse. I 8 § i detta kapitel finns ett uttryckligt krav på att en verksamhetsplan ska bifogas ansökan. Vad en sådan plan ska innehålla är reglerat i Finansinspektionens föreskrifter (FFFS 2002:6) om verksamhetsplan för värdepappersbolag m.fl. Ytterligare regler om ansökningsförfarandet finns i 2 kap. i Finansinspektionens allmänna råd (FFFS 2002:5) om värdepappersrörelse. Någon föreskriftsrätt på detta område, förutom vad gäller verksamhetsplanen, har inspektionen inte. Föreskriftsrätten i 6 kap. 2 § 1 lagen om värdepappersrörelse gäller vilka upplysningar den som redan är värdepappersinstitut ska lämna till Finansinspektionen. Även om de nuvarande svenska bestämmelserna i stort sett uppfyller MiFID:s krav bör dock föreskriftsrätten utvidgas till att omfatta även vilka upplysningar det företag ska lämna som ännu inte är värdepappersinstitut men som ansöker om tillstånd.

Kraven på att tillståndet ska ange vilken verksamhet som avses och att företagen ska söka nya tillstånd för nya verksamheter (artikel 6.1 och 6.2 i MiFID) motsvarar dem som följer av gällande svenska tillståndsregler. Reglerna i MiFID påkallar därför inte någon ändring i sak.

Ägare och ledning

De svenska reglerna om styrelse, ledande befattningshavare samt deras vandel och erfarenhet motsvarar kraven i MiFID och behöver inte ändras. Detsamma gäller reglerna om ägarprövning m.m. i artikel 10 i MiFID. Bestämmelserna i den svenska lagen går dock utöver minimikravet i MiFID när det gäller antal styrelseledamöter (fem i stället för två). Enligt 10 kap. 7 § lagen om bank- och finansieringsrörelse ska ett bankaktiebolag ha minst tre styrelseledamöter. Det finns inte anledning att ha avvikande krav för värdepappersbolag och samma krav som för banker bör gälla värdepappersbolag.

I svensk rätt är regeln om att Finansinspektionen kan motsätta sig en förändring i gruppen ledande befattningshavare utformad som en återkallelsegrund, se 6 kap. 9 § andra stycket 2 lagen om värdepappersrörelse. Regeln motsvarar kravet i artikel 9.3 i MiFID och behöver inte ändras.

Regler om värdepappersinstitutens skyldighet att lämna uppgifter om ledande befattningshavare finns i Finansinspektionens föreskrifter (FFFS 1998:13) om rapporteringsskyldighet vid utseende av vissa ledande befattningshavare samt allmänna råd (FFFS 1998:14) om ägar- och ledningsprövning. Ett krav på att ändringar vad gäller styrelse och verkställande direktör bör dock införas i lagen för att införliva motsvarande krav i artikel 9.2 i MiFID. Med en utvidgad föreskriftsrätt, i enlighet med utredningens förslag ovan, kan regeringen eller den myndighet regeringen bestämmer utfärda bindande föreskrifter både om vilka uppgifter som ska lämnas vid ansökan och vilka uppgifter som ska lämnas vid förändringar.

8.1.2. Krav på kapital och system för investerarskydd

Kapitalkrav

Bestämmelsen i artikel 12 i MiFID om att ett värdepappersföretag ska ha ett tillräckligt startkapital i enlighet med det s.k. kapitalkravsdirektivet (direktiv 93/6/EEG), CAD, finns sedan tidigare i artikel 3.3 i ISD.

2

Kraven enligt ISD har genomförts genom änd-

ring av 2 kap. 5 § lagen om värdepappersrörelse.

3

System för investerarskydd

Enligt artikel 11 i MiFID ska den behöriga myndigheten kontrollera att den som ansöker om auktorisation vid tiden för auktorisationen fullgör sina förpliktelser enligt det s.k. investerarskyddsdirektivet (direktiv 97/9/EG). Det direktivet har genomförts i

2

Under hösten 2005 enades rådet och kommissionen om ett förslag till ett nytt direktiv.

Efter språkgranskning av direktivtexten förväntas ett formellt antagande av direktivet kunna ske under våren 2006. Direktivet ska vara genomfört den 31 december 2006. Finansdepartementet har i en promemoria utgiven den 22 december 2005 om nya kapitaltäckningsregler lämnat förslag på genomförande av direktivet.

3

Prop. 1994/95:50, s. 111 ff.

svensk rätt genom lagen (1999:158) om investerarskydd.

4

Enlig 1 §

andra stycket i den lagen handläggs frågor om investerarskyddet av Insättningsgarantinämnden och enligt 23 § samma lag ska nämnden underrätta Finansinspektionen om ett värdepappersinstitut inte fullgör sina skyldigheter enligt lagen.

Överväganden och förslag

Förslag: Ett företag som driver en MTF ska ha ett startkapital som vid tidpunkten för tillståndsbeslutet motsvarar 730 000 euro och ett företag som enbart bedriver investeringsrådgivning eller tar emot och vidarebefordrar order utan att inneha kunders medel eller värdepapper ska ha antingen ett visst startkapital, en ansvarsförsäkring av viss omfattning eller en kombination av startkapital och ansvarsförsäkring. I övrigt förs bestämmelserna om kapitalkrav oförändrade över till den nya lagen om värdepappersmarknaden.

Värdepappersbolag vars verksamhet omfattar mottagande av medel på konto behöver inte ha ansvarsförsäkring.

Ett värdepappersbolags förvärv av egendom kräver Finansinspektionens tillstånd, om institutets motprestation motsvarar mer än 25 procent av bolagets kapitalbas. Tillstånd till förvärv ska ges om det inte kan antas att förvärvet leder till att reglerna i lagen om värdepappersmarknaden eller andra författningar överträds. Tillståndet ska meddelas före förvärvet. Ansökan ska prövas av Finansinspektionen.

Kapitalkrav

MiFID innebär inte i sig någon ändring av kapitalkraven men de nya verksamheterna investeringsrådgivning och drift av MTF innebär att gällande svenska bestämmelser om startkapital måste justeras. Företag som endast bedriver verksamheten drift av MTF tillhör kategorin övriga värdepappersföretag i CAD och ska ha ett startkapital på 730 000 euro. Däremot gäller särskilda regler för det företag som endast bedriver investeringsrådgivning eller tar emot och vidarebefordrar order utan att inneha kunders medel eller

4

Prop. 1998/99:30.

värdepapper. Enligt de ändringar av CAD som skett genom arti- kel 67 i MiFID ska sådana företag antingen ha ett startkapital på 50 000 euro, eller en ansvarsförsäkring eller motsvarande som täcker skador på grund av fel eller försummelser (minst 1 000 000 euro för varje skadeståndskrav och minst 1 500 000 euro per år). Ett tredje alternativ är att företaget har en kombination av startkapital och ansvarsförsäkring som ger ett motsvarande skydd. Ett lite lättare kapitalkrav gäller dock om ett sådant företag som nyss beskrivits också är registrerat som försäkringsförmedlare enligt direktiv 2002/92/EG om försäkringsförmedling. Enligt artikel 3.4 b i CAD – en artikel som även den införts genom MiFID (artikel 67) – ska ett sådant företag ha ett startkapital på 25 000 euro, eller en ansvarsförsäkring (minst 500 000 euro för varje skadeståndskrav och minst 750 000 euro per år), eller en kombination av startkapital och ansvarsförsäkring som ger ett motsvarande skydd. För svenskt vidkommande ska detta kapitalkrav gälla företag som registrerats enligt 2 kap.3 och 4 §§ lagen (2005:405) om försäkringsförmedling.

De svenska bestämmelserna om startkapital bör således ändras dels så att drift av MTF hamnar i den kategori där kravet på startkapital är 730 000 euro (se om kapitalkraven för en marknadsoperatör som driver en MTF nedan i avsnitt 8.3.2), dels så att särskilda regler införs för de företag som enbart bedriver verksamheten investeringsrådgivning eller tar emot och vidarebefordrar order utan att inneha kunders medel eller värdepapper.

Ansvarsförsäkring

I MiFID finns inget krav på ansvarsförsäkring för värdepappersföretag. Ett sådant krav finns däremot i 5 kap. 2 § lagen om värdepappersrörelse. Bestämmelsen infördes 1991 och redan då var de svenska reglerna om kapitaltäckning anpassade till gemenskapsrätten, närmare bestämt det dåvarande EG-direktivet om kapitaltäckning för kreditinstitut (motsvarigheten till dagens CAD). Den svenska regeln har utformats med kravet på ansvarsförsäkringar för försäkringsmäklare som förebild (motsvarigheten till dagens försäkringsförmedlare) med motiveringen att reglerna om kapitaltäckning inte i alla lägen tillgodosåg kundernas intressen av att ett värdepappersbolag kan fullgöra den skadeståndsskyldighet som kan

uppkomma om bolaget missköter sitt uppdrag.

5

Sedan regeln in-

fördes har kapitaltäckningsreglerna ändrats genom CAD. De ändringar i CAD som nu föreslagits innebär bl.a. att värdepappersbolag ska bedöma och kapitaltäcka även operationella risker, t.ex. risken för att misskötta uppdrag leder till skadeståndsskyldighet. Det kan då ifrågasättas om det är motiverat att dessutom ha ett krav på ansvarsförsäkring.

För närvarande pågår ett arbete inom Finansdepartementet med att genomföra de nya kapitaltäckningsreglerna i svensk rätt. Om kravet på ansvarsförsäkring ska behållas bör avgöras i det sammanhanget. Utredningen anser att dock att det i vart fall är motiverat att avskaffa kravet på ansvarförsäkring för de värdepappersbolag vars verksamhet omfattar mottagande av medel på konto. Dessa bolag omfattas av det högre kapitalkrav som gäller för kreditinstitut. För kreditinstitut finns det inte något krav på ansvarsförsäkring och detsamma bör gälla värdepappersbolag som omfattas av kreditinstitutens kapitalkrav. Därutöver kan som angetts ovan, företag som enbart bedriver verksamheten investeringsrådgivning eller tar emot och vidarebefordrar order utan att inneha kunders medel eller värdepapper välja mellan ett visst minsta kapital, ansvarförsäkring eller en kombination av dessa.

Tillstånd för förvärv av egendom i vissa fall

Enligt 3 kap. 1 § andra stycket lagen om värdepappersrörelse krävs tillstånd av Finansinspektionen för förvärv av s.k. organisationsaktier eller andelar. Någon beloppsgräns finns inte angiven, vilket får till följd att även väldigt små förvärv måste prövas av Finansinspektionen. Med hänsyn till de allmänna regler om soliditet, likviditet och riskhantering (se 8 kap. 3–6 §§ i utredningens förslag till ny lag om värdepappersmarknaden) samt till reglerna om kapitaltäckning är det svårt att fullt ut motivera att en sådan prövning med automatik måste göras även vid beloppsmässigt förhållandevis små förvärv.

I lagen om bank- och finansieringsrörelse finns en bestämmelse som medför att gränsen för vilka förvärv som ska tillståndsprövas relateras till bankens kapitalbas (7 kap. 12 §). Den absoluta gränsen för stora exponeringar har satts vid 25 procent av kapitalbasen.

5

Prop. 1990/91:142, s. 130 f.

Enligt utredningens mening är det lämpligt att en liknande bestämmelse införs i en nya lagen om värdepappersmarknaden. Denna bestämmelse skulle ersätta dagens bestämmelse om tillståndsprövning vid organisationsförvärv. Värdepappersbolagen skulle därmed inte bli skyldiga att behöva ansöka om tillstånd för mindre förvärv. Detta skulle medföra mindre kostnader för värdepappersbolagen och samtidigt inte onödigt belasta Finansinspektionens resurser. Även om banker generellt sätt har betydligt större kapitalbas än värdepappersbolag får gränsen vid 25 procent av kapitalbasen anses lämplig för värdepappersbolag.

6

Det kan

tilläggas att ett värdepappersbolag naturligtvis inte får utnyttja hela utrymmet enligt den angivna regeln om t.ex. soliditeten, likviditeten eller riskhanteringen sätts i fara dessförinnan.

I bestämmelsen i lagen om bank- och finansieringsrörelse finns inga specifika kriterier för tillståndsprövningen utan det anges endast att tillstånd ska ges om det inte kan antas att förvärvet leder till överträdelser av den lagen eller andra författningar. Bestämmelsen i lagen om värdepappersmarknaden bör utformas på samma sätt. Med andra författningar inbegrips, förutom andra lagar, EG-rättsliga författningar, t.ex. genomförandeförordningen, och Finansinspektionens föreskrifter.

System för investerarskydd

Både gällande svenska regler och reglerna i artikel 11 i MiFID innebär något av ett moment 22. Det är först när ett företag har fått tillstånd och är ett värdepappersinstitut som företaget omfattas av investerarskyddet.

7

Det är först då som Insättningsgarantinämnden

kan underrätta inspektionen om att institutet eventuellt inte fullgör sina förpliktelser. Följaktligen är den sanktion som kan komma ifråga från inspektionens sida ytterst en återkallelse av tillståndet.

8

Enligt MiFID ska dock den behöriga myndigheten kontrollera om det blivande värdepappersinstitutet fullgör sina förpliktelser vid tidpunkten för auktorisationen. Utredningen föreslår i det följande en bestämmelse i den nya lagen om värdepappersmarknaden (3 kap. 1 §) om att en av förutsättningarna för tillstånd ska vara att det finns skäl att anta att den planerade verksamheten kommer att

6

Av förarbetena till bestämmelsen i lagen om bank- och finansieringsrörelse framgår dock

att det finns sparbanker med en kapitalbas så låg som 800 000 kr.

7

Se 4 § lagen om investerarskydd.

8

Se 6 kap. 9 § andra stycket lagen om värdepappersrörelse.

drivas enligt den nya lagen och andra författningar som reglerar ett bolagets verksamhet torde omfatta även en bedömning av om bolaget kommer att uppfylla sina förpliktelser enligt lagen om investerarskydd. Dessutom är lagen om investerarskydd utformad så, att skyddet omfattar alla svenska värdepappersinstitut, oavsett om de fullgör sina förpliktelser eller inte. Någon ändring av de svenska reglerna behövs därför inte.

8.1.3. Organisationskrav

Inledning

I artikel 13 i MiFID anges vilka krav medlemsstaterna ska ställa på värdepappersföretagens organisation. I vissa delar finns motsvarande krav i artiklarna 10 och 11 i ISD. Men organisationskraven i MiFID går i många fall ut på att företaget ska organisera verksamheten på ett sådant sätt att företaget kan leva upp till andra krav som ställs i direktivet – på att hantera intressekonflikter, skydda kunder osv. Genom att kraven i dessa hänseenden skärpts och ändrats innebär organisationskraven en ganska stor förändring (skärpning) i förhållande till ISD. I det följande behandlas inte artikel 13.3 som rör de organisatoriska kraven för att hantera intressekonflikter; den bestämmelsen behandlas i avsnitt 12.2.5 tillsammans med artikel 18 som också rör intressekonflikter.

Organisationskraven i de svenska reglerna följer av 1 kap. 7 § lagen om värdepappersrörelse. Med utgångspunkt i den bestämmelsen har Finansinspektionen utfärdat föreskrifter (FFFS 2002:7) om uppföranderegler på värdepappersmarknaden som bl.a. rör kraven på värdepappersinstitutens organisation.

Krav på att hålla kundernas finansiella instrument och pengar avskilda

I artikel 13.7 och 13.8 i MiFID ställs krav att värdepappersföretag ska vidta lämpliga åtgärder för att se till att kundernas rätt till finansiella instrument och penningmedel som företaget innehar för kundernas räkning skyddas. Motsvarande bestämmelser finns i artikel 10 andra och tredje strecksatserna i ISD. I genomförandedirektivet finns detaljerade regler om kundernas tillgångar i artiklarna 16–19.

I Sverige finns i 3 kap. 5 § första stycket lagen om värdepappersrörelse kravet på att penningmedel som tas emot med redovisningsskyldighet ska avskiljas medan regeln om att kunders finansiella instrument ska hållas avskilda från institutets egna tillgångar finns i 2 kap. 4 § i Finansinspektionens föreskrifter (FFFS 2002:7) om uppföranderegler på värdepappersmarknaden.

Anställdas regelefterlevnad och egna affärer

Enligt artikel 13.2 i MiFID ska värdepappersföretag fastställa riktlinjer och förfaranden i den omfattning som krävs för att företaget, dess anställda och anknutna ombud ska respektera sina förpliktelser enligt direktivet. Företaget ska också fastställa lämpliga bestämmelser om dessa personers privata transaktioner. I artikel 6 i genomförandedirektivet finns regler om regelefterlevnad och i artiklarna 11 och 12 finns regler om anställdas egna affärer. I ISD finns en bestämmelse om att värdepappersföretagen skulle ha lämpliga interna kontrollanordningar omfattande anställdas egna affärer (artikel 10 första strecksatsen). Någon uttrycklig bestämmelse om riktlinjer och förfaranden för att de anställda m.fl. ska fullgöra andra förpliktelser enligt direktivet finns inte i ISD.

I Sverige finns en bestämmelse i 3 kap. 1 § i Finansinspektionens föreskrifter om uppföranderegler på värdepappersmarknaden om att varje värdepappersinstitut ska ha en regelansvarig person som har till uppgift att se till att institutets styrelse och anställda har kännedom om gällande regler. Regler om anställdas egna affärer finns i 12 § lagen (2000:1087) om anmälningsskyldighet för vissa innehav av finansiella instrument och i 7 kap. i ovan nämnda föreskrifter. Dessa regler täcker, tillsammans med sundhetsparagrafen i 1 kap. 7 § lagen om värdepappersrörelse, delar av kraven enligt MiFID. Men den svenska regleringen saknar uttryckligt krav på riktlinjer m.m. för regelefterlevnad.

Tillräckliga system, resurser osv. för kontinuitet, riskkontroll m.m.

Enligt artikel 13.4 i MiFID ska värdepappersföretagen vidta rimliga åtgärder, t.ex. använda lämpliga system och resurser, för att sörja för kontinuitet och regelbundenhet i tillhandahållandet av investe-

ringstjänster. I genomförandedirektivet finns vissa regler om detta i artikel 5 som inte säger mycket mer än huvuddirektivet. En liknande regel finns i artikel 11 tredje strecksatsen i ISD. En svensk regel om detta finns i tredje strecksatsen i 1 kap. 7 § lagen om värdepappersrörelse. Varken ISD eller den svenska bestämmelsen om tillräckliga resurser m.m. syftade dock uttryckligen till att sörja för kontinuitet i tillhandahållandet av investeringstjänsterna. Några svenska föreskrifter om just system och resurser finns inte. Sådana frågor berörs dock i Finansinspektionens allmänna råd (FFFS 1995:49) om kreditrisker, se t.ex. 11 § om system för att analysera kreditrisker, och de allmänna råden (FFFS 2005:01) om styrning och kontroll av finansiella företag, se t.ex. 4 § andra, åttonde och nionde punkterna.

I artikel 13.5 andra stycket i MiFID finns en bestämmelse om att värdepappersföretag ska tillämpa sunda förfaranden för redovisning och förvaltning, ha mekanismer för internkontroll samt ha kontroll- och skyddssystem för sina informationsbehandlingssystem. Mer detaljerade bestämmelser om styrning, riskkontroll och internrevision och i vilken mån dessa funktioner ska vara separerade och oberoende finns i artiklarna 7–9 i genomförandedirektivet. En liknande bestämmelse finns i artikel 10 första strecksatsen i ISD. Några uttryckliga regler om detta finns inte i den svenska lagen eller föreskrifterna men regler finns i Finansinspektionens allmänna råd om styrning och kontroll av finansiella företag.

Dokumentation

Enligt artikel 13.6 i MiFID ska värdepappersföretagen dokumentera utförda tjänster och transaktioner på ett sådant sätt att den behöriga myndigheten kan övervaka att kraven i direktiven iakttas, särskilt vad gäller företagets förpliktelser i förhållande till kunderna. I artikel 10 fjärde strecksatsen i ISD finns en motsvarande bestämmelse. Detaljerade regler om dokumentationen av order och transaktioner finns i artiklarna 6 och 7 i genomförandeförordningen. Mer allmänt hållna regler om dokumentation och bevarande av denna finns i artiklarna 5.1 f och 51 i genomförandedirektivet. Av särskilt intresse är artikel 51.3. Enligt den artikeln ska medlemsstaterna upprätta en lista på vilken dokumentation företagen ska ha. I ett tidigare förslag motsvarande denna artikel från CESR fanns en lång lista på den dokumentation som ett

värdepappersföretag skulle bevara.

9

Denna idé har övergivits av

kommissionen som ansett att det är den behöriga myndigheten i varje medlemsstat som ska upprätta listan på den dokumentation som krävs.

I lagen om värdepappersrörelse finns inga uttryckliga dokumentationskrav i dessa avseenden förutom kravet i 4 kap. 9 § på att upprätta avräkningsnotor vid köp, byte eller försäljning av finansiella instrument. I Finansinspektionens föreskrifter om uppföranderegler på värdepappersmarknaden och i föreskrifter och allmänna råd (FFFS 2004:4) om finansiell rådgivning till konsumenter

10

finns dock en mängd bestämmelser om värdepappers-

institutens dokumentation, främst avseende tjänster och värdepapperstransaktioner som utförs för kunder. I 6 kap. i Finansinspektionens föreskrifter om uppföranderegler på värdepappersmarknaden finns utförliga bestämmelser om dokumentationen av affärsuppdrag. Dessa bestämmelser har sin förebild i Svenska Fondhandlareföreningens s.k. ”handlarrumsregler”.

11

Enligt före-

skrifterna ska samtliga affärsuppdrag dokumenteras när de tas emot från en kund och föreskrifterna anger vilka uppgifter som ska dokumenteras och hur.

De uppgifter om kundens identitet, kundens ekonomiska situation, erfarenhet av värdepappersmarknaden och syftet med de tjänster kunden efterfrågar som värdepappersinstitutet ska inhämta enligt1 kap. 7 § andra stycket fjärde och femte strecksatserna lagen om värdepappersrörelse ska enligt 4 kap. 1 § Finansinspektionens föreskrifter om uppföranderegler på värdepappersmarknaden också dokumenteras. Detsamma gäller investeringsrådgivning som lämnas till kunden.

12

I många fall sker rådgivningen över bandinspelade

telefoner och det finns föreskrifter även om detta.

13

I nämnda

föreskrifter finns även en dokumentationsregel för diskretionära förvaltningsuppdrag.

14

Inför sådana uppdrag ska institutet inhämta

9

CESR’s Technical Advise on possible Implementing Measures of the Directive 2004/39/EC on Markets in Financial Instruments January 2005, Ref: CESR/05-024c, s. 28 ff.

10

Dokumentationskraven i FFFS 2004:4 gäller enbart när det är fråga om finansiell rådgivning till konsumenter enligt lagen (2003:862) om finansiell rådgivning till konsumenter.

11

Riktlinjer för affärsuppdrag avseende aktier och aktierelaterade finansiella instrument, april 2003.

12

5 kap. 4 § Finansinspektionens föreskrifter om uppföranderegler på värdepappersmarknaden.

13

6 kap. Finansinspektionens föreskrifter om uppföranderegler på värdepappersmarknaden.

14

4 kap. 2 § Finansinspektionens föreskrifter om uppföranderegler på värdepappersmarknaden.

och dokumentera uppgifter om kundens riskprofil, placeringshorisont och placeringsrestriktioner.

Dokumentationskraven i FFFS 2004:4 rör dokumentation av rådgivaren/institutet (3 kap. 1 §), konsumenten (3 kap. 2 §) och rådgivningssituationen (3 kap. 3 §).

Outsourcing

Artikel 13.5 första stycket MiFID avser värdepappersföretag som anlitar en tredje part för att fullgöra vissa operativa funktioner av väsentlig betydelse (outsourcing). Värdepappersföretagen ska i sådana fall vidta rimliga åtgärder för att inte outsourcingen ska medföra ytterligare operativa risker. Outsourcing får enligt artikeln inte ske på ett sådant sätt att det väsentligt försämrar kvaliteten på företagets internkontroll eller tillsynsmyndighetens övervakning. Bestämmelserna kompletteras av artiklarna 13–15 i genomförandedirektivet. Någon uttrycklig regel om outsourcing finns varken i ISD eller i lagen om värdepappersrörelse. I 15 § Finansinspektionens föreskrifter om verksamhetsplan för värdepappersbolag m.fl. finns dock en bestämmelse om att omfattningen av outsourcingen ska redovisas och att av redovisningen ska framgå hur kundernas intressen kommer att tillgodoses. Likaså finns i Finansinspektionens allmänna råd om styrning och kontroll av finansiella företag ett kapitel om outsourcing där det ställs krav på interna regler för hur företagen ska gå till väga vid outsourcing. De allmänna råden behandlar bl.a. frågan om hanteringen av risker och intern kontroll (7 kap. 2 §) och förhållandet till Finansinspektionen (7 kap. 4 §).

Överväganden och förslag

Förslag: I den nya lagen om värdepappersmarknaden införs i enlighet med MiFID detaljerade regler om uppförande, hantering av intressekonflikter och krav på organisationen. I bestämmelserna om organisationen ställs krav på att företaget ska

  • hålla kunders medel och deras finansiella instrument avskilda,
  • upprätthålla och tillämpa de riktlinjer som krävs för att institutets styrelse, de anställda och anknutna ombud följer de regler som gäller för verksamheten,
  • ha de resurser och rutiner som krävs för att verksamheten ska kunna drivas kontinuerligt och investeringstjänsterna tillhandahållas regelbundet,
  • ha tillfredsställande rutiner för intern kontroll,
  • ska säkerställa en tillförlitlig redovisning,
  • dokumentera utförda tjänster och transaktioner, samt
  • se till att outsourcing av väsentlig betydelse drivs av uppdragstagaren under kontrollerade och säkerhetsmässigt betryggande former.

Regeringen eller, den myndighet regeringen bestämmer, får meddela närmare föreskrifter om vad ett värdepappersinstitut ska iaktta för att uppfylla de ovan angivna skyldigheterna.

Såväl reglerna om skydd för investerare och hanteringen av intressekonflikter som kraven på värdepappersföretagens organisation är mycket mer omfattande och preciserade i MiFID än i ISD. Vidare anknyter kommissionens genomförandeåtgärder direkt till de detaljerade reglerna i direktivet. Även om dagens svenska ”sundhetsparagraf” i 1 kap. 7 § lagen om värdepappersrörelse kan sägas omfatta många av MiFID:s krav kommer den svenska regeln inte att vara tillräcklig. För att den svenska regleringen ska motsvara MiFID – och för att det ska vara möjligt att förstå vilken lagregel en viss artikel i genomförandeförordningen anknyter till – bör sundhetsparagrafen ersättas med detaljerade regler avseende skydd för investerare, hantering av intressekonflikter och värdepappersföretagens organisation. När det gäller kraven på organisationen bör uttryckliga bestämmelser, utformade med artikel 13 i MiFID som förebild, införas i lagen. Bestämmelserna bör innehålla krav på:

  • att både kunders medel och deras finansiella instrument ska hållas avskilda (artikel 13.7 och 13.8),
  • riktlinjer och kontroll av regelefterlevnad (artikel 13.2),
  • tillräckliga system och resurser för kunna tillhandahålla investeringstjänsterna kontinuerligt (artikel 13.4)
  • tillfredsställande rutiner för intern kontroll (artikel 13.5),
  • dokumentation av utförda tjänster och transaktioner (arti- kel 13.6),
  • kontroll vid outsourcing (artikel 13.5)

Det allmänt hållna dokumentationskravet i artikel 13.6 i MiFID kompletteras av bestämmelserna i artiklarna 6 och 7 i genomförandeförordningen när det gäller dokumentationen av order och transaktioner. För dokumentationen av värdepappersföretagens tjänster i övrigt finns inga detaljregler i genomförandeåtgärderna, förutom bestämmelserna om hur dokumentationen ska bevaras i artikel 51. Detta kan tolkas antingen så att det står varje medlemsstat fritt att införa nationella dokumentationskrav på de områden där reglering saknas i genomförandeåtgärderna eller också på det sättet att några ytterligare dokumentationskrav inte får ställas av medlemsstaterna. I det senare fallet skulle det ankomma på företagen själva att dokumentera utförandet av sina tjänster på ett sådant sätt att dokumentationen uppfyller ett allmänt utformat krav av det slag som följer av direktivet.

För den senare tolkningen talar bestämmelserna i artikel 51.1 tredje stycket och 51.4 i genomförandedirektivet som ger medlemsstatarena rätt men inte skyldighet att ställa egna dokumentationskrav på några utpekade områden (hur länge dokumentationen ska sparas och närmare bestämmelser om dokumentation vid inspelning av telefonsamtal). Om det skulle stå öppet för medlemsstaterna att införa de dokumentationskrav som de finner lämpliga skulle de nämnda artiklarna tillåta något som ankommer på medlemsstaterna själva och således inte fylla någon funktion. Något som talar mot en sådan tolkning är dock artikel 51.3 i genomförandedirektivet där det framgår att det är den behöriga myndigheten som ska upprätta en lista på den dokumentation som krävs. Kommissionen har i sin ”backround note” till genomförandedirektivet angett att dokumentationskraven i genomförandeåtgärderna med största sannolikhet måste kompletteras med specifika krav.

15

I denna fråga har meningarna varit delade mellan de sakkunniga i utredningen. Utredningen har dock stannat för att direktivet och kommissionens genomförandeåtgärder bör tolkas så att det är förenligt med direktivet och genomförandeförordningen att införa nationella krav på dokumentation avseende de av värdepappersföretagens tjänster för vilka detaljerade dokumentationskrav saknas i genomförandeåtgärderna. Detta innebär att befintliga svenska föreskrifter som sammanfaller med kraven enligt artiklarna 6 och 7 i förordningen (avseende order och transaktioner) måste utmönst-

15

Se under avsnitt 7.9 i kommissionens ”background note” till förslaget till genomförandedirektiv (2006-02-06).

ras. För andra delar av företagens tjänster kan befintliga dokumentationskrav behållas i sak med de justeringar som föranleds av artikel 51 i genomförandedirektivet. Det senare gäller också dokumentationskrav som rör företagens organisation och där genomförandedirektivet ställer krav på t.ex. interna regler, intressekonfliktspolicy osv.

Bestämmelserna i övrigt bör kompletteras med föreskriftsrätt för Finansinspektionen som sedan får utforma detaljbestämmelser i enlighet med genomförandedirektivet. I praktiken kommer det i stora delar att innebära korrigeringar, i enlighet med kommissionens genomförandeåtgärder, av befintliga föreskrifter och att delar av de allmänna råd som nämnts ovan blir bindande föreskrifter.

Naturligtvis innebär det anförda inte något annat än att det står de svenska företagen och deras branschorganisation fritt att själva precisera sin policy i dokumentationsfrågor på samma sätt sker för närvarande.

8.2. Anknutna ombud

8.2.1. Regleringen av anknutna ombud i MiFID

Enligt definitionen i artikel 4.1.25 är ett anknutet ombud en fysisk eller juridisk person som för ett enda värdepappersföretags räkning

  • marknadsför det företagets tjänster,
  • tar emot eller vidarebefordrar instruktioner eller order avseende investeringstjänster,
  • placerar finansiella instrument, eller
  • tillhandahåller rådgivning avseende sådana finansiella instrument eller investeringstjänster som värdepappersföretaget tillhandahåller.

För att vara ett anknutet ombud ska personen ifråga således företräda endast ett värdepappersföretag och det värdepappersföretaget ska fullt och ovillkorligt ansvara för det anknutna ombudets verksamhet på företagets vägnar.

Anknutna ombud finns redan i dag i vissa länder inom EU men är ovanliga i andra. Det har därför blivit frivilligt för medlemsstaterna att tillåta ett värdepappersföretag att utse anknutna ombud. Medlemsstater som tillåter det ska dock enligt artikel 23.2

kräva att värdepappersföretagen blir fullt ansvariga för varje handling eller underlåtenhet från det anknutna ombudets sida när ombudet handlar på företagets vägnar. Värdepappersföretag som använder anknutna ombud ska övervaka ombudets verksamhet så att ombudet följer bestämmelserna enligt MiFID. Värdepappersföretagen ska också se till att ombudet upplyser kunder om sina handlingsbefogenheter och om vilket företag han eller hon handlar för.

Medlemsstaterna kan enligt artikel 23.2 andra stycket tillåta att ett anknutet ombud får ha hand om kunders pengar eller finansiella instrument. Handhavandet ska ske på värdepappersföretagets vägnar och ansvar. Bestämmelserna i artikel 13.6–13.8, om dokumentation och om att kundernas tillgångar ska hållas avskilda från institutets egna, gäller även när ett anknutet ombud har hand om pengarna eller instrumenten.

Medlemsstater som tillåter anknutna ombud ska enligt artikel 23.4 kräva att värdepappersföretagen vidtar lämpliga åtgärder för att se till att den verksamhet som ombudet tillhandahåller men som faller utanför direktivet inte inverkar negativt på den verksamhet ombud utför på värdepappersföretagets vägnar.

I artikel 23.3 finns bestämmelser som innebär att en medlemsstat som tillåter anknutna ombud ska föra ett offentligt och kontinuerligt uppdaterat register över de ombud som har ett fast driftsställe i medlemsstaten. Registreringen ska föregås av en vandels- och kunskapsprövning. Medlemsstaterna får bestämma att värdepappersföretagen själva får göra den prövningen. Enligt artikel 23.4 andra stycket kan även registerföringen skötas av värdepappersföretag m.fl. under den behöriga myndighetens överinseende. Enligt artikel 23.5 får värdepappersföretag inte utse andra anknutna ombud än sådana som förs in i registret. Ombud i medlemsstater som inte tillåter anknutna ombud ska registreras hos den behöriga myndigheten i den stat som är hemmedlemsstat för det värdepappersföretag som utsett ombudet. Det innebär således att en medlemsstat som inte tillåter anknutna ombud måste acceptera verksamhet från ombud som är anknutna till värdepappersföretag från andra stater (se även artikel 31.2). Enligt artikel 23.6 kan slutligen medlemsstaterna ställa strängare krav på anknutna ombud som är registrerade i medlemsstaten än vad som följer av artikel 23.

Artikel 23 innebär att ett värdepappersföretag kan anlita någon som saknar tillstånd att utföra investeringstjänster förutsatt att denne utses till anknutet ombud. Även om det inte finns något

uttryckligt utrymme i direktivets artikel om auktorisationskrav för att bedriva investeringstjänster utan tillstånd går det att utläsa av skäl 36 i ingressen till MiFID att den som utför investeringstjänster på mer än ett värdepappersföretags vägnar ska anses som ett tillståndspliktigt värdepappersföretag och inte ett anknutet ombud. Motsatsvis följer att den som utför tjänster för enbart ett värdepappersföretag inte anses bedriva egen tillståndpliktig verksamhet.

8.2.2. Övervägande och förslag

Förslag: I den nya lagen om värdepappersmarknaden införs en möjlighet för värdepappersinstitut att utse anknutna ombud.

Ett anknutet ombud är en fysisk eller juridisk person som har träffat avtal med ett värdepappersinstitut om att på institutets fulla ansvar marknadsföra institutets tjänster, motta och vidarebefordra order eller tillhandahålla rådgivning i fråga om finansiella instrument och tjänster som erbjuds av institutet.

Avtalet mellan institutet och det anknutna ombudet ska innebära att institutet är ansvarigt för ren förmögenhetsskada som drabbar en kund till följd av att ombudet uppsåtligen eller av oaktsamhet åsidosätter de skyldigheter som anges i lagen om hur verksamheten ska bedrivas.

Värdepappersinstituten ansvarar för att de anknutna ombuden uppfyller de krav som uppställs i lagen. Instituten ansvarar vidare för att de anknutna ombuden registreras hos Bolagsverket.

Ett anknutet ombud ska informera sina kunder om vilket institut ombudet företräder, vilka befogenheter ombudet har och att institutet är ansvarigt för ren förmögenhetsskada som ombudet genom sin verksamhet uppsåtligen eller av oaktsamhet orsakat kunden.

Regeringen eller den myndighet som regeringen bestämmer får meddela närmare föreskrifter om vad ett avtal mellan ett värdepappersinstitut och ett anknutet ombud ska innehålla och vad instituten ska iaktta i samband med anmälan och kontroll av ett anknutet ombud.

Möjligheten att verka som anknutet ombud i MiFID:s bemärkelse finns för närvarande inte i Sverige. För det fall ett företag t.ex. tar emot och vidarebefordrar order för ett värdepappersinstitut krävs därför i dag tillstånd från Finansinspektionen.

Det är enligt MiFID frivilligt för medlemsstaterna att införa bestämmelser om anknutna ombud. Utredningen har i dag svårt att överblicka om det i framtiden kommer att finnas ett kommersiellt intresse av att bedriva verksamhet genom anknutna ombud. Dock finns sådana möjligheter redan i andra länder och dessa ombud skulle därmed kunna verka i Sverige. Utredningen anser därför att det är naturligt att marknadsaktörerna själva bör få möjlighet att värdera de kommersiella för- och nackdelarna med att utse sådana ombud. En möjlighet att utse anknutna ombud bör därför införas i lagen. Det bör vara möjligt att utse både fysiska och juridiska personer till anknutna ombud.

Av direktivet följer att medlemsstaterna ska kräva att värdepappersföretag som beslutar att utse anknutna ombud ska vara ansvariga för den skada ett anknutet ombud orsakar en kund då ombudet handlar på företagets vägnar. Bestämmelsen är närmast av näringsrättslig art. En lämplig väg att införliva bestämmelsen är att kräva att ett värdepappersinstitut som vill utse ett anknutet ombud sluter ett tredjemansavtal med ombudet vilket ska innebära att institutet tar på sig samma skadeståndsansvar som institutet har när det gäller handlande av institutets anställda. En kunds rätt till ersättning för skada bör inte vara sämre om kunden ingått avtal med ett anknutet ombud än om detta skett genom en av institutets anställda, bl.a. därför att det för många kunder kommer att vara svårt att skilja mellan en representant som kommer direkt från institutet och ett anknutet ombud eller i vart fall vari skillnaderna består. Det anknutna ombudet företräder ju endast ett värdepappersinstitut och ska i sin verksamhet vara skyldig att tydligt ange detta företags firma. Även om ett värdepappersinstitut är skyldigt att se till att ett anknutet ombud informerar kunden om vilka handlingsbefogenheter han har och vilket institut han företräder

16

kan det enligt utredningens mening inte krävas av en kund

att denne helt och hållet förstår innebörden av förhållandet mellan institutet och ombudet. I stället är det mer naturligt att värdepappersinstitutet i hög grad får ansvara för vad det anknutna ombudet gör. Skälet till detta är att institutet får den kommersiella

16

Se artikel 23.2 i MiFID.

fördelen av att kunna marknadsföra sina produkter genom en annan aktör och att institutet själv väljer vem som ska verka som anknutet ombud. En sådan lösning ligger också nära direktivets ordalydelse. För det fall kunden är medveten om eller borde ha varit medveten om att det anknutna ombudet överträtt sina befogenheter enligt avtalet med institutet torde dock institutet inte vara bunden av de skador som drabbar kunden. Omfattningen av värdepappersinstitutets ansvar får närmare utformas genom rättspraxis.

Att ett värdepappersinstitut ansvarar för det anknutna ombudets åtgärder betyder naturligtvis inte att det anknutna ombudet självt är fritt från ansvar. Den skadelidande kan välja att rikta sitt anspråk direkt mot det anknutna ombudet. Och även om kravet riktas mot värdepappersinstitutet kan institutet i sin tur föra en regresstalan mot det anknutna ombudet.

Det är enligt direktivet möjligt att delegera registreringen till värdepappersföretag, branschorganisationer m.m. I dag utfärdar Bolagsverket registreringsbevis för värdepappersbolag. Det är därför naturligt att Bolagsverket även sköter registreringen av de anknutna ombuden.

Eftersom ett värdepappersinstitut ansvarar för den skada som kan uppkomma genom ett ombuds uppträdande finns det inte anledning att ställa samma krav på anknutna ombud som gäller vid tillståndsgivningen för ett värdepappersinstitut, t.ex. kraven på ansvarsförsäkring, lednings- och ägarprövning och minsta eget kapital. Inte heller kravet på anslutning till ett system för investerarskydd är relevant för de anknutna ombuden – de ska inte förvara kundernas tillgångar. Dock bör kraven på dokumentation av utförda tjänster vara desamma för de anknutna ombuden som för värdepappersinstitut. Ett anknutet ombud är även skyldigt att följa de allmänna uppföranderegler som gäller för värdepappersinstitut. Därutöver bör ett anknutet ombud vara skyldigt att informera sina kunder om vilket institut ombudet företräder, vilka befogenheter ombudet har och att institutet är ansvarigt för ren förmögenhetsskada som ombudet orsakat kunden. Det åligger värdepappersinstitutet att säkerställa att ombudet uppfyller lagens, genomförandeförordningens och föreskrifternas krav på de tjänster som ombudet utför för institutets räkning. Detta bör, med förebild i vad som gäller för outsourcing, ske genom att institutet avtalar om en rätt att kontrollera det anknutna ombudets verksamhet, ta del av handlingar och dokumentation osv.

Direktivet ger även medlemsstaterna en valmöjlighet att reglera vem som ska kontrollera att de anknutna ombuden uppfyller de allmänna kraven i samband en registrering. Enligt utredningens mening finns det inget hinder för att uppgiften att anmäla ombuden till Bolagsverket anförtros värdepappersinstituten och att instituten själva kontrollerar att ombuden uppfyller lagens krav. Detta eftersom det torde ligga i värdepappersinstitutens eget intresse att ombuden besitter nödvändiga kunskaper m.m., inte minst på grund av att de i slutändan kommer att få stå till svars för ombudens handlande. Skulle ett institut brista i kontrollen av sina ombud är det en grund för inspektionen att vidta en åtgärd. Värdepappersinstituten bör således ansvara för att de anknutna ombuden registreras hos Bolagsverket. Till ansökan bör fogas det avtal som ingåtts mellan institutet och ombudet. Därmed kan företagets åtagande gentemot kunderna i formell mening sägas komma till allmänhetens kännedom. Vidare bör instituten ansvara för att uppgifterna hos Bolagsverket hålls aktuella. Värdepappersinstitutets gör således den initiala kontrollen av de anknutna ombuden kvalifikationer. Enligt utredningens mening är det fördel om även den fortlöpande prövningen görs av institutet under Finansinspektionens tillsyn.

Regeringen eller den myndighet regeringen bestämmer bör bemyndigas att meddela föreskrifter om vad avtalet mellan värdepappersinstitutet och ombudet ska innehålla samt om vad instituten ska iaktta vid kontrollen av anknutna ombuds kvalifikationer och vid anmälan av dessa ombud för registrering hos Bolagsverket.

8.3. Reglerade marknader

8.3.1. Krav på ledande befattningshavare och ägare

Kraven i artikel 37 i MiFID på ledande befattningshavare för den som driver en reglerad marknad är desamma som kraven på motsvarande personer i ett värdepappersföretag enligt artikel 9 i direktivet. Detsamma gäller kraven på att lämna information om vilka de ledande befattningshavarna är.

Även kraven på vandel och upplysningsskyldighet avseende kvalificerade ägare är i stort sett desamma för den som ska driva en reglerad marknad som för värdepappersföretag – även om bestäm-

melserna avseende värdepappersföretagen är mer detaljerade vad gäller tidsfrister och ägarförändringar.

Överväganden och förslag

Förslag: De gällande reglerna om börsers ledning och ägare överförs med smärre ändringar till den nya lagen om värdepappersmarknaden.

Liksom för värdepappersinstituten är kravet på minsta antalet styrelseledamöter högre i den svenska lagen (fem) än i MiFID (två). Det finns inga skäl att ställa andra krav på den som driver en reglerad marknad än på ett värdepappersföretag i detta hänseende. Det nuvarande kravet bör därför ändras till minst tre ledamöter (se avsnitt 8.1.1).

Ett lämplighetskrav på ledande befattningshavare och kvalificerade ägare finns i 2 kap. 2 § första stycket 3 och 4 i börs- och clearinglagen. Regler om uppgiftsskyldighet finns i Finansinspektionens föreskrifter (FFFS 1998:13) om rapporteringsskyldighet vid utseende av vissa ledande befattningshavare. Ett krav på att ändringar vad gäller styrelse och verkställande direktör bör dock införas i lagen för att införliva motsvarande krav i artikel 37.1 i MiFID. När det gäller rapportering av kvalificerat innehav omfattar Finansinspektionens föreskrifter och allmänna råd (FFFS 2004:17) om rapportering av kvalificerat innehav och dotterföretag m.m. inte börser. För att komplettera föreskrifterna med börser krävs ett tillägg i förordningen (1992:561) om börs och clearingverksamhet eller dess motsvarighet.

8.3.2. Krav på organisationen m.m.

Enligt artikel 39 i MiFID ska medlemsstaterna ställa krav på en reglerad marknads organisation m.m. när det gäller,

  • identifiering och hantering av intressekonflikter (39 a),
  • riskhantering och säkra tekniska system (39 b och c),
  • regler, system m.m. för handeln och avveckling av transaktionerna (39 d och e), och
  • tillräckliga finansiella resurser (39 f).

Dessa bestämmelser avseende de reglerade marknaderna är mindre långtgående och mindre detaljerade än motsvarande regler för värdepappersföretagen och någon ytterligare detaljreglering igenomförandebestämmelserna finns inte.

När det gäller intressekonflikter tar artikel 39 a sikte på konflikter mellan å den ena sidan den reglerade marknadens, dess ägares eller operatörs intressen och å den andra sidan ”den reglerade marknadens sunda funktion”. Den reglerade marknaden ska vidta åtgärder för att identifiera sådana intressekonflikter och hantera möjliga negativa följder för driften av den reglerade marknaden eller negativa följder för den reglerade marknadens aktörer.

Enligt artikel 39 b och c ska medlemsstaterna kräva att en reglerad marknad dels har tillräckliga förutsättningar för att kunna identifiera och hantera de risker marknaden är utsatt för, dels har säkra tekniska system och kan hantera riskerna för systemavbrott.

Enligt artikel 39 d ska medlemsstaterna kräva att en reglerad marknad har tydliga och objektiva regler för en rättvis och välordnad handel. Enligt artikel 39 e ska marknaden också lägga upp verksamheten på ett sätt som underlättar avvecklingen av de transaktioner som har utförts. Detta torde innebära att en reglerad marknad måste se till att avsluten kan hanteras i ett fungerande clearing- och avvecklingssystem.

Slutligen ska medlemsstaterna enligt artikel 39 f kräva att den reglerade marknaden har tillräckliga finansiella resurser för att kunna fungera korrekt med hänsyn till arten och omfattningen av transaktionerna samt riskexponeringen. Några uttryckliga krav på ett visst minsta kapital, som i artikel 12 för värdepappersföretagen, finns inte.

Överväganden och förslag

Förslag: Den som driver en reglerad marknad ska inrätta en från affärsverksamheten oberoende funktion som ska sköta marknadsövervakningen och övervaka medlemmars och emittenters regelefterlevnad i övrigt.

I den nya lagen om värdepappersmarknaden införs uttryckliga krav på säkra tekniska system samt på att den reglerade marknadens handelsregler ska omfatta bestämmelser om avvecklingen av affärerna.

Liksom tidigare ska den som driver en reglerad marknad ha tillräckliga finansiella resurser. Kravet kompletteras med ett krav på startkapital för den som också ska driva en MTF.

Intressekonflikter

Det finns inte några uttryckliga regler i börs- och clearinglagen om hanteringen av intressekonflikter. Reglerna om börsens disciplinnämnd (4 kap. 8–11 §§) innebär dock att medlemmars och emittenters överträdelser av reglerna prövas av en nämnd vars ledamöter inte kommer från börsen. Även om den slutliga prövningen av en överträdelse sker av en oberoende nämnd skulle intressekonflikter kunna leda till att ett disciplinärende inte initieras från börsens sida. Börsen är beroende av intäkterna från från emittenterna och dem som handlar på marknadsplatsen. Även om både emittenter och handlare har ett intresse av att marknadens integritet och därmed förtroende upprätthålls går det inte att bortse från att det innebär en intressekonflikt att vara skyldig att kontrollera och rapportera sina kunder. Förtroendekommissionen beskrev detta problem så här:

Det ligger i sakens natur att ett börsnoterat företag har starka incitament att höja sina intäkter och sänka sina kostnader. Det kan leda till att Stockholmsbörsen strävar efter att attrahera/behålla så många noterade företag som möjligt, vilket i sin tur kan inverka menligt på börsens myndighetsuppgifter. Det kan t.ex. uppstå en situation då börsen behöver sänka kostnaderna även för de förtroendeskapande inslagen i verksamheten. Dessa kostnader kan ju åtminstone i ett kortsiktigt perspektiv te sig affärsmässigt mindre motiverade.

17

För att genomföra MiFID och ta om hand denna potentiella intressekonflikt bör därför en bestämmelse om att en reglerad marknad ska identifiera och hantera intressekonflikter tas in i lagen. Möjligen är en sådan allmänt hållen bestämmelse inte tillräcklig för att åtgärda samtliga de intressekonflikter som kan uppstå. Ett sätt att undvika de intressekonflikter som kan uppstå på grund av den myndighetsliknande uppgift som börsens marknadsövervakning utgör skulle kunna vara att låta denna uppgift utföras av någon annan, t.ex. Finansinspektionen. Enligt artikel 43.1 i MiFID ska dock en reglerad marknad ha en marknadsövervak-

17

SOU 2004:47, s. 316 f.

ningsfunktion. Det skulle således strida mot MiFID att flytta över marknadsövervakningen från börsen till Finansinspektionen.

En börs har också ett eget intresse av att handeln sker i enlighet med reglerna – insiderhandel och otillbörlig marknadspåverkan kan skada förtroendet för handeln på börsen vilket i förlängningen skulle kunna leda till att färre aktörer deltar i handeln. Börsens marknadsövervakning har också till stor del en annan uppgift än att hitta kriminaliserade förfaranden – den ska vaka över att medlemmarna följer god sed och hindra beteenden som leder till felaktigheter i kursbildningen (även om felaktigheterna inte beror på brott). Ett annat skäl för att den löpande övervakningen bör skötas av respektive marknadsplats är att den måste anpassas till varje marknadsplats förhållanden, bl.a. karaktären och volymen på den handel som bedrivs där.

18

En sådan anpassning torde vara

lättare att genomföra om den löpande övervakningen sköts av respektive marknadsplats själv i stället för av en central myndighet. Det bör också framhållas att marknadsövervakningsfunktionen inte är en isolerad företeelse som med enbart tekniska hjälpmedel bevakar kursrörelser. Den information som börsen får genom de löpande kontakterna med de noterade bolagen och medlemmarna är en viktig del av övervakningen – en del som till stor del skulle gå förlorad om övervakningen sköttes av någon annan. Övervägande skäl talar således för att den löpande marknadsövervakningen även i fortsättningen bör skötas av marknadsplatsen själv. Reglerna om marknadsövervakningen bör dock skärpas på så sätt att det ställs ett uttryckligt krav på att den som driver en reglerad marknad ska organisera verksamheten så att marknadsövervakningen sköts av en separat funktion/enhet och att marknadsövervakningsfunktionens oberoende ställning säkerställs. Denna oberoende funktion bör också fullgöra skyldigheterna att övervaka medlemmars och emittenters regelefterlevnad i övrigt, se kapitel 13. Att verksamheten organiseras i enlighet med dessa bestämmelser blir sedan föremål för Finansinspektionens tillsyn. För att ytterligare möjliggöra kontroll i efterhand bör i lagen också ställa krav på dokumentation av de övervakningsåtgärder och kontrollåtgärder som vidtas – oavsett om åtgärderna leder till ett disciplinärende/anmälan till Finansinspektionen eller inte. Sådana bestämmelser i kombination med Finansinspektionens möjligheter att ingripa, t.ex. genom s.k. straffavgifter (se avsnitt 14.5.2), bör kunna bidra till en effektiv kontroll

18

Prop. 1990/91:42, s. 65.

av att den som driver en reglerad marknad sköter sin marknadsövervakning.

Hantering av risker och krav på system

I börs- och clearinglagen finns inte heller något uttryckligt krav på hantering av risker och att ha säkra tekniska system (artikel 39 b och c). Även om ett sådant krav kan sägas följa av sundhetskravet i 2 kap. 1 § börs- och clearinglagen bör bestämmelsen kompletteras i dessa avseenden.

Handelsregler

Enligt 4 kap. 2 § börs- och clearinglagen ska en börs ha ändamålsenliga regler för hur handeln ska gå till. Kraven på handelsregler tillsammans med kraven på fritt tillträde, neutralitet och god genomlysning i 2 kap. 1 § börs- och clearinglagen innebär att handelsreglerna inte får vara skönsmässiga. De svenska reglerna motsvarar kraven i artikel 39 d på regler för en rättvis och välordnad handel. Någon ändring i sak behövs därför inte för att genomföra artikel 39 d i MiFID (handelsreglerna bör dock anpassas på grund av andra regler i MiFID, se avsnitt 13.2). Däremot ställs i den svenska lagen inget uttryckligt krav på att en börs ska vidta åtgärder för att underlätta en effektiv avveckling av transaktionerna. En sådan regel bör därför införas i den nya lagen om värdepappersmarknaden.

Kapitalkrav

En reglerad marknad är inte exponerad för risker av den karaktär som kreditinstitut och värdepappersföretag behöver täcka med eget kapital – t.ex. marknadsrisker och kreditrisker. Följaktligen omfattas reglerade marknader varken av det nuvarande CAD eller av kommissionens förslag till ändringar av det direktivet.

19

En reglerad

marknad är dock exponerad för andra typer av risker som gör att den kan behöva ett visst reservkapital. Den reglerade marknaden kan t.ex. ådra sig ersättningsskyldighet för fel som uppstår i verk-

19

Se avsnitt 8.1.1.

samheten. Det kan, som angetts i förarbetena till börs- och clearinglagen, röra sig om fel som begås av anställda vid börsen, tekniska fel för vilka den reglerade marknaden inte kan få ersättning av någon utomstående eller skadeståndskrav för felaktiga beslut om avnotering.

20

Att den reglerade marknaden har en god

finansiell styrka ökar också utsikterna för verksamhetens varaktighet och kontinuitet. Ett allmänt hållet krav på att en reglerad marknad ska ha tillräckliga finansiella resurser bör, av dessa skäl och för att genomföra MiFID i denna del, ställas i den svenska lagen. Bedömningen av vilket krav som ska ställas i det enskilda fallet bör göras utifrån omfattningen och arten av den verksamhet som den reglerade marknaden bedriver. Liksom tidigare bör även andra finansiella resurser som börsen har eller kan utnyttja, t.ex. försäkringar, garantier m.m., vägas in.

Om däremot den som driver en reglerad marknad också driver en MTF följer av artikel 5.2 i MiFID att marknadsoperatören då omfattas av kravet på ett visst minsta startkapital i artikel 12. Visserligen är inte heller MTF-verksamhet förknippad med den typ av risker som kräver kapitaltäckning enligt CAD, men det är rimligt att det gäller samma krav på startkapital för en marknadsoperatör som driver en MTF som för ett värdepappersföretag som har drift av en MTF som sin enda verksamhet.

20

Prop. 1991/92:113, s. 75.

9. Verksamhet över gränserna

9.1. Inledning

Det s.k. Europapasset, dvs. värdepappersföretagens rättighet att bedriva verksamhet i andra medlemsstater med stöd av tillståndet i sitt hemland, regleras i artiklarna 31–35 i MiFID. Dessa regler behandlas i avsnitt 9.2. Även verksamheten vid en reglerad marknad kan sägas vara gränsöverskridande, om t.ex. de som deltar i handeln befinner sig i olika medlemsstater. De fåtal regler som finns om detta i MiFID behandlas i avsnitt 9.3

9.2. Värdepappersföretag

9.2.1. Tillhandahålla tjänster över gränserna

Rätten att tillhandahålla tjänster över gränserna (utan att etablera en filial) regleras i artikel 31 i MiFID. Artikeln motsvarar artiklarna 14 och 18 i ISD med några mindre ändringar. Själva rättigheten att tillhandahålla tjänster finns i artikel 31.1 som motsvarar relevanta delar av artikel 14 i ISD. Regeln i artikel 14.2 i ISD om att medlemsstaterna inte som villkor för en etablering fick ställa krav på ytterligare auktorisation eller kapitaltillskott eller motsvarande har ersatts med artikel 31.1 andra stycket MiFID som innebär att medlemsstaterna inte får ställa några ytterligare krav än som följer av direktivet på företag som tillhandahåller tjänster från en annan medlemsstat. Detta gäller dock bara sådana frågor som omfattas av direktivet. Artikel 31.2 i MiFID reglerar värdepappersföretagens skyldighet att, till den behöriga myndigheten i hemmedlemsstaten, informera om i vilken medlemsstat företaget avser att inleda verksamhet samt lämna en verksamhetsplan. En motsvarande bestämmelse finns i artikel 18.1 i ISD. Andra stycket i artikel 31.2 i MiFID är dock en nyhet i förhållande till ISD. Enligt artikeln ska

den behöriga myndigheten i hemmedlemsstaten på begäran av den behöriga myndigheten i värdmedlemsstaten lämna uppgift huruvida värdepappersföretaget ska använda sig av anknutna ombud.

Enligt artikel 31.3 i MiFID, som motsvaras av artikel 18.2 i ISD, ska den behöriga myndigheten i hemmedlemsstaten inom en månad från det att den fick uppgifter enligt artikel 31.2 vidarebefordra informationen till den behöriga myndigheten i värdmedlemsstaten.

Värdepappersföretaget ska underrätta den behöriga myndigheten om ändringar i de förhållanden som företaget lämnat uppgifter om enligt artikel 31.2 och den behöriga myndigheten i hemmedlemsstaten ska underrätta den behöriga myndigheten i värdmedlemsstaten.

Bestämmelserna i artikel 31.5 och 31.6 i MiFID är nya i förhållande till ISD och berör värdepappersföretag och marknadsoperatörer som driver en MTF. Enligt artikel 31.5 ska medlemsstaterna tillåta att den som driver en MTF i en annan medlemsstat (hemmedlemsstaten), vidtar lämpliga åtgärder i värdmedlemsstaten för att underlätta för användare eller deltagare på MTF:en att delta i handeln på distans. Företag som driver en MTF ska enligt arti- kel 31.6 meddela den behöriga myndigheten i sitt hemland i vilka andra medlemsstater företaget tänker vidta sådana underlättande åtgärder och den behöriga myndigheten ska i sin tur vidarebefordra uppgifterna till den behöriga myndigheten i berörd medlemsstat. Den behöriga myndigheten i hemmedlemsstaten ska också – på begäran av en behörig myndighet i en annan medlemsstat – vidarebefordra uppgifter om vilka av MTF:ens deltagare som är etablerade i den senare staten. Bestämmelser med samma innehåll finns även för reglerade marknader (artikel 42.6).

9.2.2. Etablera filialer

Rätten att etablera filialer i andra medlemsstater regleras i artikel 32 i MiFID. Även denna artikel har sin motsvarighet i ISD, i artiklar- na 14 och 17. Liksom vid tillhandahållande av tjänster över gränserna är medlemsstaternas, när det gäller verksamhet som omfattas av direktivet, förbjudna att ställa andra krav på filialer än vad som följer av direktivet. Ett värdepappersföretag som vill etablera en filial ska enligt artikel 32.2 underrätta den behöriga myndigheten i hemmedlemsstaten om;

  • i vilken medlemsstat företaget avser att etablera filial,
  • en verksamhetsplan, av vilken det ska framgå vilka tjänster som ska tillhandahållas från filialen, filialens organisationsstruktur samt om filialen ska använda anknutna ombud,
  • adress i värdmedlemsstaten
  • namn på filialens ledande befattningshavare

Motsvarande underrättelsesskyldighet, utom vad avser anknutna ombud, finns i artikel 17.2 i ISD.

Enligt artikel 32.2 andra stycket i MiFID ska ett anknutet ombud utanför företagets hemmedlemsstat vara införlivat med filialen.

1

Det anknutna ombudet ses alltså som en del av filialen och

inte som en självständig representant för företaget. Men om värdepappersföretaget inte har någon filial innebär bestämmelsen inte att ett anknutet ombud automatiskt blir en filial. Bestämmelsen saknar motsvarighet i ISD.

Om den behöriga myndigheten i hemmedlemsstaten, med beaktande av filialens verksamhet, inte har anledning att ifrågasätta värdepappersföretagets administrativa struktur eller finansiella situation ska myndigheten inom tre månader från det att den underrättats enligt artikel 32.2 vidarebefordra informationen till den behöriga myndigheten i värdmedlemsstaten. Den behöriga myndigheten i hemmedlemsstaten ska också informera värdepappersföretaget om detta. En motsvarande regel finns i arti- kel 17.3 i ISD. Enligt artikel 32.4 i MiFID ska den behöriga myndigheten i hemmedlemsstaten underrätta den behöriga myndigheten i värdmedlemsstaten om det system för investerarskydd som värdepappersföretaget är medlem i samt om ändringar av detta. En i stort sett motsvarande bestämmelse finns i artikel 17.3 andra stycket i ISD. Om den behöriga myndigheten i hemmedlemsstaten vägrar sända över uppgifter till den behöriga myndigheten i värdmedlemsstaten ska myndigheten enligt artikel 32.5 i MiFID underrätta värdepappersföretaget om detta senast inom tre månader från det att myndigheten fått alla uppgifter. En sådan bestämmelse finns också i artikel 17.3 tredje stycket i ISD. Enligt artikel 32.6 får filialen etableras och inleda sin verksamhet efter meddelande från

1

Tolkad strikt enligt sin ordalydelse kan artikeln sägas innebära att varje anknutet ombud

utanför företagets hemmedlemsstat ska anses införlivat med filialen i en annan medlemsstat – oavsett om det anknutna ombudet befinner sig i samma medlemsstat som filialen. Detta skulle få orimliga konsekvenser och kan inte ha varit avsikten med artikeln. Artikeln måste enligt utredningens mening förstås så att det enbart är om det anknutna ombudet har hemvist i samma medlemsstat som filialen som ombudet ska anses vara en del av filialen.

den behöriga myndigheten, eller senast två månader från det att den behöriga myndigheten i hemmedlemsstaten underrättade den behöriga myndigheten i värdmedlemsstaten enligt artikel 32.3.

Ansvaret för övervakningen av att filialen tillhandahåller investeringstjänster i enlighet med reglerna i artiklarna 19 (uppföranderegler), 21och 22 (bästa orderutförande och hantering av kundorder), 25 (rapportering av transaktioner), 27 (offentliggörande av fasta bud) och 28 (handelsinformation från en MTF), ska enligt artikel 32.7 åvila den behöriga myndigheten i den medlemsstat där filialen är belägen. Enligt 32.7 andra stycket ska den myndigheten ha rätt att granska verksamhetsformerna i filialen. Myndigheten kan också begära de ändringar som är ”oundgängligen nödvändiga” för att myndigheten ska kunna sörja för efterlevnaden av artiklar- na 19, 21, 22, 25, 27 och 28 och de nationella bestämmelser som antagits med stöd av artiklarna. I ISD finns en regel om möjligheterna att övervaka filialer i artikel 19.2 och 19.3. Enligt den bestämmelsen kan medlemsstaterna ålägga filialerna samma uppgiftsskyldighet och ställa samma krav som staten ställer på sina egna värdepappersföretag. I artikel 32.8 i MiFID finns en regel om att den behöriga myndigheten i ett värdepappersföretags hemmedlemsstat, efter att ha underättat den behöriga myndigheten i värdmedlemsstaten, ska få utföra inspektioner på plats vid filialen. En motsvarande regel finns i artikel 24.1 i ISD.

9.2.3. Tillträde till reglerade marknader samt clearing- och avvecklingssystem

Enligt artikel 33 i MiFID ska medlemsstaterna kräva av sina reglerade marknader att värdepappersföretag från andra medlemsstater ska ha rätt att bli medlemmar eller få tillträde till marknaderna, antingen som direktmedlemmar genom en filial eller som fjärrmedlemmar. Medlemsstaterna får inte ställa några andra krav på värdepappersföretagen, i frågor som omfattas av direktivet, än som följer av direktivet. Fjärrmedlemsskap förutsätter dock att den reglerade marknaden inte är konstruerad på ett sätt som i sig kräver fysisk närvaro för att transaktioner ska kunna genomföras. En motsvarande regel finns i artikel 15 i ISD.

Artiklarna 34 och 35 är till största delen nya i förhållande till ISD. I artikel 15.1 i ISD finns dock en bestämmelse om tillträde till clearing- och avvecklingssystem. Artikel 34.1 ställer krav på att

värdepappersföretag från andra medlemsstater ska få tillträde till clearing- och avvecklingssystem på samma icke-diskriminerande och objektiva villkor som inhemska värdepappersföretag. Artikeln innebär dock inte någon inskränkning i operatörens rätt att på affärsmässiga grunder vägra tillträde till marknaden, se artikel 34.3. Enligt artikel 34.2 ska medlemsstaterna också kräva att reglerade marknader i medlemsstaten ger sina medlemmar eller aktörer rätt att välja avvecklingssystem för de transaktioner som genomförts på den reglerade marknaden förutsatt att:

1. avtal och förbindelser mellan det valda avvecklingssystemet och

varje annat system säkerställer en effektiv och ekonomisk avveckling och,

2. den behöriga myndigheten som ansvarar för tillsyn över den

reglerade marknaden har tillstyrkt användningen av avvecklingssystemet i fråga.

Dessa förutsättningar begränsar värdepappersföretagens valfrihet betydligt. Fungerande förbindelser m.m. med ”varje annat system” enligt p. 1 innebär att det valda avvecklingssytemet måste ha en fungerande förbindelse med t.ex. en central värdepappersförvarare. En förutsättning för att t.ex. avvecklingen av transaktioner med svenska aktier som handlas på en svensk reglerad marknad ska kunna ske genom ett annat avvecklingssystem än VPC är att detta andra system har någon förbindelse med VPC-systemet.

I artikel 35 ställs krav på att medlemsstaterna inte får hindra den som driver en MTF att träffa lämpliga överenskommelser med någon i en annan medlemsstat avseende clearing- och avveckling av affärerna som genomförts på MTF:en. Enligt artikel 35.2 kan dock den behöriga myndigheten för den som driver en MTF, om det är nödvändigt för att MTF:en ska fungera, motsätta sig att ett clearing- eller avvecklingssystem i en annan medlemsstat utnyttjas.

9.2.4. Överväganden och förslag

Förslag: MiFID:s bestämmelser om värdepappersföretags gränsöverskridande och filialetablering flyttas med vissa mindre justeringar över till den nya lagen om värdepappersmarknaden. Underrättelsen till Finansinspektionen ska, utöver vad om krävs i dag, även innehålla uppgifter om företaget avser att använda anknutna ombud. Om ett värdepappersbolag avser att ändra något av de förhållanden som angetts i bolagets underrättelse till Finansinspektionen ska bolaget underrätta inspektionen om detta.

Ett utländskt företags anknutna ombud i Sverige ska anses vara en del av företagets filial här.

Gränsöverskridande verksamhet och filialer

Bestämmelser som ger värdepappersföretag från andra medlemsstater rätt att tillhandahålla tjänster över gränserna eller genom filialer finns redan i 1 kap. 3 c § i lagen om värdepappersrörelse. Svenska värdepappersbolags rätt att bedriva verksamhet i ett annat land inom EES finns i 1 kap. 5 § lagen om värdepappersrörelse. Bestämmelserna överensstämmer i huvudsak med MiFID men de bör dock justeras så att underrättelsen till Finansinspektionen även ska innehålla uppgifter om bolaget avser att använda anknutna ombud. Om ett värdepappersbolag avser att ändra något av de förhållanden som angetts i bolagets underrättelse till Finansinspektionen ska bolaget underrätta inspektionen om detta. Detta är en skillnad mot gällande rätt då även den behöriga myndigheten värdmedlemsstaten ska underrättas.

Enligt definitionen av begreppet filial i 1 kap. 2 § första stycket 7 i lagen om värdepappersrörelse ska även flera driftställen ses som en enda filial. I vissa fall kan nog ett anknutet ombud vara ett sådant driftställe som redan på grund av denna definition ska ses som en del av filialen. Definitionen är dock hämtad från ISD.

2

Trots att filialdefinitionen i MiFID i stort sett motsvarar den i ISD har det i MiFID särskilt angetts i artikel 32.2 andra stycket i MiFID att ett anknutet ombud ska anses vara en del av filialen. En särskild regel bör därför också tas in i den svenska lagen så att även ett

2

Prop. 1994/95:50, s. 339.

sådant ombud som inte kan anses vara ett ”driftställe” ändå ska anses vara en del av filialen.

Tillträde till marknader samt clearing- och avvecklingssystem

Bestämmelser om tillträde till börser, auktoriserade marknadsplatser och clearingorganisationer finns i dag i 3 kap. 1 och 1 a §§, 7 kap. 2 a § och 8 kap. 1 § i börs- och clearinglagen. De svenska reglerna ställer inte upp några särskilda krav för utländska värdepappersföretag. De är således förenliga med artiklarna 33 och 34 i MiFID och behöver inte ändras (däremot måste de aktuella reglerna ändras av andra skäl, se avsnitt 13.4). Artikel 35 förbjuder medlemsstaterna att sätta upp regler som hindrar den som driver en MTF att under vissa förutsättningar fritt välja avvecklingssystem. Artikeln i sig behöver inte genomföras med bestämmelser i lagen – däremot måste hänsyn tas till artikeln när bestämmelserna om MTF utformas.

Reglerna i artikel 31.5 och 31.6 om att den som driver en MTF ska underrätta den behöriga myndigheten i sin hemmedlemsstat om företaget avser att vidta åtgärder i en annan medlemsstat motsvaras av identiska regler för reglerade marknader. Genomförandet av dessa bestämmelser behandlas därför i ett sammanhang nedan.

9.3. Reglerade marknader

9.3.1. Bestämmelser i MiFID

Reglerade marknaders ”gränsöverskridande”

En reglerad marknad i en medlemsstat kan också sägas ägna sig åt ”gränsöverskridande verksamhet” om deltagarna på marknaden befinner sig i andra medlemsstater. Denna typ av gränsöverskridande har dock inte mycket gemensamt med värdepappersföretagens möjligheter att tillhandahålla tjänster i andra medlemsstater och än mindre gemensamt med värdepappersföretagens filialetableringar. Reglerna om reglerade marknaders gränsöverskridande verksamhet i MiFID är i konsekvens med detta långt från lika utförliga som för värdepappersföretagens gränsöverskridande verksamhet. De reglerade marknadernas rättigheter enligt MiFID i detta avseende består dels av en rätt att vidta åtgärder på andra

medlemsstaters territorium för att underlätta för deltagare från den medlemsstaten, dels av en rätt att träffa överenskommelser med clearingorganisationer i andra medlemsstater. Bestämmelserna om offentliga förteckningar över de olika reglerade marknaderna i EU kan också hänföras till dessa bestämmelser.

Underlättande åtgärder

Medlemsstaterna ska enligt artikel 42.6 i MiFID tillåta att reglerade marknader från andra medlemsstater vidtar lämpliga åtgärder, på värdmedlemsstatens territorium, för att underlätta tillträdet till och handeln på den reglerade marknaden för fjärrmedlemmar. En reglerad marknad som avser att vidta sådana åtgärder ska underrätta den behöriga myndigheten i sin hemmedlemsstat som inom en månad ska vidarebefordra informationen till den medlemsstat där åtgärderna ska vidtas. Den behöriga myndigheten i hemmedlemsstaten ska också på begäran av den behöriga myndigheten i den andra medlemsstaten vidarebefordra information om identiteten på medlemmar eller deltagare som är etablerade i den andra medlemsstaten. Uppgifter om medlemmarna/deltagarnas identitet ska den behöriga myndigheten i den reglerade marknadens hemmedlemsstat få regelbundet från den reglerade marknaden enligt artikel 42.7.

Överenskommelser med utländska clearingorganisationer

Enligt artikel 46 i MiFID ska medlemsstaterna inte hindra reglerade marknader från att träffa lämpliga överenskommelser med clearingorganisationer i andra medlemsstater. Den behöriga myndigheten i en medlemsstat kan dock motsätta sig sådana arrangemang om det är nödvändigt för att den reglerade marknaden ska fungera korrekt.

Förteckning över reglerade marknader

Enligt artikel 47 i MiFID ska varje medlemsstat upprätta en förteckning över de reglerade marknader för vilka den är hemmedlemsstat. Förteckningen, och ändringar i den, ska sändas till övriga medlemsstater och kommissionen. Kommissionen ska offentliggöra en förteckning över samtliga reglerade marknader och på sin webbplats offentliggöra och uppdatera förteckningen varje gång

medlemsstaterna meddelar ändringar. En motsvarande bestämmelse finns i artikel 16 i ISD.

9.3.2. Överväganden och förslag

Förslag: En börs ska underrätta Finansinspektionen om den avser att vidta åtgärder i en annan medlemsstat för att underlätta för deltagande i handeln från den medlemsstaten. Finansinspektionen ska vidarebefordra informationen till den behöriga myndigheten i den andra medlemsstaten inom en månad. Motsvarande regler ska införas för den som driver en MTF.

Underrättelser om underlättande åtgärder

Det finns i nuvarande reglering inget som skulle hindra en utländsk reglerad marknad eller den som driver en MTF från att vidta underlättande åtgärder enligt artikel 42.6 respektive artikel 31.5 i MiFID i Sverige. Några lagregler om detta behöver därför inte införas. Det finns inte heller några regler om att den som driver en reglerad marknad eller MTF i Sverige ska underrätta Finansinspektionen om åtgärder som ska vidtas i en annan medlemsstat. Det bör dock i sammanhanget framhållas att underrättelser vid underlättande åtgärder inte är den enda möjligheten för en medlemsstat att få reda på att någon med hemvist i den staten deltar i handeln på en reglerad marknad i en annan medlemsstat. Enligt artikel 42.7 ska den behöriga myndigheten regelbundet få information om vilka av den statens institut som deltar i handeln på en reglerade marknad i en annan medlemsstat. Någon motsvarande regel finns dock inte beträffande deltagare på en MTF. Även om i vart fall artikel 42.6 i det perspektivet kan framstå som överflödig bör det dock, för att korrekt genomföra MiFID, införas en skyldighet för den som driver en reglerad marknad eller en MTF i Sverige att underrätta Finansinspektionen om åtgärder som ska vidtas i en annan medlemsstat.

För att det ska vara fråga om sådana underlättande åtgärder som kräver underrättelse måste det vara fråga om någorlunda ingripande åtgärder. Att tillhandahålla dataprogramvaror över gränserna för att underlätta eller möjliggöra fjärrmedlemskap kan inte anses vara sådana åtgärder som kräver underrättelse. Det skulle knappast vara

möjligt för den som driver marknadsplatsen att vara helt säker på i vilken medlemsstat programvaran används – vilket således skulle försvåra en korrekt underrättelse. För den som driver en reglerad marknad eller MTF ska vara skyldig att underrätta den behöriga myndigheten bör det alltså vara fråga om åtgärder som marknadsoperatören har full kontroll över. Det vill säga fysiska arrangemang i en annan medlemsstat som närmast motsvarar upprättandet av en filial. Om marknadsoperatören t.ex. inrättar ett kontor med terminaler som står i förbindelse med handelssystemet eller dylikt bör underrättelseskyldigheten inträda.

Även regler om att Finansinspektionen ska underrätta den behöriga myndigheten där börsen eller den som driver en MTF avser att vidta de underlättande åtgärderna bör införas i lagen.

Enligt 1 § 10 förordningen (1992:561) om börs- och clearingverksamhet får Finansinspektionen meddela föreskrifter om vilka upplysningar bl.a. en börs ska lämna till inspektionen. Inspektionen kan således redan med befintliga regler föreskriva att en börs ska lämna en sådan förteckning över sina medlemmar som avses i artikel 42.7 i MiFID.

Överenskommelser med utländska clearingorganisationer

I Sverige skulle man i teorin kunna tänka sig att Finansinspektionen motsatte sig att en svensk börs samarbetade med en clearingorganisation i en annan medlemsstat genom att inspektionen vidtog sanktioner mot börsen, t.ex. under åberopande av att samarbetet stred mot den allmänna sundhetsregeln i 2 kap. 1 §. I den mån detta var berättigat för att den reglerade marknaden skulle fungera korrekt vore ett sådant ingripande förenligt med artikel 46. I den mån ingripandet inte var berättigat skulle det inte vara förenligt med vare sig den svenska lagen eller artikel 46 i MiFID. Det behövs därför inget tillägg till gällande regler för att genomföra artikel 46 i svensk rätt.

Förteckning över reglerade marknader

Medlemsstaternas skyldighet enligt ISD att upprätta en förteckning över reglerade marknader ledde som nämnts inte till någon uttrycklig bestämmelse i lag eller förordning, se avsnitt 8.1.1. Lik-

som förteckningen över värdepappersföretag kan bestämmelsen genomföras genom en komplettering av förordningen med instruktion för Finansinspektionen.

10. Genomlysning

10.1. Inledning

God genomlysning av en marknad för finansiella instrument kännetecknas av att investerarna har tillgång till den information de behöver för att kunna göra välgrundande investeringsbeslut och för att kunna utvärdera sina affärer i efterhand. Genomlysning rör således både den information som finns tillgänglig före handeln, dvs. uppgifter om köp- och säljintressen och den information som tillhandahålls efter handeln, dvs. information om redan avslutade affärer.

Vilken information och i vilka mängder som genomlysningen av en viss marknad lämpligen bör omfatta är en inte alltigenom enkel fråga och kan skilja sig avsevärt mellan olika marknader och marknadssegment. Om det vore så att mer information alltid är bättre för marknadens funktion än mindre information skulle starka krav på genomlysning vara oproblematiska. Tyvärr är det inte alltid så enkelt.

Detta kan tydliggöras med ett exempel. Om en aktieinvesterare, som är intresserad av att köpa en stor post aktier i ett visst företag, tvingas avslöja sina avsikter innan han eller hon genomför köpet kommer detta troligen att pressa upp priset, eftersom andra investerare då tror att köparen har ny positiv information om företaget. Detta kommer givetvis att minska hans eller hennes förtjänst av att förvärva aktierna. Det kan leda till att investeraren väljer att avstå från att handla eller väljer en marknadsplats med mindre genomlysning.

I grunden uppstår problemet eftersom handeln i sig skapar information som är värdefull för andra investerare. Själva informationen kan också ses som en vara. Genom att handla kan en investerare till exempel få information om hur andra aktörer värderar det finansiella instrumentet, vilket i sin tur kan påverka den egna värderingen av både det handlade instrumentet och andra relaterade

instrument. En långtgående genomlysning kan därför påverka denna marknad för information.

Ett exempel på hur detta problem hanteras i praktiken är att på de flesta elektroniska aktiemarknader med en hög grad av genomlysning sker större transaktioner i regel vid sidan om det elektroniska ordermatchningssystemet. Många elektroniska marknadsplatser tillåter också så kallade dolda order där informationen om en del av volymen inte publikt tillgänglig förrän delar av ordern har lett till avslut.

Alltför höga krav på genomlysning kan även ha andra negativa effekter. Om investerare alltid tvingas avslöja sina avsikter i förväg minskar deras incitament att lägga ner resurser på att analysera de olika företagens framtidsutsikter. Om avkastningen på sådana analyser minskar kommer färre analyser att genomföras och investerarna som kollektiv att bli sämre informerade vilket leder till en sämre fungerande marknad med mindre handel och större skillnader mellan köp- och säljkurser. Valet av genomlysning påverkar således både marknadens likviditet och effektivitet.

1

Att hitta en lämplig nivå på genomlysningen innebär således ett antal avvägningar. Det gäller att ha en tillräckligt hög grad av genomlysning för att locka till sig investerare, men samtidigt inte en så stark genomlysning att investerarnas incitament att analysera företagen och handla stora positioner minskar alltför mycket. Generellt torde små investerare gynnas av en högre grad av genomlysning, i vart fall så länge detta inte påverkar marknadseffektiviteten negativt, medan större och för marknadens funktion viktigare aktörer kan gynnas av en något lägre grad av genomlysning. Den lämpliga nivån på genomlysningen innebär därför en avvägning mellan olika investerares intressen.

Traditionellt har marknadsplatser i hög grad kunnat välja nivå på genomlysning. Det finns en praktisk logik i detta eftersom det för en börs eller annan aktör som driver en marknadsplats är viktigt att hitta den nivå på genomlysning som passar bäst för just hans marknadsplats. Det ligger i marknadsplatsoperatörens eget intresse att etablera en genomlysningsnivå som främjar såväl förtroendet

1

För en mer utförlig diskussion kring genomlysningens effekter på marknadens funktions-

sätt, se bland annat Madhavan, A. (2000) ”Market Micro structure: A Survey” Journal of Financial Markets, 3, 205–258 och Rindi, B. (2004) ”Informed Traders as Liquidity Providers: Transparency, Liquidity and Price Formation” Working paper, Bocconi University, October. För en studie kring skillnaderna mellan olika marknaders genomlysning se till exempel Comerton-Forde, C. och J. Rydge (2004), ”A Review of Stock Market Microstructure”, Working paper SIRCA, April.

för marknadsplatsen som likvid och effektiv handel, eftersom marknadsplatsens intäkter till stor del styrs av omsättningen. Valet av genomlysning har också historiskt sett varit ett viktigt konkurrensmedel, där olika marknadsplatser valt olika strategier.

Vid offentlig reglering av genomlysning uppstår ett antal komplikationer. En komplikation är att behovet av genomlysning är olika för olika finansiella instrument. Aktiemarknaderna – där ofta mindre investerare deltar – kännetecknas vanligen av en högre grad av genomlysning än exempelvis ränte- och valutamarknaderna, där i första hand professionella aktörer deltar. Över tiden har också olika marknadsplatser förändrat sina regler för genomlysning vilket tyder på att den lämpliga nivån inte är konstant. Mycket talar därför för att den optimala utformningen av reglerna kring genomlysning varierar såväl över tiden som mellan olika marknadsplatser, olika typer av värdepapper och olika typer av investerare. Valet kompliceras även av att graden av genomlysning har betydelse inte bara för investerarnas förtroende för marknadsplatsen utan även för finansmarknaden i stort.

Mot denna bakgrund är det enligt utredningens mening viktigt att i utformningen av regleringen av genomlysningen så långt som möjligt välja en flexibel nivå som både bidrar till investerarnas förtroende för marknadsplatsen och till en effektiv och likvid marknad.

MiFID innebär i flera fall en EU-harmonisering av genomlysningen. Huvudregeln i MiFID är att informationen om anbud och priser m.m. ska lämnas omedelbart. MiFID och genomförandedirektivet innehåller emellertid ett flertal undantag från denna regel. Krav på information före och efter handel i MiFID gäller i första hand aktier upptagna till handel på en reglerad marknad oavsett var handeln skett. Tanken är att harmonisera genomlysningen och att ge marknadens aktörer möjlighet att handla där de bästa villkoren finns. Bestämmelserna om en hög nivå på genomlysningen är också ett viktigt komplement till reglerna om bästa möjliga orderutförande för kunderna. Genom att information om kurser och avslut finns lätt tillgängliga har såväl kunderna som den behöriga myndigheten en möjlighet att på ett enkelt sätt kontrollera om en transaktion skett i enlighet med uppställda regler.

Genomlysningsreglerna i MiFID – som alltså endast gäller aktier upptagna till handel på en reglerad marknad – är uppdelade i krav på offentliggörande av information före respektive efter handel. Bestämmelserna är något annorlunda utformade beroende på om

handeln skett vid en reglerad marknad/MTF eller om handeln utförts direkt i ett värdepappersföretags regi – t.ex. mot det egna lagret eller genom sammanförande av två kunders order.

Tabellen nedan ger en sammanfattande bild av var bestämmelserna om offentliggörande av information före och efter handel finns i MiFID.

Information före handel Information efter handel

Reglerad marknad Artikel 44 Artikel 45 MTF Artikel 29 Artikel 30 Värdepappersföretag som utför en order på annat sätt än på en MTF eller reglerad marknad (exkl. systematiska internhandlare)

Artikel 22.2 Artikel 28

Systematiska internhandlare Artikel 27 Artikel 28

Nedan kommer i avsnitt 10.2 att redogöras för bestämmelserna om krav på offentliggörande av information före handel. Regelverket rörande skyldigheten för systematiska internhandlare att offentliggöra köp- och säljpriser kommer att beröras i ett särskilt avsnitt (10.2.3) då dessa bestämmelser skiljer sig markant från de övriga. Därefter kommer i avsnitt 10.3 ett avsnitt om skyldigheten att offentliggöra information efter handel. Slutligen kommer i avsnitt 10.4 utredningens förslag till hur bestämmelserna om genomlysning i MiFID ska införlivas i svensk rätt.

10.2. Bestämmelser i MiFID om krav på information före handel

10.2.1. Reglerad marknad och MTF

I artikel 44.1 i MiFID ställs krav på en reglerad marknad att offentliggöra aktuella köp- och säljbud samt orderdjupet. Kommissionens genomförandebestämmelser innehåller delvis olika regler för offentliggörandet av information beroende på hur handeln är organiserad på marknadsplatsen. För en orderdriven marknad ska orderdjupet redovisas i fem nivåer (artikel 16.2 i genomförandeförordningen). Skyldigheten enligt artikel 44 gäller endast aktier som är upptagna till handeln på marknaden men medlemsstaterna har möjlighet att tillämpa direktivets krav även på andra finansiella

instrument (jfr skäl 46 i ingressen till MiFID). I artikel 29.1 ställs liknande krav på en MTF i fråga om aktier som är upptagna till handel på en reglerad marknad. Däremot uppställs inte motsvarande krav när det gäller aktier som bara handlas på en MTF. Informationen ska göras tillgänglig för allmänheten på rimliga affärsmässiga villkor.

Enligt artiklarna 44.2 och 29.2 ska de behöriga myndigheterna ha möjlighet att på grundval av marknadsmodell, ordertyp och orderstorlek göra undantag från informationskravet. Kommissionen har i genomförandeförordningen närmare föreskrivit när undantag från kravet på information får medges (artiklarna 17–19).

För det första får undantag medges om handelssystemet är uppbyggt på ett sådant sätt att priset bestäms utifrån ett referenspris. Krav ställs dock på att referenspriset är allmänt tillgängligt och att det betraktas som tillförlitligt referenspris av marknadsaktörer (artikel 17.1 a i genomförandeförordningen). För det andra kan undantag medges från skyldigheten att offentliggöra information för s.k. manuella avslut (negotiated transactions). Med manuella avslut menas avslut som skett utanför en marknadsplats orderbok, t.ex. avslut mot det egna lagret eller avslut mellan två kunder som sammanförs av ett värdepappersföretag, men i enlighet med de regler marknadsplatsen satt upp.

2

Med detta syn-

sätt har det ansetts nödvändigt att göra undantag från skyldigheten att offentliggöra information före handeln. Huvudregeln för att undantaget ska bli tillämpligt är att transaktionen skett inom det volymvägda kursintervallet.

3

Speciella regler gäller dock om trans-

aktionen utförts under andra förutsättningar än gällande marknadspris, t.ex. snittpriset under dagen (s.k. VWAP-order).

4

För det tredje får undantag medges för vissa typer av order som har det gemensamt att endast en del av ordern visas i systemet under förutsättning att detta sker genom den reglerade marknadens eller MTF:ens försorg (artikel 17.2 i genomförandeförordningen). Det som avses är framförallt s.k. isbergsorder.

5

Anledningen till att

2

Undantaget för manuella avslut är dock inte tillämpligt för transaktioner som skett i

enlighet med artikel 27 (systematisk internhandel). Angående begreppet på och utanför en reglerad marknad, se avsnitt 12.4.2.

3

Med detta menas den teoretiska spread som skulle etableras i orderboken om ordern hade

lagts där.

4

Jfr artikel 3 i genomförandeförordningen.

5

En isbergsorder ger en kund möjlighet att delvis dölja volymen av en order för allmänheten.

Kunden lämnar information till marknadsplatsen om vilken ordervolym han eller hon vill ska läggas ut i systemet. Så fort denna del är avslutad läggs en ny order med automatik in i syste-

detta undantag finns är att aktörerna själva skulle ha kunnat organiserat sin handel på motsvarande sätt men att marknaden genom att tillhandahålla tjänsten effektiviserar och förenklar investerarnas handel.

Undantag från informationsskyldigheten kan slutligen medges för en order som är större än en normalorder (artikel 19 igenomförandeförordningen). Vid bedömningen av om en order är större än normalordern ska hänsyn tas inte bara till själva beloppet utan även till den aktuella aktiens likviditet (se nedanstående tabell). Den dagliga omsättningen beräknas av den behöriga myndigheten (artikel 32 i genomförandeförordningen). Nivåerna nedan ska ses som miniminivåer för att medlemsstaterna ska kunna medge undantag. Inget hindrar en reglerad marknad eller MTF att i sina regelverk ha högre gränser för när undantag från informationsskyldigheten ska kunna göras.

Daglig

omsättning

Daglig omsättning

Daglig omsättning

Daglig omsättning

Daglig omsättning

Större än 50 milj. euro

Mellan 25– 50 milj. euro

Mellan 1– 25 milj. euro

Mellan 0.5– 1 milj. euro

Mindre än 0,5 milj. euro

Minsta storlek på en order för att undantag ska kunna medges

EUR 500 000

EUR 400 000

EUR 250 000

EUR 100 000

EUR 50 000

Ex. En aktie har en daglig omsättning på 750 000 euro. För att undantag från informationsskyldigheten då ska kunna medges krävs att orderns storlek uppgår till åtminstone 100 000 euro.

10.2.2. Värdepappersföretag

När ett värdepappersföretag utför en transaktion utanför en reglerad marknad eller MTF föreligger inget allmänt krav på information före handel. Bestämmelsen i artikel 22.2 i MiFID som stadgar en skyldighet för värdepappersföretag att i vissa fall offentliggöra limitorder som inte utförs omedelbart innebär dock i praktiken ett krav på information före handel även för värdepappers-

met. Tjänsten ger kunden en möjlighet att på ett enkelt sätt lägga en större order utan att detta påverkar marknaden.

företag. Vidare utgör skyligheten att offentliggöra fasta priser i artikel 27 för handel kärnan i reglerna om systematiska internhandlare (se avsnitt 12.2.3).

Om ett företag erhåller en limitorder avseende aktier upptagna till handel på en reglerad marknad och ordern inte utförs omedelbart ska företaget enligt artikel 22.2, för att underlätta ett så skyndsamt verkställande som möjligt, offentliggöra ordern genom att göra den tillgänglig för övriga marknadsaktörer. Skyldigheten gäller dock inte om kunden har lämnat uttryckliga instruktioner om att så inte ska ske. Medlemsstaterna får enligt artikeln föreskriva att företagen ska anses ha fullgjort skyldigheten att offentliggöra ordern om de har lämnat den till en reglerad marknad eller MTF. Av artikel 30 i genomförandeförordningen framgår att ett värdepappersföretag alltid ska anses ha uppfyllt sina skyldigheter enligt artikel 22.2 i MiFID om företaget vidarebefordrar ordern antingen till en orderdriven reglerad marknad eller MTF eller offentliggör ordern på ett sådant sätt att den lätt kan genomföras så snart marknadsvillkoren tillåter det.

Bestämmelsen i artikel 22.2 har tillkommit såväl för att utöka en kunds möjligheter att få en order utförd som för att tillgodose intresset från andra marknadsaktörer att få del av information om lagda limitorder. Bestämmelsen får därmed anses åtminstone delvis vara en genomlysningsregel. Den behöriga myndigheten har dock möjlighet att medge undantag från kravet på att offentliggöra ordern om ordern är ovanligt stor. Detta undantag ska vara utformat på samma sätt som det som gäller för reglerade marknader enligt artikel 44.2 (se ovan).

10.2.3. Systematiska internhandlare

Inledning

Kommissionen övervägde redan i sitt förslag till nytt direktiv (KOM (2002) 625 slutlig) att införa en skyldighet för värdepappersföretag att i förväg ange till vilka priser de var beredda att köpa och sälja värdepapper utanför de reglerade marknaderna. Skyldigheten skulle endast gälla s.k. systematiska internhandlare. Enligt definitionen i MiFID är en systematisk internhandlare ett värdepappersföretag som på ett organiserat, frekvent och systematiskt sätt handlar för egen räkning genom att utföra kundorder

utanför en reglerad marknad eller MTF (definitionen kommenteras närmare nedan).

Kravet på systematiska internhandlare – som nu återfinns i artikel 27 – är troligen den mest kontroversiella och omdiskuterade bestämmelsen i direktivet. Artikeln kan ses som en kompromiss för att de medlemsstater som hittills tillämpat s.k. koncentrationsregler skulle vara beredda att avskaffa sådana regler. I de länder där sådana koncentrationsregler tillämpats har reglerna inneburit ett börstvång i så måtto att det funnits ett lagkrav på att aktieaffärer ska ske på en börs.

Kommissionen utgick i sitt förslag till direktiv från att ett krav på insyn före transaktionen skulle komma att förbättra prisbildningsprocessen genom att handelsinformationen till marknadsaktörerna maximerades. Bedömt ur perspektivet bästa möjliga utförande och effektiv prisbildning var det enligt kommissionen inte tillräckligt att känna till de villkor som gällde för genomförandet av den senaste transaktionen. Det faktum att valet av en viss handelsplats ledde till det fördelaktigaste utfallet för den senaste transaktionen innebär inte någon garanti för att denna handelsplats också kommer att erbjuda de mest fördelaktiga villkoren för nästa affär. Kommissionen föreslog därför att en skyldighet skulle införas för värdepappersföretag att avge fasta offentliga köp- och säljbud för en specificerad transaktionsstorlek för de mest likvida aktierna för vilka de var systematiska internhandlare. En sådan regel skulle ge marknadsaktörerna på förhand besked om på vilka villkor värdepappersföretaget var redo att genomföra transaktioner för den angivna volymen i aktien i fråga.

Bestämmelsen om skyldigheten att offentliggöra priser har justerats under processens gång, bl.a. vad gäller till vilken översta orderstorlek ett värdepappersföretag är skyldigt att offentliggöra priser, möjligheten att differentiera priser beroende på orderns storlek och möjlighet för värdepappersföretag att kunna begränsa antalet order när den totala ordervolymen blir avsevärt högre än normalt.

Skyldigheten att offentliggöra priser skulle kunna beskrivas som en marknadsgarantåtagande för de värdepappersföretag som omfattas av bestämmelsen. Marknadsgaranter används emellertid normalt för att förbättra likviditeten på sådana marknader som annars skulle kännetecknas av dålig likviditet. Bestämmelsen i artikel 27 innebär emellertid det motsatta eftersom den kräver offentliggörande av priser i de aktier för vilka det finns en likvid marknad.

Definition av systematisk internhandlare

Med systematisk internhandlare avses ett värdepappersföretag som på ett organiserat, frekvent och systematiskt sätt handlar för egen räkning genom att utföra kundorder utanför en reglerad marknad eller en MTF (artikel 4.1.7 i MiFID). Samtliga tre rekvisit på vilket sätt handeln ska utföras (organiserat, frekvent och systematiskt) måste således vara uppfyllda för att ett värdepappersföretag ska anses vara en systematisk internhandlare.

I kommissionens genomförandebestämmelser finns närmare anvisningar om när ett värdepappersföretag är att anse som en systematisk internhandlare (artikel 20 i genomförandeförordningen). Enligt bestämmelserna ska ett värdepappersföretag anses bedriva sin internhandel på ett organiserat, frekvent och systematiskt sätt bl.a. om internhandeln spelar en betydande affärsmässig roll för företaget och utförs i enlighet med fastställda regler och förfaranden Därutöver krävs att internhandeln sker regelbundet och att den är kontinuerligt tillgänglig för företagets kunder samt att den utförs av personal eller med automatiserat tekniskt system som är utsett för just detta ändamål.

Att ett värdepappersföretag en gång blivit att betrakta som en systematisk internhandlare i ett antal aktier innebär inte att företaget för all framtid är skyldigt att fortsätta offentliggöra priser i dessa aktier. En systematisk internhandlare har naturligtvis möjlighet att sluta agera som internhandlare i en aktie. Ett krav för detta är enligt genomförandeförordningen att internhandlare meddelar ett sådant beslut i förväg. Ett sådant beslut ska publiceras på samma sätt som företaget tidigare har offentliggjort sina priser. Hur ofta ett företag kan växla mellan att vara internhandlare eller inte framgår inte av MiFID eller genomförandeförordningen utan detta får i första hand anses vara en sak för tillsynsmyndigheten att avgöra.

Skyldighet för systematiska internhandlare att offentliggöra köp- eller säljpriser

Av artikel 27.1 framgår att en systematisk internhandlare är skyldig att offentliggöra fasta bud med köp- eller säljpriser i de likvida aktier som är upptagna till handel på en reglerad marknad och som

företaget är systematiska internhandlare för.

6

Företaget är därmed

också enligt artikel 27.3 i princip skyldigt att göra affärer till de offentliggjorda priserna. Företaget har dock enligt artikel 27.5 rätt att på grundval av sin affärspolicy och på ett objektivt icke-diskriminerande sätt avgöra vilka personer företaget ger tillgång till sina bud.

7

Värdepappersföretaget har därutöver rätt att vägra att ingå,

eller avbryta, affärsförbindelser med investerare på grundval av affärsmässiga överväganden som t.ex. investerarens kreditvärdighet och motpartsrisk. Ett värdepappersföretag har således vissa möjligheter att utforma sin systematiska internhandel på det sätt man önskar. Det väsentliga är dock att företaget inom den policy man antagit inte gör åtskillnader mellan t.ex. olika kunder på ett diskriminerande sätt.

Som framgått ovan gäller kravet på att offentliggöra bud endast för likvida aktier. Kommissionen har i sina genomförandebestämmelser preciserat vad som ska menas med detta begrepp (artikel 21 i genomförandeförordningen). En aktie ska enligt huvudregeln uppfylla samtliga följande tre krav för att anses vara likvid.

1. Aktien ska handlas dagligen.

2. De aktier som finns i allmän ägo (s.k. free float) ska uppgå till minst 500 miljoner euro.

8

3. Antingen ska det genomsnittliga antalet transaktioner per dag i aktien överstiga 500 eller så ska den genomsnittliga dagliga omsättningen överstiga två miljoner euro.

Som framgår av punkten 3 räcker det att ett av kraven i denna punkt är uppfylld för att en aktie ska anses vara likvid (förutsatt att även punkterna 1 och 2 är uppfyllda). Medlemsstaterna har dock möjlighet att bestämma att båda de alternativa kraven i punkten tre måste vara uppfyllda för att an aktie ska anses vara likvid och på så sätt begränsa antalet aktier.

Även om en aktie inte uppfyller de ovan nämnda kraven har medlemsstaterna rätt att besluta att upp till fem aktier i hemlandet

6

Det kan noteras att ett företag kan vara systematisk internhandlare i en aktie endast

beträffande försäljning av aktien (se skrivningen och/eller i artikel 27.1 tredje stycket). Internhandlaren är då endast skyldig att offentliggöra säljpriser för aktien.

7

Jfr skäl 50 i ingressen till MiFID som anger ett snävare tillämpningsområde när ett värde-

pappersföretag kan avgöra vilka personer som de ger tillgång till sina bud än vad artikel 27.5 gör.

8

Vid beräkningen av free float exkluderas innehav som överstiger 5 procent av det totala

röstetalet. Detta gäller dock inte om aktierna ägs av investeringsfonder eller motsvarande fonder utomlands samt pensionsfonder (se artikel 27.3 i genomförandedirektivet).

ska anses som likvida. Denna bestämmelse har tillkommit med anledning av att det i flera länder endast finns ett fåtal aktier som når upp till de ovan nämnda kraven.

I fråga om aktier för vilka det saknas en likvid marknad ska de systematiska internhandlarna på begäran ge bud till sina kunder. Anledningen till att värdepappersföretagen endast är skyldiga att offentliggöra priser i likvida aktier är att de annars skulle tvingas exponera sig för en risk t.ex. genom att inte kunna bli av med köpta aktier till det pris som de köptes för. Det framgår inte direkt ut direktivtexten om övriga bestämmelser i artikeln är tillämpliga på dessa aktier. Med tanke på artikelns inriktning och att flera bestämmelser inte rimligen ska tillämpas på illikvida aktier – t.ex. indelningen av aktier i olika kategorier – anser utredningen att artikeln bör tolkas så att övriga bestämmelser i artikeln inte är tillämpliga för sådana bud som ett företag ger i illikvida aktier. Bestämmelsen kan då tyckas tämligen innehållslös då värdepappersföretaget – om det inte skulle vara intresserad av att utföra en internhandel – kan lämna ett så dåligt bud att en affär inte blir av.

Av artikel 27.1 andra stycket framgår att skyldigheten att offentliggöra bud endast gäller transaktioner som är mindre eller lika stora som standardstorleken på marknaden (se nedan). När det gäller större transaktioner kan således värdepappersföretaget förhandla fritt med kunden.

När MiFID har genomförts kommer varje likvid aktie att ha en angiven standardstorlek beroende på hur stor genomsnittstransaktionen för den aktien är. Eftersom bedömningen ska ske samlat för samtliga de marknadsplatser där aktien handlas har det ansetts vara förenat med betydande administrativa insatser att räkna fram en individuellt baserad storlek för varje enskild aktie och dessutom hålla dessa beräkningar uppdaterade. I artikel 27.1 fjärde stycket stadgas därför att aktierna ska delas in i olika klasser. Bedömningen av till vilken klass en aktie ska tillhöra ska utföras av den behöriga myndigheten för den likviditetsmässigt mest relevanta marknaden. Klasserna i sig har dock bestämts av kommissionen. Av tabell 3 i bilaga 2 till genomförandeförordningen framgår att aktier för vilka medelvärdet för transaktioner är upp till 50 000 euro delas in i klasser i intervaller om 10 000 euro och för transaktioner därutöver i intervall om 20 000 euro. Standardstorleken för en aktie i en klass kommer att bestämmas till värdet i mitten av klassen.

9

En aktie som

9

I den första klassen (0–10 000 euro) har dock standardstorleken bestämts till 7 500 euro.

ligger i klassen 20 000–30 000 euro kommer därmed att få en standardstorlek om 25 000 euro.

Standardstorleken beräknas således i euro. Ett värdepappersföretag har naturligtvis möjlighet att genom en omräkning i stället offentliggöra sina priser i en annan valuta eller utifrån antal aktier.

Enligt artikel 27.1 tredje stycket får en systematisk internhandlare bestämma upp till vilken storlek eller vilket belopp han är villig att offentliggöra bud. Internhandlaren har också möjlighet att offentliggöra olika bud för olika volymer (se exempel nedan). Budet ska offentliggöras på ett sätt som gör det lätt tillgängligt för andra marknadsaktörer på rimliga affärsmässiga villkor (artikel 27.3 andra stycket). Företaget väljer själv på vilket sätt han vill offentliggöra buden. Detta kan t.ex. ske genom en reglerad marknads försorg. I artikel 44.1 andra stycket stadgas nämligen att en reglerad marknad på rimliga affärsmässiga villkor och på icke-diskriminerande grunder får ge värdepappersföretag tillträde till de funktioner de använder för att offentliggöra information enligt den artikeln. Detta kan t.ex. ske genom att en order i orderboken markeras på ett sätt så att det framgår att ordern även kan handlas internt hos värdepappersföretaget eller genom att den offentliggörs på en separat informationssida.

Det offentliggjorda priset ska återspegla villkoren på marknaden. Detta innebär i praktiken att priset ska ligga i närheten av priset på andra relevanta marknader (se artikel 23 a i genomförandeförordningen).

De systematiska internhandlarna ska enligt artikel 27.3 första stycket regelbundet och kontinuerligt offentliggöra sina bud under den tid då den del av företaget som interhandlar har öppet. Internhandlarna ska ha rätt att när som helst uppdatera sina bud. Detta är viktigt då priset, som framgått ovan, ska återspegla villkoren på marknaden. Vid exceptionella marknadsvillkor ska internhandlaren även ha rätt att dra tillbaka sina bud. En systematisk internhandlare är skyldig att under minst ett år bevara information om vilka priser han offentliggjort (artikel 43 b i genomförandeförordningen).

Systematiska internhandlare ska, samtidigt som de uppfyller kraven i artikel 21 om bästa orderutförande, utföra de order de mottar från sina icke-professionella kunder till de offentligjorda priserna vid den tidpunkt då orderna mottogs. I direktivet anges inte när en order ska anses som mottagen. Syftet med artikel 27 är att ett värdepappersföretag offentliggör i princip bindande bud. Det är därmed normalt sett kunden som genom ett accepterande av

företagets offentliggjorda pris binder avtalsparterna. Utredningen anser därför att tidpunkten för mottagande av en order enligt artikel 27 bör vara just den tidpunkt då kunden accepterar företagets bud, under förutsättning att värdepappersföretaget har gjort den kontroll av kunden som är nödvändig. Det förhållandet att värdepappersföretaget, efter det att kunden accepterat ett bud, skickar iväg ordern till en annan avdelning inom företaget bör dock inte påverka tiden för mottagandet av ordern. Företaget utsätts då visserligen för en risk att marknadspriset ändras innan företaget kan balansera kundtransaktionen med en motsatt transaktion på marknaden. Den risken är emellertid densamma för kunden.

Om en kund har lämnat en order till ett värdepappersföretag och företaget ser att kunden kan få ett bättre pris på en börs eller en annan marknadsplats än företagets offentliggjorda pris har företaget inte rätt att erbjuda ett bättre pris. För att inte bryta mot bestämmelserna om bästa orderutförande i artikel 21 är företaget då i allmänhet skyldigt att slussa ordern vidare till marknadsplatsen. Man skulle i och för sig kunna tänka sig en situation då en kund, trots att han har blivit informerad om att priset på en annan marknadsplats är bättre, ändå vill få till stånd ett snabbt avslut på det av värdepappersföretaget offentliggjorda priset. Bestämmelserna om bästa orderutförande i artikel 21 gäller ju inte om kunden gett specifika instruktioner.

Skyldigheten att genomföra affären till de offentliggjorda buden vid den tidpunkt orderna mottogs gäller även, enligt huvudregeln i artikel 27.3 fjärde stycket, vid utförande av order från professionella kunder. Dessa order får emellertid utföras till ett bättre pris i berättigade fall förutsatt att priset ligger inom ett offentliggjort intervall nära marknadsförhållandena och förutsatt att orderns storlek överstiger den storlek som är den vanliga i fråga om icke-professionella investerare (7 500 euro enligt artikel 25 i genomförandeförordningen). Det är alltså fråga om order som storleksmässigt ligger mellan 7 500 euro och den fastställda standardstorleken för aktien. Om ordern är större än standardstorleken är artikel 27 ju över huvud taget inte tillämplig (artikel 27.1 andra stycket).

Artikel 27.3 fjärde stycket innehåller till skillnad från tredje stycket inte något förbehåll om reglerna i artikel 21 om bästa orderutförande. Artikel 21 gäller emellertid oavsett om institutets motpart är professionell eller inte. Det enda undantaget som görs i artikel 21 är för affärer med godtagbara motparter. Även profes-

sionella kunders order måste således enligt huvudregeln slussas vidare till något annat forum om det ger kunden mer förmånliga villkor (jfr skäl 44 i ingressen till MiFID).

Systematiska internhandlare får enligt artikel 27.3 femte stycket utföra order de mottar från sina professionella kunder till priser som skiljer sig från de offentligjorda buden utan att behöva uppfylla de villkor som anges i fjärde stycket i fråga om transaktioner där utförande av ordern i olika värdepapper är en del av en enda transaktion (s.k. basket trade) eller i fråga om order som är underkastade andra villkor än det aktuella marknadspriset. För att det första undantaget ska bli tillämpligt krävs att det i transaktionen ingår åtminstone tio olika värdepapper (artikel 24.1 a i genomförandeförordningen). Det andra undantaget avser andra order än vanliga köp- och säljorder till bästa möjliga pris eller limitorder. Som exempel på när undantaget skulle kunna tillämpas är när en kund t.ex. köper A-aktier med villkor att han eller hon samtidigt får sälja B-aktier i ett och samma företag samt en s.k. VWAPorder.

10

Om en systematisk internhandlare får en order som överstiger den storlek han offentliggjort priser för men inte överstiger standardstorleken på marknaden, har internhandlaren enligt arti- kel 27.3 sjätte stycket rätt att avvisa ordern i den del den överstiger den storlek han offentliggjort priser för. Om han väljer att utföra hela ordern är internhandlaren dock skyldig att utföra ordern till det offentliggjorda priset – naturligtvis under förutsättning att ett bättre pris inte kan fås på en annan marknad. För det fall en internhandlare har offentliggjort olika priser för olika storlekar och han erhåller en order som ligger mellan dessa storlekar får internhandlaren välja till vilket av de två priserna ordern ska utföras. Följande två exempel kan illustrera artikel 27.3 sjätte stycket.

10

Se artikel 3.2 i genomförandeförordningen.

Exempel 1: Ett värdepappersföretag har offentliggjort följande säljkurser. Standardstorleken för bolaget motsvarar 1 000 aktier.

0–200 aktier 50 kr/aktie 201–400 aktier 49,75 kr/aktie 401–800 aktier 49,50 kr/aktie En kund kommer in till ett värdepappersföretag och vill köpa 900 aktier. Värdepappersföretaget är inte skyldigt att acceptera ordern i dess helhet eftersom den överstiger den storlek som företaget offentliggjort priser för. Företaget kan dock välja att acceptera ordern men måste då utföra hela ordern till det pris som gäller för 800 aktier, dvs. 49,50 kr.

Exempel 2: Ett värdepappersföretag kan i stället för att offentliggöra priser i intervall offentliggöra priser i ett visst antal aktier.

100 aktier 50 kr 300 aktier 49,75 kr 600 aktier 49,65 kr För det fall ett värdepappersföretag mottar en order mellan två storlekar, t.ex. 200 aktier, har företaget i princip rätt att avvisa ordern men också rätt att välja att utföra ordern antingen till det pris som gäller för 100 aktier eller till det pris som gäller för 300 aktier. Direktivtexten anger således vilket pris som ska gälla för transaktioner mellan de av företaget angivna nivåerna (100, 300 respektive 600) och mellan den av företaget angivna högsta nivån och standardstorleken (i exemplet 1 000 aktier). Däremot anges ingen regel för det fall att företaget väljer att utföra en order som ligger under den lägsta angivna nivån (i exemplet 100 aktier). Enligt utredningens mening måste bestämmelsen i sådant fall tolkas som att ordern måste utföras – under förutsättning att företaget accepterar ordern – till det pris som gäller på den lägst offentliggjorda storleken, dvs. 100 aktier i exemplet. Med en sådan tolkning kommer de värdepappersföretag som är intresserade av att handla även i små storlekar att offentliggöra priser i flera olika storlekar.

Den behöriga myndigheten ska enligt artikel 27.4 övervaka att värdepappersföretagen regelbundet uppdaterar de köp- och säljpriser som offentliggörs och att företagen har priser som är representativa för marknadsvillkoren samt att de iakttar bestämmelsen i

artikel 27.3 fjärde stycket om när professionella kunder får erbjudas bättre priser.

För att risken att exponeras för ett stort antal affärer ska kunna begränsas har den systematiska internhandlaren enligt artikel 27.6 rätt att på ett icke-diskriminerande sätt begränsa det antal transaktioner han åtar sig att utföra åt samma kund. Detsamma gäller vid order från olika kunder om det totala antalet eller volymen av orderna avsevärt överstiger det normala. En internhandlare ska i riktlinjer ange i vilken omfattning han har möjlighet att åta sig order (se artikel 24.2 i genomförandeförordningen).

10.3. Bestämmelser i MiFID om krav på information efter handel

Bestämmelser om skyldighet att offentliggöra information efter handel finns för reglerad marknad i artikel 45, för MTF i artikel 30 och för värdepappersföretag i artikel 28.

Av artikel 45.1 framgår att den reglerade marknaden – åtminstone när det gäller aktier som är upptagna till handel på marknaden – ska offentliggöra priser, volymer och tidpunkter för transaktioner som genomförts i dess system. Uppgifterna ska offentliggöras på rimliga affärsmässiga villkor och i så nära realtid som möjligt. Av artikel 28 i genomförandeförordningen framgår att uppgifterna under alla förhållanden måste offentliggöras inom tre minuter från det att transaktionen ägde rum. Det bör poängteras att huvudregeln är att informationen ska offentliggöras i så nära realtid som det är tekniskt möjligt och att det således inte är tillåtet att vänta med offentliggörandet i tre minuter (jfr skäl 18 i ingressen till genomförandeförordningen).

Utöver ovan nämnda information ska det vid offentliggörande särskilt noteras bl.a. om avslutet var ett s.k. manuellt avslut (negotiated transaction) och om transaktionens pris bestämdes utifrån andra förhållanden än marknadspriset (artikel 26.1 i genomförandeförordningen).

I artikel 30 finns en motsvarande bestämmelse för MTF:er. Kravet för en MTF gäller dock inte uppgifter som efter en anmälan från MTF:en har offentliggjorts i en reglerad marknads system. Slutligen finns i artikel 28 en motsvarande bestämmelse för värdepappersföretag som genomför en transaktion på annat sätt än på en reglerad marknad eller MTF. Det kan noteras att något offentlig-

görande från ett värdepappersföretags sida inte behövs om handeln har ägt rum på en reglerad marknad eller MTF; i så fall gäller i stället marknadsplatsens informationsskyldighet enligt artiklar- na 45 och 30. Även vid s.k. manuella avslut kommer offentliggörandet ske i enlighet med artiklarna 45 och 30. Med manuella avslut menas avslut som har skett utanför en reglerad marknads eller MTF:s system men i enlighet med marknadens regelverk. Ett värdepappersföretag som t.ex. gjort ett avslut mot det egna lagret och sedan anmält avslutet till en börs i enlighet med dess regler ska vad beträffar reglerna om genomlysning ansetts ha gjort detta på den reglerade marknaden.

11

Skyldigheten för ett värdepappersföretag att lämna information i så nära realtid som möjligt gäller endast om ordern utförts under företagets normala öppettider. I de fall företaget utför en transaktion efter denna tid är det enligt artikel 28.5 i genomförandeförordningen tillräckligt att informationen offentliggörs vid en senare tidpunkt dock senast innan den för aktien mest relevanta marknadsplatsen öppnar nästa dag.

På samma sätt som för information som ska lämnas före handel kan medlemsstaterna besluta att tillämpa direktivets krav om genomlysning på andra finansiella instrument än aktier upptagna till handel på en reglerad marknad.

Den behöriga myndigheten har enligt artiklarna 45.2 och 30.2 i MiFID möjlighet att under vissa förutsättningar tillåta en reglerad marknad och MTF att skjuta upp offentliggörandet av informationen. Detta ska enligt direktivtexten särskilt gälla i fråga om ovanligt stora transaktioner. Den reglerade marknaden och MTF:en ska i förväg ha lagt fast en ordning för hantering av uppskovssituationer och denna ordning ska ha godkänts av den behöriga myndigheten samt gjorts tillgänglig för marknadens aktörer.

Även ett värdepappersföretag har möjlighet att skjuta upp offentliggörande av information efter handel. Om de beslut som antagits i enlighet med artikel 45 innehåller föreskrifter om förlängd tidsfrist ska nämligen en sådan möjlighet även gälla för värdepappersföretag som genomfört en transaktion utanför en reglerad marknad eller MTF. Artikeln är inte helt lättbegriplig. Utredningen har dock tolkat bestämmelsen så att ett värdepappersföretags möjligheter till att skjuta upp offentliggörandet är av-

11

Angående begreppet handel på eller utanför en reglerad marknad eller MTF, se av- snitt 12.4.2.

hängigt av de beslut som den behöriga myndigheten har meddelat en reglerad marknad. Ett värdepappersföretag skulle därmed inte ha en självständig rätt att av en behörig myndighet begära att få tillstånd att skjuta upp offentliggörandet av information efter handel.

I genomförandeförordningen konkretiseras när och hur länge ett offentliggörande kan skjutas upp (tabell 4 i bilaga 2). Hur länge ett offentliggörande kan skjutas upp beror såväl på aktiens omsättning som på transaktionens storlek.

Indelning av aktier med hänsyn tagen till den genomsnittliga dagliga omsättningen (GDO) GDO GDO GDO GDO

mindre än 100 000 euro

100 000–1 milj. euro

1–50 milj. euro större än 50 milj. euro

Maximal tillåten för- dröjning av offentlig- görande av information

Minsta storlek på en transaktion för att fördröjning av offentliggörande av informationen ska vara tillåten

60 minuter 10 000 euro Större än 5 procent av GDO och 25 000 euro

Lägre än 10 procent av GDO och 3,5 milj. euro

Lägre än 10 procent av GDO och 7,5 milj. euro

180 minuter 25 000 euro Större än 15 procent av GDO och 75 000 euro

Lägre än 15 procent av GDO och 5 milj. euro

Lägre än 20 procent av GDO och 15 milj. euro

Till slutet av handels- dagen (eller till kl. 12.00 dagen därpå om transaktionen utfördes under de sista två timmarna)

45 000 euro Större än 25 procent av GDO och 100 000 euro

Lägre än 25 procent av GDO och 10 milj. euro

Lägre än 30 procent av GDO och 30 milj. euro

Till slutet av handels- dagen dagen efter transaktionen

60 000 euro Större än 50 procent av GDO och 100 000 euro

100 procent av GDO 100 procent av GDO

Till slutet av handels- dagen två dagar efter transaktionen

80 000 euro Större än 100 pro- cent av GDO och 25 000 euro

250 procent av GDO

10.4. Genomförande i svensk rätt

10.4.1. Nuvarande reglering

I 2 kap. 1 § börs- och clearinglagen anges som en av flera förutsättningar för auktorisation att en börs ska bedriva sin verksamhet så att verksamheten kan anses sund. Därvid ska börsen bl.a. tillämpa principen om god genomlysning som innebär att de som deltar i handeln får en snabb, samtidig och korrekt information om handeln och att allmänheten får tillfälle att ta del av sådan information.

Närmare bestämmelser om information såväl före som efter handel finns i 4 kap. 3 § samma lag. Enligt paragrafen ska informationen om kurser och omsättningsuppgifter beträffande de finansiella instrument som noteras vid en börs offentliggöras omedelbart, om inte Finansinspektionen med hänsyn till handelns effektivitet tillåter något annat. I 7 kap. finns liknande bestämmelser för en auktoriserad marknadsplats. En skillnad är dock att det för en auktoriserad marknadsplats inte föreligger något krav på omedelbarhet. I stället ska informationen sammanställas dagligen och offentliggöras i den ordning och omfattning som regeringen eller, efter regeringens bemyndigande, Finansinspektionen föreskriver.

Finansinspektionen har i sina föreskrifter (FFFS 1995:43) om inregistrering av fondpapper m.m. närmare angett vilken information som ska offentliggöras, bl.a. beträffande kurser och omsättning. I 3 kap. i dessa föreskrifter stadgas, vad gäller börser

12

, att

offentliggörande av kurser och omsättningsuppgifter beträffande varje finansiellt instrument ska ske elektroniskt och anses ha skett genom att dessa av börsen hålls tillgängliga för spridning till etablerade informationsföretag. När det gäller köp- och säljbud ska information om orderdjupet – om den tillhandahålls i förväg – vara tillgänglig under den tid handeln pågår. Offentliggörandet av varje avslut ska enligt huvudregeln innehålla uppgifter om

  • beteckningen på det finansiella instrument som köpts och sålts,
  • datum och tid för affären,

12

Föreskrifterna i 3 kap. reglerar endast sådan information som avses i 4 kap. 3 § börs- och clearinglagen. Föreskrifterna är således inte tillämpliga för auktoriserade marknadsplatser och några andra föreskrifter som gäller för auktoriserade marknadsplatser finns inte.

  • pris, ränta eller kurs,
  • volym, och
  • aggregerad volym under dagen.

Finansinspektionen kan, om särskilda skäl finns, efter särskild ansökan från en börs medge dispens från de angivna minimikraven avseende uppgifter som ska offentliggöras, om det är motiverat med hänsyn till effektiviteten i handeln. Dessutom har inspektionen medgett undantag från kravet på omedelbarhet vad gäller avslut i skuldebrev samt i termins- och optionskontrakt avseende skuldebrev, dvs. instrument på penning- och obligationsmarknaden. Information om priser och omsättning rörande dessa instrument ska offentliggöras senast kl. 09.00 dagen efter affärsdagen. För dessa instrument finns också särskilda bestämmelser vilka uppgifter offentliggörandet ska innehålla. Anledningen till undantaget är att dessa instrument har en annan marknadsstruktur; det är färre aktörer som till stor del professionella som handlar i instrumenten och handel är till skillnad från börshandeln inte orderdriven utan prisdriven.

Det föreligger således i dag en möjlighet för en börs att få dispens från Finansinspektionen från skyldigheten att offentliggöra information omedelbart. Finansinspektionen beslutade den 23 maj 2005 att medge Stockholmsbörsen sådan dispens.

13

Inspektionens

beslut innebär att offentliggörande av information rörande transaktioner i aktier kan fördröjas om transaktionens storlek överstiger vissa i beslutet angivna gränser. Tiden som ett offentliggörande kan fördröjas beror bl.a. på aktiens dagliga omsättning och transaktionens storlek. Som längst kan informationen fördröjas till handelsdagens slut. Beslutet av inspektionen gäller i ett år, dvs. till den 23 maj 2006.

13

FI Dnr 05-2303-406. Före detta datum hade alltså Stockholmsbörsen inte rätt att tillämpa ett fördröjt offentliggörande.

10.4.2. Överväganden och förslag

Informationskrav före handel på en reglerad marknad och MTF

Förslag: En börs och ett företag som driver en MTF ska offentliggöra information om handel beträffande de finansiella instrument som tagits upp till handel på marknaden i en utsträckning som med hänsyn till verksamhetens art och omfattning säkrar en god genomlysning.

För aktier upptagna till handel på en reglerad marknad ska börsen och företaget som driver en MTF offentliggöra köp- och säljbud samt orderdjup. Denna information ska göras tillgänglig för allmänheten på rimliga affärsmässiga villkor och fortlöpande under den tid marknaderna är öppna.

Regeringen eller den myndighet regeringen bestämmer får meddela närmare föreskrifter om ett företags skyldigheter att offentliggöra information beträffande andra finansiella instrument än sådana som är upptagna till handel på en reglerad marknad.

MiFID ställer krav på offentliggörande av aktuella köp- och säljbud samt orderdjup (fem prisnivåer) vid dessa priser. Informationen ska göras tillgänglig för allmänheten på rimliga affärsmässiga villkor och fortlöpande under den tid då marknaderna normalt är öppna. Kravet gäller bara aktier som är upptagna till handel på en reglerad marknad.

De svenska bestämmelserna i börs- och clearinglagen och Finansinspektionens föreskrifter uppfyller MiFID:s krav utom vad gäller kravet på information om orderdjupet. Enligt de svenska bestämmelserna verkar börsen själv kunna besluta om denna information ska tillhandahållas (jfr 3 kap. 4 § i Finansinspektionens föreskrifter om inregistrering av fondpapper m.m.). Enligt artiklarna 44.1 och 29.1 i MiFID är huvudregeln att sådan information ska offentliggöras. Det föreligger således en saklig skillnad mellan MiFID och den svenska regleringen i denna del. I den nya lagen bör därför informationsskyldigheten utökas till att även gälla orderdjupet. En sådan skärpning torde inte innebära några praktiska problem eftersom de existerande börserna redan i dag regelmässigt tillhandahåller information om orderdjupet i sina system.

Bestämmelsen i artiklarna 44.2 och 45.1 som anger att den reglerade marknaden kan låta värdepappersföretag använda den

reglerade marknadens system för att offentliggöra information enligt artiklarna 27 och 28 kräver ingen lagändring. Enligt 4 kap. 5 § börs- och clearinglagen får en börs utöver den verksamhet som auktorisationen avser driva sådan verksamhet som har nära samband med den. En sidoverksamhet som ansetts ha sådant samband är att erbjuda kursinformation från andra marknadsplatser (prop. 1991/92:113 s. 76 f). Även att tillhandahålla systemet för offentliggjorda priser för värdepappersinstitut bör vara en sådan verksamhet som har ett nära samband med börsverksamheten.

Som framgått ovan behöver medlemsstaterna enligt MiFID endast tillämpa bestämmelserna om genomlysning på aktier som är upptagna till handel på en reglerad marknad. Bestämmelserna i börs- och clearinglagen gäller emellertid för alla finansiella instrument som är noterade på en börs. Utgångspunkten för utredningen har varit att skapa ett regelverk som, förutom att uppfylla MiFID:s krav, säkerställer en god genomlysning samtidigt som den inte ska vara alltför stelbent. Utredningens allmänna utgångspunkt har också varit att undvika nya regler som går längre än MiFID om inte starka skäl talar för detta. Enligt utredningen ligger det ett stort värde att den som vill driva en reglerad marknad eller MTF har möjlighet att själv skapa det system och regelverk som passar just den marknadens mål och inriktning. Ett alltför detaljerat regelsystem skulle kunna allvarligt minska intresset för att starta olika alternativa marknadsplatser. När det gäller MTF:er är det i dag oklart i vilken omfattning sådana kommer att drivas i Sverige. En gissning är dock att ett flertal kommer att växa fram med olika inriktningar och olika målgrupper. Relevansen av god genomlysning kan variera avsevärt beroende på vem en reglerad marknad eller en MTF riktar sig till. Det torde t.ex. vara betydligt värdefullare med detaljerade genomlysningsregler på en marknadsplats som domineras av icke-professionella kunder jämfört med en obligationsmarknad med uteslutande professionella aktörer.

Att ersätta dagens krav på genomlysning endast med MiFID:s minimikrav skulle medföra en betydande avreglering vad gäller andra instrument än aktier upptagna till handel på en reglerad marknad. Utredningen föreslår därför att en bestämmelse införs i den nya lagen som innebär att en börs och ett företag som driver en MTF ska offentliggöra information om handel beträffande de finansiella instrument som tagits upp till handel på marknaden i en utsträckning som med hänsyn till verksamhetens art och omfattning säkrar en god genomlysning. Vad som menas med en god

genomlysning kommer att variera bl.a. beroende på handelns omfattning, vem marknaden riktar sig till och vilka instrument som handlas på marknaden. Det blir därefter en uppgift för Finansinspektionen att i sin tillsynsverksamhet övervaka att dessa krav uppfylls. Bestämmelsens utformning bidrar till en viss grad av frihet och flexibilitet för marknadsplatserna. Regeringen eller den myndighet regeringen bestämmer bör bemyndigas att meddela närmare föreskrifter om vad ett företag ska iaktta för att uppfylla kraven på god genomlysning. Det kan även framhållas att det oavsett reglering torde ligga i en marknads eget intresse att genomlysningen uppfyller vissa grundläggande krav för att på så sätt locka till sig fler investerare.

När det gäller aktier som är upptagna till handel på en reglerad marknad måste naturligtvis bestämmelser motsvarande MiFID införas i den nya lagen. Som framgått tidigare har medlemsstaterna möjlighet att låta MiFID:s och genomförandeförordningens mer detaljerade bestämmelser om offentliggörande av information före handel även gälla andra instrument. Med hänsyn till de fördelar som ligger i att skapa ett flexibelt regelverk anser dock utredningen att det för närvarande är tillräckligt att låta MiFID:s och genomförandeförordningens bestämmelser endast tillämpas på aktier som är upptagna till handel på en reglerad marknad. Tilläggas kan att kommissionen enligt artikel 65.1 i MiFID senast två år efter det att direktivet trätt i kraft ska rapportera till Europaparlamentet och rådet om direktivets informationskrav före och efter handel ska utvidgas till att även gälla andra finansiella instrument än aktier.

Bestämmelserna i MiFID om möjligheten att meddela undantag från offentliggörandet av information före handel behandlas senare i detta avsnitt.

Krav på värdepappersinstitut att offentliggöra limitorder

Förslag: Om en kund har föreskrivit ett lägsta pris vid försäljning till tredje man eller ett högsta pris vid inköp (limit) avseende aktier upptagna till handel på en reglerad marknad och värdepappersinstitutet inte utför ordern omedelbart ska institutet snarast offentliggöra ordern på ett sätt som gör den lätt tillgänglig för övriga marknadsaktörer. Detta gäller dock inte om kunden har gett andra instruktioner.

Som angetts ovan är ett värdepappersföretag enligt artikel 22.2 i MiFID skyldigt att omedelbart offentliggöra en limitorder avseende aktier upptagna till handel på en reglerad marknad, om ordern inte utförs omedelbart. Ordern ska offentliggöras på ett sätt som gör den lätt tillgänglig för övriga marknadsaktörer. Skyldigheten gäller dock inte om kunden gett andra instruktioner.

Ett krav på värdepappersinstitut enligt artikel 22.2 föreligger inte enligt svensk rätt i dag. En bestämmelse med detta innehåll måste därför införas i den nya värdepappersmarknadslagen. I praktiken torde en sådan skyldighet innebära att limitordern läggs in i en reglerad marknads eller en MTF:s handelssystem. Som redogjorts för ovan kan ett värdepappersinstitut dock välja att offentliggöra ordern på ett annat sätt under förutsättning att ordern genom offentliggörandet kan genomföras på ett snabbt sätt (jfr artikel 30 i genomförandeförordningen). Skyldigheten att offentliggöra en order omedelbart kan dock inte gälla i de fall detta skulle strida mot andra regelverk, t.ex. bestämmelser om marknadsmissbruk, eller om själva ordern är utformad på ett sådant sätt att det skulle strida mot den reglerade marknadens regelsystem att omedelbart lägga in den i orderboken, t.ex. en stop-loss-order.

Ett offentliggörande av en limitorder skulle kunna innebära en risk för att kunden får ett sämre pris än vad han annars skulle ha fått. Värdepappersföretaget skulle t.ex. ha möjlighet att få ett mer fördelaktigt pris för kunden genom att avvakta något med att offentliggöra budet eller genom att dela upp ordern i flera, mindre order. Enligt utredningens mening måste dock artikel 30 i genomförandeförordningen tolkas så att ett värdepappersinstitut alltid har uppfyllt sina skyldigheter om det har vidarebefordrat ordern till t.ex. en orderdriven reglerad marknad eller MTF. Naturligtvis kan kunden i samband med att han gav ordern ha gett specifika instruktioner om hur institutet ska handla.

14

På grund av bestämmelsen i

artikel 30 i genomförandeförordningen anser utredningen att det inte finns anledning att utnyttja möjligheten enligt artikel 22.2 att fastslå att ett institut har fullgjort sin skyldighet om det vidarebefordrar ordern till en reglerad marknad eller MTF.

Bestämmelsen i MiFID om möjligheten att meddela undantag från kravet på offentliggörandet behandlas senare i detta avsnitt (jfr artikel 22.2 sista meningen).

14

Jfr artikel 4 i genomförandedirektivet och kommentaren till denna artikel i avsnitt 6.2.

Informationskrav efter handel på en reglerad marknad och MTF

Förslag: Informationsskyldigheten före handel för en börs och ett företag som driver en MTF beträffande finansiella instrument som är upptagna till handel på marknaden ska även innefatta information efter handel.

För aktier som är upptagna till handel på en reglerad marknad ska börsen och företaget som driver en MTF offentliggöra pris, volym och tidpunkt för de transaktioner med aktierna som har genomförts på den reglerade marknaden. Denna information ska göras tillgänglig för allmänheten på rimliga affärsmässiga villkor och i så nära realtid som möjligt.

Av MiFID och genomförandeförordningen framgår att reglerade marknader och MTF:er efter avslut ska offentliggöra priser, volymer och tidpunkter för transaktioner som genomförts i deras system. Vidare ska det vid offentliggörandet enligt kommissionens genomförandebestämmelser särskilt noteras bl.a. om avslutet var ett s.k. manuellt avslut (negotiated transactions) och om transaktionens pris bestämdes utifrån andra förhållanden än marknadspriset. Informationen ska göras tillgänglig på rimliga affärsmässiga villkor i så nära realtid som möjligt.

MiFID:s bestämmelser om offentliggörande av priser, volymer och tidpunkter för transaktioner överensstämmer med de bestämmelser som redan i dag gäller för börser genom börs- och clearinglagen och Finansinspektionens föreskrifter. Kraven om särskild notering av de ovan nämnda omständigheterna är dock en nyhet jämfört med dagens regler.

15

Bestämmelserna i börs- och clearinglagen gäller till skillnad från MiFID alla finansiella instrument som är noterade på en börs. I Finansinspektionens föreskrifter finns dock särskilda regler för instrument på penning- och obligationsmarknaden. På samma sätt som föreslagits rörande information före handel anser utredningen att MiFID:s och kommissionens genomförandebestämmelser endast bör gälla för aktier upptagna till handel på en reglerad marknad. Den allmänna regel om god genomlysning som föreslagits beträffande information före handel ska dock även innefatta information efter handel. Finansinspektionens föreskrifter, som i dag är skriva som undantag till huvudregeln om omedelbar genom-

15

Stockholmsbörsen noterar dock dessa omständigheter redan i dag.

lysning, får anpassas när den nya mer allmänna bestämmelsen om genomlysning införs.

Krav på värdepappersinstitut att offentliggöra information efter handel

Förslag: Ett värdepappersinstitut som har genomfört en transaktion med aktier som är upptagna till handel på en reglerad marknad ska offentliggöra information om pris, volym och tidpunkt för transaktionen. Informationen ska göras tillgänglig för allmänheten på rimliga affärsmässiga villkor och i så nära realtid som möjligt och på ett sätt som gör den lätt tillgänglig för andra marknadsaktörer. Institutet behöver dock inte offentliggöra någon information om transaktionen har genomförts på en reglerad marknad eller MTF eller utgör ett s.k. manuellt avslut, dvs. avslutet har visserligen skett utanför en marknadsplats men i enlighet med marknadens regelverk.

Någon bestämmelse motsvarande den i MiFID om värdepappersföretags skyldighet att offentliggöra information om transaktioner med aktier som skett utanför en reglerad marknad eller MTF finns inte i dag. Regelverket är i stället uppbyggt så att börsmedlemmarna är skyldiga att rapportera till börsen de avslut de gjort utanför börsen på det sätt och i den omfattning som börsen bestämmer (4 kap. 4 § börs- och clearinglagen).

16

För värdepappersinstitut som

inte är börsmedlemmar finns en skyldighet i 1 kap. 7 a § lagen om värdepappersrörelse att anmäla avslut till börsen. Själva offentliggörande av informationen åligger därefter börsen (4 kap. 3 § börs- och clearinglagen).

En annan skillnad mellan MiFID och den svenska regleringen är att MiFID endast kräver offentliggörande av avslut med aktier upptagna till handel på en reglerad marknad. Skyldigheten för värdepappersinstituten att rapportera avslut enligt börs- och clearinglagen avser samtliga finansiella instrument som är noterade vid börsen.

Eftersom det i nuvarande reglering saknas en bestämmelse som ålägger värdepappersinstitut att offentliggöra information efter

16

Vid Stockholmsbörsen gäller att avslut under en handelspost (normalt ca ett halvt basbelopp) inte behöver rapporteras.

handel rörande avslut med aktier upptagna till handel på en reglerad marknad måste en sådan bestämmelse införas i den nya lagen. Det kan noteras att informationen ska göras tillgänglig på rimliga affärsmässiga villkor, vilket torde betyda att institutet åtminstone har rätt till viss ersättning för de kostnader som offentliggörandet innebär från de personer som önskar ta del av informationen.

Utredningen har ovan föreslagit att MiFID:s genomlysningsregler endast ska tillämpas på aktier upptagna till handel på en reglerad marknad. Någon anledning att göra en annan bedömning när det gäller värdepappersinstitut föreligger inte.

Således bör värdepappersinstitut endast vara skyldiga att offentliggöra information om pris, volym och tidpunkt för transaktioner med aktier som är upptagna till handel på en reglerad marknad. Eftersom värdepappersinstituten enligt MiFID själva ansvarar för att informationen offentliggörs finns det inget skäl att bibehålla dagens bestämmelse om rapporteringsskyldighet till börsen. Ett institut har dock naturligtvis möjlighet att komma överens med en börs eller ett värdepappersinstitut som driver en MTF att informationen offentliggörs genom dessa marknaders system, dvs. vad som i praktiken sker i dag. Med detta ställningstagande finns det inte heller anledning att bibehålla rapporteringsskyldigheten när det gäller andra finansiella instrument än aktier upptagna till handel på en reglerad marknad. En annan sak är att börsen och deltagarna på den reglerade marknaden avtalsvis kan ställa upp sådana villkor.

Bestämmelserna i MiFID om möjligheten att skjuta upp offentliggörandet behandlas nedan.

Undantag från skyldigheten att lämna information och möjligheten att skjuta upp offentliggörandet

Förslag: Finansinspektionen ska ha möjlighet att för transaktioner med aktier upptagna till handel på en reglerad marknad medge undantag från skyldigheten för en börs eller ett företag som driver en MTF att offentliggöra information före handel. De närmare förutsättningarna för att undantag ska kunna beviljas framgår av genomförandeförordningen.

Finansinspektionen ska även ha rätt att medge undantag från skyldigheten för ett värdepappersinstitut att offentliggöra en limitorder som inte har utförts omedelbart. Förutsättningarna

för detta ska vara desamma som de som gäller för en börs och ett företag som driver en MFF.

Finansinspektionen ska vidare ha rätt att beträffande samma instrument medge en börs eller ett företag som driver en MTF dispens från skyldigheten att offentliggöra information efter handel så snart som möjligt. Ett värdepappersinstitut ska ha samma möjligheter att erhålla dispens från skyldigheten att offentliggöra information efter handel som Finansinspektionen har medgett en reglerad marknad.

Som framgått ovan ska den behöriga myndigheten ha rätt att göra undantag från bestämmelserna om offentliggörande av information före handel med hänvisning till marknadsmodell, ordertyp och orderstorlek (artiklarna 44 och 29 i MiFID). Detta gäller för såväl börser som företag som driver MTF:er. Dessutom ska ett värdepappersföretag som enligt artikel 22.2 är skyldigt att offentliggöra en limitorder ges samma möjligheter att göra undantag. Vidare finns bestämmelser om rätt för börser, företag som driver MTF:er och värdepappersföretag att med hänsyn till typ och storlek av en order skjuta upp offentliggörandet av information efter handel (artiklarna 45, 30 och 28).

Tillsammans med kommissionens genomförandebestämmelser är MiFID:s reglering mer detaljerad än nuvarande svenska regler. I börs- och clearinglagen föreskrivs endast att Finansinspektionen kan meddela dispens från kravet på att information ska lämnas omedelbart, om det är motiverat med hänsyn till effektiviteten i handeln.

Bestämmelser bör införas i lagen om värdepappersmarknaden som ger regeringen eller den myndighet som regeringen bestämmer rätt att meddela undantag från informationsskyldigheten före handel och dispens från kravet att offentliggöra information efter handel så snart som möjligt. De närmare förutsättningarna för när undantag eller dispens kan medges framgår av genomförandeförordningen.

Systematiska internhandlare

Förslag: En definition av systematiska internhandlare motsvarande den som ges i MiFID förs in i lagen om värdepappersmarknaden. Därutöver införs en bestämmelse som anger att en systematisk internhandlare är skyldig att offentliggöra marknadsmässiga fasta bud med köp- eller säljpriser i de likvida aktier som är upptagna till handel på en reglerad marknad och som värdepappersinstitutet är systematisk internhandlare för. Skyldigheten att offentliggöra priser gäller endast upp till standardstorleken på den mest relevanta marknaden för aktien.

En systematisk internhandlare ska ha rätt att när som helst ändra sina bud. Vid extraordinära marknadsförhållanden ska internhandlaren också ha rätt att dra tillbaka sina bud.

En systematisk internhandlare är skyldig att utföra ordern till det offentliggjorda priset vid tidpunkten då ordern togs emot om inte detta skulle strida mot bestämmelserna om bästa orderutförande. Internhandlaren ska dock ha rätt att utföra en order till ett bättres pris om ordern kommer från en professionell kund, det förbättrade priset ligger inom ett intervall nära marknadsförhållandena och orderns storlek överstiger den storlek som är den vanliga i fråga om icke-professionella investerare (7 500 euro enligt artikel 25 i genomförandeförordningen). En systematisk internhandlare ska därutöver få utföra en order till ett bättre pris än det offentliggjorda i fråga om transaktioner där utförande av ordern i olika värdepapper är en del av en enda transaktion eller i fråga om order som är underkastade andra villkor än det aktuella marknadspriset.

En systematisk internhandlare ska ha rätt att i enlighet med sin affärspolicy och på ett icke-diskriminerande sätt avgöra till vilka personer han ger tillgång till sina bud. Internhandlaren får även vägra att ingå, eller avbryta, affärsförbindelser med kunder på grundval av affärsmässiga överväganden.

En systematisk internhandlare ska vidare ha rätt att på ett icke-diskriminerande sätt begränsa det antal transaktioner från samma kund han åtar sig att inleda på de offentliggjorda villkoren samt begränsa det totala antalet transaktioner från olika kunder vid samma tidpunkt om antalet eller volymen av orderna avsevärt överstiger det normala.

Regeringen eller den myndighet regeringen bestämmer bemyndigas att meddela närmare föreskrifter om vilka kriterier

som ska ställas upp vid bedömningen av om en aktie är att anses som likvid enligt artikel 21.1 andra stycket genomförandeförordningen.

Bestämmelserna i MiFID om systematiska internhandlare saknar motsvarighet i nuvarande reglering och måste därmed införas i den nya lagen om värdepappersmarknaden. En närmare beskrivning av artikel 27 ges i avsnitt 10.2.3. Därutöver bör en definition av en systematisk internhandlare som språkligt anknyter till direktivtexten införas i lagen.

Definitionen träffar sådana värdepappersinstitut som utför kunders order mot det egna lagret på ett organiserat, frekvent och systematiskt sätt, se även artikel 20 i genomförandeförordningen. Förutom traditionella värdepappersinstitut träffar denna definition även sådana institut som t.ex. Aktiespararnas värdepappersinstitut Aktieinvest FK AB som har som affärsidé att tillhandahålla handel med aktier i småposter – eller till och med andelar av aktier – till ett pris som beräknas på kurserna under dagen. Syftet med sådana tjänster är att på ett kostnadseffektivt sätt tillhandahålla aktiehandelstjänster även till sådana kunder som endast önskar köpa enstaka aktier För att kunna tillhandahålla den typ av tjänster handlar sådana företag för egen räkning – och utför kundernas order mot det egna lagret. På så sätt kan det pris som kunderna betalar/får bestämmas till t.ex. dagens högsta betalkurs med ett påslag/avdrag beräknad som en procentuell andel av skillnaden mellan dagens högsta och lägsta betalkurs. Sättet att beräkna priset är således tydligt redovisat innan kunderna lägger sina order men prissättningen i det enskilda fallet sker efter det att marknadsplatsen stängt. Detta förfaringssätt stämmer inte överens med skyldigheterna enligt artikel 27 att offentliggöra priser och utföra kunders order till de offentliggjorda priserna. De nya reglerna förhindrar således att de beskrivna tjänsterna utförs som beskrivits ovan. Enligt utredningens uppfattning bör dock i sak motsvarande tjänster kunna tillhandahållas om t.ex. villkoren för tjänsten ändras så att kunderna i fråga inte köper aktier utan i stället erhåller en fordran på aktier mot företaget.

Det är oklart hur svenska värdepappersinstitut i övrigt kommer att reagera på det nya regelverket. Som anförts ovan kommer ett institut att ha relativt stora möjligheter att självt bestämma hur internhandeln ska läggas upp. Vidare bestämmer ju institutet självt

om det över huvud taget ska ägna sig åt systematisk internhandel och i vilka aktier det i så fall ska ske. I den bemärkelsen ger direktivet instituten möjlighet att själva bestämma vilken exponering institutet ska utsätta sig för.

Som redogjorts för ovan har medlemsstaterna enligt artikel 21.1 i genomförandeförordningen viss möjlighet att välja vilka krav som ska vara uppfyllda för att en aktie ska anses vara likvid. Enligt huvudregeln ska en aktie anses likvid om det genomsnittliga antalet transaktioner i aktien överstiger 500 per dag eller om den dagliga omsättningen överstiger 500 miljoner euro. Om Sverige skulle välja att låta huvudregeln styra vilka aktier som ska anses vara likvida skulle i dagsläget ca 35 aktier uppfylla kraven.

17

Om Sverige i stället

skulle välja att båda kraven ska vara uppfyllda skulle endast ca 15 aktier anses som likvida.

Enligt utredningens mening finns det ingen anledning att redan i samband med att MiFID träder i kraft kategorisera fler aktier som likvida än vad minimireglerna i MiFID och genomförandeförordningen kräver. För det fall värdepappersinstituten anser att det finns kommersiella fördelar med att offentliggöra bud även i andra aktier har de naturligtvis möjlighet att göra detta. Även de övriga nordiska länderna planerar, såvitt utredningen har förstått, att utnyttja möjligheten att begränsa antalet likvida aktier.

Regeringen eller den myndighet regeringen bestämmer bör bemyndigas att meddela närmare föreskrifter om vilka kriterier som ska ställas upp vid bedömningen av om en aktie är att anses som likvid enligt artikel 21.1 andra stycket genomförandeförordningen.

17

Se CESR:s Annex I to the Consultation document: Data on shares subject to article 27 of the MiFID, REF.: 05-164 Annex I.

11. Transaktionsrapportering

11.1. Bestämmelser i MiFID om krav på rapporteringsskyldighet

Av artikel 25.3 i MiFID framgår att ett värdepappersföretag som har utfört en transaktion med ett finansiellt instrument som tagits upp till handel på en reglerad marknad så snart som möjligt och senast vid slutet av följande arbetsdag ska lämna uppgifter om transaktionen till den behöriga myndigheten. Skyldigheten gäller oavsett om transaktionen utförts på en reglerad marknad eller inte. Med transaktion avses ett köp eller en försäljning av ett finansiellt instrument (se artikel 5 i genomförandeförordningen).

Bestämmelsen om att ett värdepappersföretag endast är skyldigt att rapportera om transaktioner med finansiella instrument som är upptagna till handel på en reglerad marknad är en minimibestämmelse. Medlemsstaterna har således möjlighet att tillämpa bestämmelserna om rapporteringsskyldighet även på andra finansiella instrument (jfr skäl 45 i ingressen till MiFID).

Informationen ska enligt artikel 25.4 bl.a. innehålla uppgifter om namn och nummer på de instrument som har köpts eller sålts, kvantitet, samt dag och tidpunkt för genomförandet av transaktionen. Kommissionen har i sina genomförandebestämmelser till artikeln upprättat en detaljerad lista på vilken information som en transaktionsrapportering till den behöriga myndigheten måste innehålla (bilaga I till genomförandeförordningen). Förutom de ovan angivna kraven nämns bl.a. information om huruvida avslutet gjordes för egen räkning eller för kunds räkning och var avslutet skedde.

De enskilda medlemsstaterna har därutöver under vissa förutsättningar möjlighet att kräva att ett värdepappersföretag ska rapportera ytterligare information till den behöriga myndigheten. I artikel 12 i genomförandeförordningen anges nämligen två fall där utökade informationskrav är möjliga. För det första får den be-

höriga myndigheten begära in ytterligare information om det med hänsyn till ett finansiellt instruments specifika karaktär eller en enskild marknadsplats särskilda handelsmetoder är nödvändigt för att den behöriga myndigheten skall kunna övervaka att ett värdepappersinstitut driver sin verksamhet hederligt, rättvist och professionellt och på ett sätt så att allmänhetens förtroende upprätthålls. För det andra får den behöriga myndigheten kräva att rapporterna ska innehålla information om kundidentitet. Till skillnad från det första fallet anges inga begränsningar när det gäller en myndighets möjligheter att kräva att rapporterna ska innehålla denna information. Denna senare punkt diskuteras dock fortfarande vid arbetet med att ta fram genomförandebestämmelser och det är inte säkert att den kommer att stå kvar i det slutliga förslaget till genomförandeförordning.

Rapporteringen till den behöriga myndigheten ska i princip ske i elektronisk form. Anledningen till detta är bl.a. att information snabbt ska kunna slussas vidare till behöriga myndigheter i andra medlemsstater när detta är föreskrivet (se nedan). Endast under vissa speciella förhållanden kan den behöriga myndigheten tillåta undantag från denna regel (se artikel 11.1 i genomförandeförordningen).

Av artikel 25.5 framgår att informationen inte nödvändigtvis måste lämnas av värdepappersföretaget självt. Medlemsstaterna ska nämligen föreskriva att informationen i stället kan lämnas

  • av en tredje part som handlar för värdepappersföretagets räkning,
  • genom ett ordermatchnings- eller rapportsystem som godkänts av den behöriga myndigheten, eller
  • av den reglerade marknaden eller av MTF:en i vars system transaktionen genomfördes.

I de fall transaktionen rapporteras direkt till den behöriga myndigheten av en reglerad marknad, en MTF eller ett ordermatchnings- eller rapportsystem får undantag medges från värdepappersföretagets skyldighet enligt artikel 25.3 första stycket.

Enligt artikel 25.3 andra stycket ska den behöriga myndigheten säkerställa att även den behöriga myndigheten för ”den mest relevanta marknaden i termer av likviditet för de aktuella finansiella instrumenten” (dvs. den reglerade marknad där instrumenten har störst likviditet) erhåller informationen. Kommissionen har i

genomförandebestämmelserna angett metoder för hur den likviditetsmässigt mest relevanta marknaden skall fastställas och vilken information som skall lämnas (se artiklarna 8 och 9 i genomförandeförordningen). Det kan noteras att en filial ska rapportera till den behöriga myndigheten i värdmedlemsstaten (jfr artiklar- na 25.6 och 32.7 i MiFID). Den behöriga myndigheten i värdmedlemsstaten ska därefter vidarebefordra informationen till den behöriga myndigheten i filialens hemmedlemsstat om denna inte har avsagt sig informationen (jfr artikel 25.6 i MiFID).

11.2. Rapporteringsskyldigheten i dag

Enligt börs- och clearinglagen ska börsmedlemmar till börsen rapportera avslut som medlemmarna utanför börsen har gjort för egen räkning eller någon annans räkning i de finansiella instrument som noteras vid börsen (4 kap. 4 § börs- och clearingslagen). Rapporteringen ska ske i den ordning och omfattning som börsen bestämmer. Enligt Stockholmsbörsen regler ska medlemmen normalt rapportera sådana avslut inom fem minuter. Har avslutet skett efter börsens stängning ska rapportering normalt ske senast femton minuter före börsens öppnande nästa börsdag. För värdepappersinstitut som inte är börsmedlemmar följer en rapporteringsskyldighet av 1 kap. 7 a § första stycket lagen om värdepappersrörelse.

Bestämmelser om rapporteringsskyldighet för svenska värdepappersinstitut som bedriver gränsöverskridande verksamhet finns i 1 kap. 7 a § andra stycket lagen om värdepappersrörelse. Av denna bestämmelse framgår att svenska värdepappersinstitut är skyldiga att rapportera avslut i finansiella instrument som är föremål för handel på en reglerad marknad inom EES när avslutet skett från en filial i ett annat EES-land eller genom tillhandahållande av gränsöverskridande verksamhet till ett sådant land. Handlas de finansiella instrumenten på en svensk börs eller auktoriserad marknadsplats ska rapporteringen ske dit, annars till Finansinspektionen. Rapporteringen ska ske i den omfattning och på det sätt som Finansinspektionen föreskriver. Av 10 kap. i Finansinspektionens föreskrifter (FFFS 2002:7) om uppföranderegler på värdepappersmarknaden framgår vilka kategorier av finansiella instrument som omfattas av rapporteringsskyldigheten och inom vilken tidsfrist avsluten ska rapporteras. I det fall anmälan ska göras till en svensk börs ska avsluten rapporteras inom fem minuter och i det fall

anmälan ska göras till Finansinspektionen gäller att anmälan ska göras senast kl. 08.00 dagen efter affärsdagen. Om värdepappersinstitutet är skyldigt att anmäla avslut i värdlandet, som gjorts på en börs eller annan reglerad marknad, är institutet inte skyldigt att anmäla avslutet till vare sig svensk börs eller Finansinspektionen.

Det bör framhållas att de huvudsakliga skälen bakom dagens rapporteringsregler är börs- och clearingslagens krav på god genomlysning samt marknadsövervakning. Investeringstjänstedirektivet krav på transaktionsrapportering – och de syften som legat bakom det kravet – har således hittills varit av underordnad betydelse i svensk lagstiftning.

11.3. Genomförande av MiFID:s bestämmelser

11.3.1. En allmän bestämmelse om transaktionsrapportering

Förslag: Ett värdepappersinstitut är ansvarigt för att uppgifter om de transaktioner som institutet har utfört, så snart som möjligt och senast vid slutet av följande arbetsdag, rapporteras till Finansinspektionen om transaktionerna avser finansiella instrument som är upptagna till handel på en reglerad marknad.

Rapporteringen till inspektionen ska innehålla den information som anges i tabell 1 i bilaga I till genomförandeförordningen.

Informationen till inspektionen får lämnas

  • av värdepappersinstitutet självt,
  • genom tredje part som handlar för institutets räkning,
  • genom ett ordermatchnings- eller rapporteringssystem som godkänts av Finansinspektionen, eller
  • genom den reglerade marknad eller MTF där transaktionen genomfördes.

Regeringen eller den myndighet regeringen bestämmer får föreskriva

  • att rapporteringsskyldigheten ska utökas till att även gälla finansiella instrument som inte är upptagna till handel på en reglerad marknad,
  • att en transaktionsrapport ska innehålla information utöver den som krävs enligt bilaga I i genomförandeförordningen om detta med hänsyn till ett finansiellt instruments specifika karaktär

eller en enskild marknadsplats särskilda handelsmetoder är nödvändigt för att inspektionen ska kunna övervaka att ett värdepappersinstitut driver sin verksamhet hederligt, rättvist och professionellt och på ett sätt så att allmänhetens förtroende upprätthålls, och

  • att en transaktionsrapport ska innehålla information om kundidentitet.

Bedömning: Utformningen av ett transaktionsrapporteringssystem bör ske på ett ansvarsfullt sätt i dialog och nära samarbete mellan Finansinspektionen och instituten, där såväl ekonomiska som praktiska konsekvenser för instituten beaktas. Därvid bör inspektionen även beakta vilka system som införs i andra relevanta länder, bl.a. de övriga nordiska och baltiska länderna.

Som redogjorts för ovan är ett värdepappersföretag enligt huvudregeln i MiFID skyldigt att rapportera samtliga transaktioner avseende finansiella instrument som upptagits till handel på en reglerad marknad till den behöriga myndigheten. Informationen kan dock lämnas av någon annan än värdepappersföretaget. Rapporteringsskyldigheten gäller oavsett om transaktionen skett på en reglerad marknad eller inte.

Någon skyldighet för värdepappersinstitut att rapportera till Finansinspektionen på det sätt som beskrivs i MiFID finns inte i dag (med undantag för bestämmelsen i 1 kap. 7 a § andra stycket lagen om värdepappersrörelse). En ny bestämmelse måste därför införas i den nya lagen som ålägger värdepappersinstitut att själva eller av en tredje part som handlar för värdepappersföretagets räkning, genom ett ordermatchnings- eller rapportsystem som godkänts av Finansinspektionen eller av den reglerade marknaden eller av MTF:en i vars system transaktionen genomfördes rapportera om transaktionen till Finansinspektionen. Eftersom det enligt huvudregeln framgår att ett värdepappersinstitut kan rapportera t.ex. genom en reglerad marknad i vars system transaktionen genomfördes anser utredningen att det är överflödigt att införa det frivilliga undantaget i artikel 25.5 andra meningen i MiFID om att medge undantag för institutens rapporteringsskyldighet för det fall rapporten sker genom t.ex. en reglerad marknad. En bestämmelse motsvarande nuvarande 1 kap. 7 a § andra stycket lagen om värdepappersrörelse kommer därmed att bli överflödig och bör inte tas

in i den nya lagen.

1

Formellt innehåller de nya reglerna en väsentlig

ökning av värdepappersinstitutens rapportering till Finansinspektionen, men om man väger in dagens rapporteringsskyldighet till börsen är den praktiska skillnaden något mindre.

När det gäller den närmare utformningen av vilken information som ska lämnas framgår denna av bestämmelserna i genomförandeförordningen.

11.3.2. Ska rapporteringsskyldigheten till Finansinspektionen gå utöver vad som krävs enligt MiFID?

Inledning

I detta avsnitt kommer att diskuteras huruvida det svenska regelverket bör ställas krav på värdepappersinstituten när det gäller rapportering som går utöver de minimikrav som MiFID ställer upp. Det är framför allt frågorna om Sverige bör utnyttja möjligheten att kräva att institutens rapporter till Finansinspektionen ska innehålla kundinformation samt frågan om ytterligare finansiella instrument skall beröras, dvs. inte enbart finansiella instrument som är upptagna till handel på en reglerad marknad.

För att besvara dessa frågor kan det vara av intresse att åter referera till artikel 25.1 i MiFID. Av denna artikel framgår att den behöriga myndigheten ska ha möjlighet att kunna övervaka verksamheten i värdepappersföretagen för att se till att dessa handlar hederligt, rättvist och professionellt och på ett sätt så att marknadens integritet främjas.

Enligt utredningens bedömning innebär detta, för det första, att inspektionen måste ha rimliga möjligheter att kunna kontrollera värdepappersföretagens uppförande i handeln. Det kan t.ex. vara frågan om hur företagen sköter intressekonflikter mellan olika kundkategorier eller mellan olika avdelningar inom företaget, bästa orderutförande, s.k. churning (dvs. omotiverat hög handel i kunders depåer i syfte att skapa courtage) och orderhantering i allmänhet.

För det andra måste inspektionen ha möjligheter att övervaka förekomsten av marknadsmissbruk och därtill närbesläktade missbruk som t.ex. insiderbrott, otillbörlig marknadspåverkan och obehörigt röjande av insiderinformation. Inspektionen bör även

1

Jfr avsnitt 10.4.2.

kunna övervaka s.k. window-dressing, dvs. manipulation av kurser inför månadsskifte, kvartalsskifte och årsskifte, samt s.k. frontrunning.

I vilken mån ett transaktionsrapporteringssystem (TRS) kan bidra till att Finansinspektionen effektivt ska kunna klara av dessa uppgifter beror dels på vilken information inspektionen får tillgång till genom rapporteringen och dels på hur analysen av den insamlade informationen sker. Med tanke på den stora informationsmängd det kommer att bli fråga kommer det sannolikt att krävas utveckling eller inköp av avancerade analysverktyg för att möjliggöra bearbetning av den lagrade informationen.

Transaktionsrapporteringssystem

En arbetsgrupp inom Finansinspektionen har i en preliminär studie tagit fram två alternativa förslag på hur ett TRS kan komma att se ut. Innan Finansinspektionens förslag redovisas ges nedan en kortare beskrivning av hur Finansinspektionens övervakning ser ut i dag. Beskrivningen är i allt väsentligt en sammanställning av uppgifter som utredningen har fått från inspektionen.

Situationen i dag

I dag saknar Finansinspektionen tillgång till kundinformation när en utredning eller undersökning inom området för marknadsmissbruk eller handelsuppförande ska inledas. Utifrån den begränsade information som inspektionen har tillgång till – i huvudsak genom nyheter och handelsinformation från SIX och Reuters – är det framför allt tre händelser som kan ge inspektionen anledning att initiera en utredning när det gäller marknadsmissbruk. Dessa är prisförändringar, omsättningsförändringar och kurspåverkande nyheter. Förutom då Finansinspektionen själv har upptäckt någon misstänkt oegentlighet kan en utredning inledas efter anmälan från börsen eller allmänheten.

När Finansinspektionen inleder en marknadsmissbruksutredning analyseras först händelsen. Om det handlar om ett eventuellt insiderbrott begärs information från de berörda företagen om vilka personer som haft tillgång till insiderinformation och vid vilken tidpunkt de fick tillgång till denna information (s.k. loggböcker).

Denna begäran skickas och besvaras manuellt. Förfarandet tar normalt 1–2 veckor. Därefter begär Finansinspektionen in avräkningsnotor från värdepappersinstituten. Dessa rapporteras elektroniskt till inspektionens Notasystem. Normalt tar det 3–4 veckor för Finansinspektionen att få in korrekta avräkningsnotor från samtliga svenska värdepappersinstitut.

När Finansinspektionen fått tillgång till alla avräkningsnotor kan analysen av handeln påbörjas. Information om de personer som haft tillgång till insiderinformation, deras kopplingar till närstående bolag etc., matas in manuellt i ett särskilt program, Notasystemet. Därefter utförs en matchning av de personer som haft insiderinformation mot dem som handlat. Analysen sker huvudsakligen manuellt, med visst stöd av kalkylprogram som Excel. Arbetet är därmed tidsödande och inspektionen hinner i regel inte med mer än 10–15 sådana analyser av handeln per år.

När det gäller undersökningar av aktörernas uppförande i handeln bedömer Finansinspektionen att den information som inspektionen i dag har tillgång till är otillräcklig för att undersökningarna ska kunna genomföras effektivt. Finansinspektionen saknar dessutom ändamålsenliga analysverktyg för att bearbeta den handelsinformation som begärs in. En undersökning av uppförandet i handeln blir därigenom resurskrävande. Bristande resurser i kombination med att marknadsmissbruksutredningar har haft högre prioritet har inneburit att inspektionen endast undantagsvis genomfört undersökningar av den här typen. Utredningar har dock genomförts i fall då det funnits en direkt koppling till ett marknadsmissbruksärende och där inspektionen genom det ärendet fått anledning att misstänka att värdepappersinstituten haft bristande rutiner eller brustit i uppförandet i handeln.

Vad är en transaktion?

Enligt definitionen i artikel 5 i genomförandeförordningen avses med transaktion ett köp eller en försäljning av ett finansiellt instrument. Under arbetets gång med att ta fram genomförandebestämmelser på detta område har man velat avgränsa tillämpningsområdet för när rapporteringsskyldigheten ska gälla. T.ex. bör i normalfallet inte aktielån, återköpstransaktioner och lösen av optioner anses som en transaktion.

En fråga som uppkommit i utredningens arbete har varit hur begreppet transaktion ska tolkas och vilka led i en ”transaktion” som ska rapporteras. Några exempel kan illustrera problemet.

Exempel 1

Ett värdepappersinstitut måste ibland vända sig till flera säljare (köpare) vid olika tillfällen för att kunna tillgodose en köpares (säljares) order. Kund 1 önskar t.ex. köpa aktier i ett bolag och värdepappersinstitut 1 sammanför köpordern med två säljorder från kund 2 och 3. Varje försäljningstillfälle måste med hänsyn till genomförandeförordningens lydelse innebära en transaktion. Såväl en köporder som en säljorder kan därmed ge upphov till ett flertal transaktioner med olika motparter och utsträckta över flera handelsdagar. Om institutet i exemplet skulle ha genomfört köparens order på börsen genom att köpa aktier vid två olika tillfällen skulle vart och ett av köpen ha utgjort en transaktion som ska rapporteras.

Några sakkunniga i utredningen delar inte utredningens slutsats ovan om vad som ska anses vara en transaktion. Ett problem med en sådan tolkning skulle nämligen vara att det ofta inte är känt vem den slutliga kunden är när avslutet görs; så är t.ex. fallet när ett fondbolag lämnar in en order som först när den är utförd i sin helhet fördelas på ett antal av de fonder som fondbolaget förvaltar. I stället anser de att definitionen av en transaktion bör tolkas utifrån ”kundens synvinkel” och att det därför ska vara avräkningsnotan som utgör grund för rapporteringen av en transaktion. Om t.ex. ett värdepappersinstitut har utfört en köporder om 1 000 aktier genom att kl. 10.00 köpa 500 aktier och kl. 13.00 köpa ytterligare 500 aktier så skulle det endast vara fråga om en transaktion som skedde kl. 13.00. Som framgått ovan anser dock utredningen att det i ett sådant fall är fråga om åtminstone två transaktioner som har utförts

Kund 1

VPI 1

Kund 2

Kund 3

Kund 1 Kund 1

VPI 1 VPI 1

Kund 2 Kund 2

Kund 3 Kund 3

vid två olika tillfällen (se vidare under rubriken Spårbarhet mellan transaktion och avräkningsnota).

2

Exempel 2

Det kan också finnas flera led mellan slutkunder på köpsidan och slutkunder på säljsidan. Värdepappersinstitut 1 har t.ex. fått en order från kund 1 att i kommission köpa aktier i ett bolag som är upptaget till handel på en reglerad marknad där institut 2 är medlem. Institut 1 vidarebefordrar ordern till institut 2 som lägger ut ordern på den reglerade marknaden där institut 3 säljer aktier på uppdrag av kund 2. En fråga är i detta fall om samtliga led är att anse som transaktioner i MiFID:s mening eller om endast transaktionen på den reglerade marknaden är att anse som en transaktion. En annan fråga är vilket värdepappersinstitut som är skyldigt att rapportera transaktionen. Utgångspunkten är att varje led där det sker ett köp eller en försäljning är en transaktion i genomförandeförordningens mening och att det institut som utfört en transaktion ska rapportera den.

Om institut 2 i exemplet ovan genomför köpet för institut 1:s räkning men i eget namn, dvs. i kommission, blir institut 2 kommissionär i förhållande till institut 1. Aktierna köps således av institut 1 och en transaktion har därmed ägt rum. De blir naturligtvis samma resultat om institut 1 direkt köper aktierna av institut 2. Man kan se saken så att institut 1 – som ju är kommissionär i förhållande till kund 1 – genom självinträde säljer aktierna vidare till kund 1. Härmed har ytterligare en transaktion skett. I detta exempel har institut 1 utfört två transaktioner, en transaktion för egen räkning på marknadsplatsen och en transaktion med kunden som köpare. Båda transaktionerna ska rapporteras av institut 1.

Man kan också tänka sig att institut 1 vidarebefordrar ordern till institut 2 som utför transaktionen på marknadsplatsen direkt för

2

Om värdepappersinstitutet har utfört ordern genom att ha köpt 100 aktier vardera av tio

kunder så har tio transaktioner skett.

Kund 1

VPI 1

Kund 2

VPI 2

VPI 3

Kundorder Vidarebefordran

Reglerad marknad

Kundorder

Kund 1 Kund 1

VPI 1 VPI 1

Kund 2 Kund 2

VPI 2 VPI 2

VPI 3 VPI 3

Kundorder Vidarebefordran

Reglerad marknad

Kundorder

intstitut 1:s kunds räkning. Då har endast en transaktion ägt rum. Institut 1 kan i detta fall endast anses ha tagit emot och vidarebefordrat order till institut 2 som har utfört den. Institut 1 som inte har utfört någon order är inte skyldig att rapportera den. Denna skyldighet åvilar institut 2.

Hur många transaktioner en order ger upphov till och vilket institut som är rapporteringsskyldigt beror således i viss mån på hur instituten behandlar affären.

Spårbarhet mellan transaktion och avräkningsnota

För att kunna undersöka om handeln i varje enskilt fall gått till i enlighet med gällande regler måste i princip alla underliggande transaktioner kunna spåras till uppgifterna i avräkningsnotan. I dag saknas ofta en omedelbar spårbarhet mellan de transaktioner som genomförs av värdepappersinstituten och de avräkningsnotor som rapporteras in. Anledningen till detta är att en avräkningsnota kan, vara hänförlig till flera olika transaktioner och kan i sin tur härstamma från flera olika handelsdagar med mycket långa kedjor av bokningar mellan avsluten och avräkningsnotorna. Ett institut kan t.ex. ha genomfört flera köp till olika kurser under flera dagar och därefter bokat ut den till kunden med en transaktionstidpunkt och ett pris motsvarande snittpriset för de olika transaktionerna. Denna senare tidpunkt och snittpriset är vad som anges på avräkningsnotan. Ett liknande problem uppstår om flera kunders order buntas ihop och genomförs på börsen och därefter fördelas ut på slutkunderna vid dagens slut.

På grund av att orderhanteringen och handeln är strukturerad på detta sätt kan en del av värdepappersinstitutens system inte automatiskt urskilja exakt vilka transaktioner som genomförts på en marknadsplats som hör ihop med varje enskild kund. Utan en sådan koppling mellan kundidentitet och transaktioner har Finansinspektionen inte möjlighet att kontrollera hur och när olika kunder handlar, vilka kunder som ofta interagerar med varandra med otillbörligt syfte, samt kontrollera hur värdepappersföretagens fördelning av priser och affärer till olika kunder efterlevs.

Det finns även andra nackdelar med ovan beskrivna handelsstruktur än svårigheterna att rapportera transaktionerna med kundidentitet. Även om strukturen är kostnadseffektiv går det inte att bortse från att den också ger möjlighet till missbruk. Om man som

utgångspunkt tänker sig att ett värdepappersinstitut genomför en rad köp och försäljningar i samma värdepapper under en eller flera dagar och dessa går med vinst. När sedan fördelningen skall ske skulle institutet eller den förvaltare som lämnat ordern kunna lägga en del av affärerna på en prioriterad eller på något sätt närstående kund. För de fall affärerna inte lett till vinst skulle institutet eller förvaltaren kunna välja att inte lägga några affärer på den prioriterade/närstående kunden. Om det inte finns någon automatisk koppling mellan identiteten på den kund som lagt orderna och transaktionerna skulle ett sådant beteende inte kunna upptäckas. Även om förutsättningarna i exemplet ändras så att enbart köp och inga försäljningar skett skulle möjligheten att fördela transaktionerna vid en senare tidpunkt när marknadspriset är ett annat än det kända inköpspriset möjliggöra samma typ av missbruk.

3

Två olika sorters transaktionssystem

Som utredningen ovan har anfört kommer bestämmelserna i MiFID att medföra att ett nytt TRS sannolikt måste utvecklas. Detta kommer att medföra kostnader, såväl för Finansinspektionen som för värdepappersinstituten, oavsett om det rör sig om ett system med den minsta mängd information som MiFID kräver, eller ett system med utökad informationsmängd. Vid en behovs- och kostnadsanalys är det från utredningens utgångspunkter därför inte i första hand relevant att jämföra mellan dagens situation och ett nytt TRS. Det är i stället mer relevant att jämföra ett system som utgår från MiFID:s minimikrav med system som går utöver dessa minimikrav (men givetvis inom ramen för vad MiFID medger). Finansinspektionens arbetsgrupp har i en preliminär studie skisserat två stiliserade TRS, ett minimialternativ (TRS-) och ett utökat alternativ (TRS+).

TRS-

Finansinspektionens TRS- utgår från den minimitolkning av kraven i MiFID och genomförandebestämmelserna som inspektionen erhållit från vissa branschföreträdare. Det är dock tveksamt enligt

3

Fondkommissionsutredningen har behandlat en liknande problematik vid kommissionärers

självinträden i SOU 2005:120 s. 201 ff.

Finansinspektionens preliminära tolkning av MiFID och genomförandeförordningen om ett TRS- är förenligt med de ställda minimikraven.

4

Systemet innebär bl.a. följande.

  • Ingen orderinformation rapporteras.
  • Endast transaktionen vid den reglerade marknaden rapporteras automatiskt.
  • Ingen kundinformation rapporteras automatiskt.
  • Avräkningsnotor tas in i efterhand vid utredningar.
  • Ingen koppling kommer att finnas mellan transaktioner och avräkningsnotor.

Enligt Finansinspektionens preliminära bedömning skulle ett TRS-, som saknar automatisk rapportering av kundinformation och spårbarhet mellan transaktion och kund, inte medföra någon större förbättring av övervakningsmöjligheterna mot i dag. Ett sådant system skulle i princip endast kunna upptäcka och utreda marknadsmissbruk. Utan spårbarhet mellan transaktion och kund skulle inspektionen fortfarande sakna möjlighet att kontrollera exakt hur och när olika kunder handlar, vilka kunder som ofta interagerar med varandra med otillbörligt syfte samt kontrollera värdepappersinstitutens fördelning av priser och affärer till olika kunder efterlevs.

TRS+

Det mer utökade alternativ som Finansinspektionen skisserat (TRS+) innebär bl.a. följande.

  • Ingen orderinformation rapporteras.
  • Alla transaktioner rapporteras.
  • Kundinformation finns angiven på varje enskild transaktion.

Finansinspektionen har uppgett att när det gäller marknadsmissbruk kommer antalet ärenden där inspektionen skulle ha kapacitet att granska handeln kraftigt att öka eftersom inspektionen redan inledningsvis skulle ha all information om handel tillgänglig. T.ex. skulle systemet rutinmässigt kunna ta fram de tio största kunderna

4

Svenska fondhandlareföreningen har dock ansett att även TRS- går längre än vad MiFID

kräver då det identifierar transaktionen med avslut på den reglerade marknaden. Föreningen förordar i stället att transaktionen ses ur kundens synvinkel och identifieras genom avräkningsnotan.

i handeln tiden före en kurspåverkande nyhet. Antalet ärenden där handeln granskas kommer således att öka om kundinformationen rapporteras. Antalet misstänkta transaktioner kan dessutom avgränsas bättre eftersom man direkt kan undersöka vilka kunder som har köpt stora poster, när och hur de köpt aktierna samt vilka beteendemönster dessa kunder haft tidigare. Finansinspektionen skulle således mer effektivt kunna hitta misstänkta transaktioner och inspektionen skulle snabbare kunna lämna över misstänkta ärenden till Ekobrottsmyndigheten.

När det gäller värdepappersinstitutens uppförande i handeln skulle Finansinspektionen regelbundet kunna granska institutens fördelning av priser och affärer till olika kunder (dvs. kontrollera om de uppfyller kraven när det gäller intressekonfliktshantering, bästa orderutförande etc.), om jämförbara order har utförts i tidsordning, hur kommissionsbestämmelserna följs och vilka kunder vars konton har misstänkt omotiverat hög handel m.m.

Krav på spårbarhet mellan transaktion och kund torde sannolikt även indirekt bidra till ett förstärkt konsumentskydd genom att branschens incitament för att hantera alla kunder hederligt och rättvist förstärks, dvs. en ökad allmänprevention.

Vissa synpunkter från Svenska fondhandlareföreningen

Utredningen har fått synpunkter från Svenska fondhandlareföreningen när det gäller Finansinspektionens förslag till ett utökat transaktionsrapporteringssystem.

Enligt föreningen kommer MiFID:s regler om bästa orderutförande, liksom förslaget till ny kommissionslag, att innebära att instituten i efterhand är skyldiga att kunna redogöra för när och hur en order mottogs, vidarebefordrades till olika handelsplatser, utfördes (helt eller delvis) och slutligen bokades ut på en kundnota. Detta gäller för övrigt i stor utsträckning redan i dag. Att kräva att denna spårning ska gå att utföra genom de uppgifter som lämnas i transaktionsrapporteringssystemet är dock inte praktiskt och ekonomiskt genomförbart. Finansinspektionen föreslår nämligen inte att t.ex. orderinformation ska rapporteras i transaktionsrapporteringssystemet.

Enligt föreningen kommer därför inte inspektionen att kunna fullgöra övervakningen av churning, intressekonflikter, bästa orderutförande och orderhantering i allmänhet på grundval av den infor-

mation som Finansinspektionen önskar erhålla genom det föreslagna transaktionsrapporteringssystemet. För att kunna bedöma huruvida churning föreligger måste inspektionen ta hänsyn till storleken på det förvaltade kapitalet samt till kundens avsikter med handeln. Är kunden t.ex. en s.k. day-trader kan omsättningshastigheten i portföljen vara extremt hög utan att det är frågan om churning. För att orderutförande eller orderhantering i allmänhet ska kunna kontrolleras fordras tillgång till uppgifter om kundens orderläggning och sådan information avses inte att samlas in genom transaktionsrapporteringssystemet eller andra löpande rutiner. Det går inte heller att bedöma om en vanlig affär följer reglerna om bästa orderutförande om ordertidpunkt saknas. Detsamma kan sägas om övervakningen av intressekonflikter. Sammanfattningsvis anser föreningen att inspektionens förväntningar på de transaktionsrapporteringssystem som inspektionen föreslagit är kraftigt överdrivna. Enligt föreningen kommer inspektionen inte att ha någon möjlighet att i detalj övervaka värdepappersinstitutens uppförande i handeln m.m. på det sätt som den tänkt sig om inte en mycket stor kontrollapparat, utöver den som MiFID föreskriver, konstrueras.

När det gäller spårbarhet mellan avslut och nota konstaterar föreningen att åtminstone 30 procent av köpen och försäljningarna på Stockholmsbörsen utförs av fjärrmedlemmar, vilka inte står under Finansinspektionens tillsyn. Det medför att i mindre än hälften av alla avslut kommer företrädare för både köp- och säljsidan att stå under tillsyn av inspektionen. I en stor del av resterande avslut rör det sig om order som lämnas till ett svenskt institut av t.ex. en utländsk bank, och inte heller i dessa fall blir slutkunden känd. Om inspektionen önskar övervaka huruvida kunder ”handlar med sig själva” kommer detta därmed attske i betydligt mindre än hälften av alla avslut. Det kan enligt föreningen starkt ifrågasättas, ur konkurrenssynpunkt och med rimliga krav på vettig relation mellan kostnader och nytta, att kräva mycket dyrbara investeringar som endast drabbar vissa institut och där mindre än hälften av affärerna kan följas mellan köpare och säljare på det sätt inspektionen tänkt sig.

När kontrollsystemet utformas är det också viktigt att beakta att instituten är ålagda att övervaka sitt eget beteende i handeln, samt att en liknande övervakningsplikt åvilar börserna. När nu även Finansinspektionen avser att mer noggrant övervaka institutens beteende i handeln bör de olika aktörernas ansvar och arbetsför-

delningen dem emellan noga övervägas så att ett samhällsekonomiskt inoptimalt system undviks.

När det gäller bedömningen av kostnaderna för transaktionsrapporteringssystemet är det även viktigt att man tar hänsyn till den funktionalitet och de personella resurser som krävs för att rätta fel i rapporteringen. Erfarenhetsmässigt sker rättelser i mellan en och två procent av alla kundnotor som skrivs. Ska spårbarhet erhållas mellan avslut och nota kommer de rättelser som uppstår i mellanliggande led att utgöra en betydligt större andel av alla avslut. Med tanke på att Finansinspektionen avser att använda uppgifterna i syfte att upptäcka beteenden som är straffsanktionerade som t.ex. insiderhandel och marknadsmissbruk är det av yttersta vikt att dessa nya uppgifter som kommer inspektionen till handa är fullständigt korrekta. Detta följer både av allmänna rättssäkerhetsskäl som av affärsmässiga skäl från institutens sida. Vid sidan av den rutinmässiga rapporteringen kommer således instituten att få inrätta funktioner som kvalitetskontrollerar och rättar rapporteringen. Detta kommer även att påverka inspektionen, bl.a. genom att informationen inte kan användas förrän skälig tid för rättelser förflutit.

De beteenden som inspektionens förslag syftar till att upptäcka och beivra är enligt föreningen skadliga för värdepappersmarknaden, och därmed för föreningens medlemmar och andra värdepappersinstitut. Instituten är betjänta av att tillsynsmyndigheten har förmåga att svara för sin del av arbetet med att upprätthålla allmänhetens förtroende för marknaden. Det är därför viktigt att kontrollsystemet utformas i samarbete mellan myndigheten och instituten så att detta syfte verkligen uppnås.

Relativa kostnader

Utredningen har inhämtat Finansinspektionens respektive Svenska fondhandlareföreningens preliminära uppskattningar av vad ett TRS- respektive ett TRS+ skulle kosta att införa och fortlöpande driva. Kostnaderna diskuteras mer ingående i avsnitt 17.2 och 17.3. Enligt Finansinspektionens bedömning skulle inspektionens kostnader för ett TRS+ sannolikt inte skilja sig avsevärt från kostnaderna för ett TRS-. Merkostnaderna för värdepappersinstituten av ett utökat transaktionsrapporteringssystem, skulle däremot enligt Fondhandlareföreningens bedömningar kunna bli synner-

ligen betydande. Som utredningen återkommer till i kap. 17.3 kan det röra sig om sammanlagda kostnader om flera hundratals miljoner kr.

Överväganden och förslag

Som framgått ovan medför bestämmelserna i MiFID att Finansinspektionen med stor sannolikhet kommer att behöva införa ett nytt transaktionsrapporteringssystem. Finansinspektionen har hävdat att ett TRS utan automatisk rapportering av kundinformation och utan spårbarhet mellan transaktion och kund inte innebär någon större förbättring av övervakningsmöjligheterna i dag.

Av MiFID följer att Finansinspektionen ska utöva tillsyn över att värdepappersinstituten lever upp till direktivets krav på t.ex. bästa orderutförande och hantering av kundorder. Detta behöver naturligtvis inte nödvändigtvis förutsätta att inspektionen på automatisk väg får tillgång till bl.a. slutkundsidentitet utan kan på samma sätt som i stor utsträckning förutsätts för annan myndighetskontroll ske genom stickprov och andra manuella kontroller. Om Finansinspektionen ska kunna utföra kontrollen optimalt utan tillgång till bl.a. kundidentitet, torde dock en kraftig ökning av manuella kontroller bli nödvändig.

Det finns, enligt utredningens mening, därför starka skäl som stöder inspektionens önskemål om frihet att utforma ett transaktionsrapporteringssystem som går utöver MiFID:s minimikrav. System liknande TRS+ förekommer även i andra länder inom EES, t.ex. Finland, Storbritannien, Tyskland och Österrike. Även Island kommer, enligt vad utredningen har erfarit, införa ett liknande system. I många andra länder förekommer emellertid inte planer på att utöka rapporteringskraven utöver MiFID:s minimibestämmelser.

Samtidigt kommer ett TRS+ att medföra merkostnader för instituten. Hur stora dessa skulle bli går i dagsläget inte med bestämdhet att avgöra. Det kan dock inte uteslutas att de skulle bli så betydande att de allvarligt hämmar de svenska institutens konkurrenskraft inom EES, åtminstone gentemot de länder som har ett mindre omfattande transaktionsrapporteringssystem (se avsnitt 17.3).

Även om fördelarna med ett transaktionsrapporteringssystem som går utöver MiFID:s minimikrav från bl.a. kontrollsynpunkt är

stora, är det enligt utredningens mening av stor vikt att utformning och införande av ett sådant system inte sker på ett sådant sätt att kostnaderna för instituten blir alltför betungande. Det system som Finansinspektionen har skisserat skulle otvivelaktigt leda till synnerligen höga kostnader för instituten, som i belysning av de invändningar som framkommit inte kan anses vara tillräckligt motiverade genom den utredning som hittills förebragts från inspektionens sida. Som framgått ovan föreligger sålunda delade meningar mellan Finansinspektionen och Svenska Fondhandlareföreningen i flera grundläggande frågor, t.ex. vilka möjligheter inspektionen har att övervaka handeln med den information som inspektionen erhåller genom ett TRS+. Ytterligare utredning är därmed nödvändig i denna del och utformningen av ett nytt TRS bör ske på ett ansvarsfullt sätt i dialog och nära samarbete mellan Finansinspektionen och instituten, där såväl ekonomiska som praktiska konsekvenser för instituten beaktas och vägs mot de fördelar som skulle uppstå för inspektionen. Därvid bör inspektionen noggrant följa vilka system som bl.a. de övriga nordiska och baltiska länderna kommer att införa. Detta medför att det enligt utredningens uppfattning är orealistiskt att ett fullt utbyggt TRS kan finnas på plats i samband med att MiFID träder i kraft utan först vid ett senare tillfälle.

Utredningen förordar alltså att Finansinspektionen tillsammans med instituten fortsätter analysen av dessa frågor så att ett resultat kan presenteras för regeringen som underlag för övervägandena om hur långtgående bemyndigande som inspektionen skall erhålla i denna del.

Frågan om rapporteringsskyldigheten ska utsträckas till att gälla även andra finansiella instrument än aktier upptagna till handel på en reglerad marknad

Av direktivet framgår att medlemsländerna har möjlighet att till- lämpa bestämmelserna om rapporteringsskyldighet även på finansiella instrument som inte är upptagna till handel på en reglerad marknad. Bestämmelsen om rapporteringsskyldighet syftar främst till att underlätta för tillsynsmyndigheter att överv